F467320

General Info

Members Datasets Scaffolds Average Seq Length
594 372 1188 117

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100565955|Ga0075436_1005659551
Length 130
Sequence VLRVSDFTWEFELTITIYGIKNCDTMKKARAWLDAHAVAYQFHDYKSAGIARGALEGWARAVGWETLLNRAGRTFRALPAKDQDGLSEKKALALMAAQPSMIKRPVLDVDGKLLVGFKPEQYAKAFGKAR

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
11 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
113 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
198 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
266 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
334 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
335 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
336 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
337 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
339 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
364 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
365 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
366 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
369 2643221583 Caulobacter sp. Root655 Isolate Unclassified
370 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
371 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
372 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 0.34
Rhizoplane 4.21
Rhizosphere 88.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100565955 3300006914 Bacteria 835
2 2214745197 2209111006 Bacteria 17059
3 2214889674 2209111006 Bacteria 569
4 ARcpr5oldR_c000160 3300000041 Bacteria 11755
5 ARSoilYngRDRAFT_c00063 3300000042 Bacteria 17542
6 ARcpr5yngRDRAFT_c000034 3300000043 Bacteria 21574
7 ARSoilOldRDRAFT_c000147 3300000044 Bacteria 11995
8 ARCol0oldRDRAFT_c02558 3300000045 Bacteria 794
9 ARCol0yngRDRAFT_1000347 3300000652 Bacteria 6627
10 JGI24749J21850_1036802 3300002076 Bacteria 711
11 Ga0065717_1002019 3300005276 Bacteria 3571
12 Ga0065716_1001981 3300005277 Bacteria 2539
13 Ga0065704_10002781 3300005289 Bacteria 5624
14 Ga0065712_10001661 3300005290 Bacteria 8971
15 Ga0065715_10008706 3300005293 Bacteria 3028
16 Ga0065707_10091175 3300005295 Bacteria 3992
17 Ga0070676_10013470 3300005328 Bacteria 4480
18 Ga0070690_100691296 3300005330 Bacteria 782
19 Ga0070670_100961124 3300005331 Bacteria 776
20 Ga0070670_101088201 3300005331 Bacteria 729
21 Ga0070666_10550597 3300005335 Bacteria 839
22 Ga0070680_100000616 3300005336 Bacteria 24670
23 Ga0070682_101334671 3300005337 Bacteria 611
24 Ga0070682_101548632 3300005337 Bacteria 571
25 Ga0068868_100103164 3300005338 Bacteria 2310
26 Ga0070660_100014093 3300005339 Bacteria 5755
27 Ga0070660_100537154 3300005339 Bacteria 975
28 Ga0070689_100044803 3300005340 Bacteria 3404
29 Ga0070691_10025503 3300005341 Bacteria 2753
30 Ga0070691_10491702 3300005341 Bacteria 708
31 Ga0070687_100056207 3300005343 Bacteria 2059
32 Ga0070661_100607115 3300005344 Bacteria 885
33 Ga0070661_100819409 3300005344 Bacteria 765
34 Ga0070692_10013927 3300005345 Bacteria 3760
35 Ga0070668_100001842 3300005347 Bacteria 15443
36 Ga0070668_100142687 3300005347 Bacteria 1931
37 Ga0070668_102249084 3300005347 Bacteria 504
38 Ga0070669_100078360 3300005353 Bacteria 2456
39 Ga0070675_100137076 3300005354 Bacteria 2089
40 Ga0070671_100040517 3300005355 Bacteria 3869
41 Ga0070674_100095912 3300005356 Bacteria 2151
42 Ga0070674_101218882 3300005356 Bacteria 669
43 Ga0070673_101712928 3300005364 Bacteria 595
44 Ga0070688_100113846 3300005365 Bacteria 1803
45 Ga0070659_100024619 3300005366 Bacteria 4615
46 Ga0070659_100549322 3300005366 Bacteria 989
47 Ga0070667_100718020 3300005367 Bacteria 925
48 Ga0070667_101049944 3300005367 Bacteria 761
49 Ga0070709_10447549 3300005434 Bacteria 972
50 Ga0070714_100194281 3300005435 Bacteria 1854
51 Ga0070714_100281776 3300005435 Bacteria 1544
52 Ga0070713_101130167 3300005436 Bacteria 757
53 Ga0070710_10229914 3300005437 Bacteria 1184
54 Ga0070701_10030760 3300005438 Bacteria 2658
55 Ga0070711_100691555 3300005439 Bacteria 858
56 Ga0070705_100028421 3300005440 Bacteria 3062
57 Ga0070705_100066836 3300005440 Bacteria 2157
58 Ga0070700_100000664 3300005441 Bacteria 17024
59 Ga0070694_100031946 3300005444 Bacteria 3454
60 Ga0070694_100492022 3300005444 Bacteria 975
61 Ga0070708_100928356 3300005445 Bacteria 817
62 Ga0070663_100166240 3300005455 Bacteria 1702
63 Ga0070663_100270198 3300005455 Bacteria 1351
64 Ga0070678_101182809 3300005456 Bacteria 708
65 Ga0070662_100007680 3300005457 Bacteria 6996
66 Ga0070662_100282180 3300005457 Bacteria 1344
67 Ga0070681_10289295 3300005458 Bacteria 1549
68 Ga0068867_100024962 3300005459 Bacteria 4285
69 Ga0070685_10039811 3300005466 Bacteria 2672
70 Ga0070698_101257356 3300005471 Bacteria 690
71 Ga0074259_10432540 3300005507 Bacteria 1085
72 Ga0070679_100038959 3300005530 Bacteria 4725
73 Ga0070679_100081133 3300005530 Bacteria 3233
74 Ga0070679_101267294 3300005530 Bacteria 683
75 Ga0070684_100112992 3300005535 Bacteria 2437
76 Ga0070697_101578986 3300005536 Bacteria 587
77 Ga0068853_100003829 3300005539 Bacteria 11523
78 Ga0068853_100334253 3300005539 Bacteria 1406
79 Ga0070672_100347899 3300005543 Bacteria 1263
80 Ga0070686_100058274 3300005544 Bacteria 2484
81 Ga0070695_100020855 3300005545 Bacteria 4004
82 Ga0070695_100486937 3300005545 Bacteria 951
83 Ga0070696_100015107 3300005546 Bacteria 5183
84 Ga0070696_101205970 3300005546 Bacteria 639
85 Ga0070693_100081849 3300005547 Bacteria 1926
86 Ga0070693_100085761 3300005547 Bacteria 1888
87 Ga0070665_100797493 3300005548 Bacteria 957
88 Ga0070665_101167462 3300005548 Bacteria 781
89 Ga0070704_100262022 3300005549 Bacteria 1424
90 Ga0068855_101115301 3300005563 Bacteria 824
91 Ga0068855_101125078 3300005563 Bacteria 820
92 Ga0070664_100035390 3300005564 Bacteria 4192
93 Ga0070664_101524914 3300005564 Bacteria 633
94 Ga0068857_100083002 3300005577 Bacteria 2863
95 Ga0068854_101149789 3300005578 Bacteria 693
96 Ga0068856_100431451 3300005614 Bacteria 1338
97 Ga0070702_100028140 3300005615 Bacteria 3043
98 Ga0070702_100924351 3300005615 Bacteria 685
99 Ga0068852_100196226 3300005616 Bacteria 1908
100 Ga0068859_100013817 3300005617 Bacteria 8096
101 Ga0068859_100023591 3300005617 Bacteria 6174
102 Ga0068866_10123530 3300005718 Bacteria 1462
103 Ga0068866_10182501 3300005718 Bacteria 1241
104 Ga0068866_10379843 3300005718 Bacteria 906
105 Ga0068861_100011109 3300005719 Bacteria 6252
106 Ga0068861_101440665 3300005719 Bacteria 674
107 Ga0068863_100391163 3300005841 Bacteria 1359
108 Ga0068858_100167944 3300005842 Bacteria 2068
109 Ga0068860_100176042 3300005843 Bacteria 2068
110 Ga0068860_100519105 3300005843 Bacteria 1191
111 Ga0068862_100001175 3300005844 Bacteria 24658
112 Ga0068862_100012389 3300005844 Bacteria 7051
113 Ga0068862_100069472 3300005844 Bacteria 3040
114 Ga0070717_10485623 3300006028 Bacteria 1116
115 Ga0075363_100274124 3300006048 Bacteria 975
116 Ga0075364_10399456 3300006051 Bacteria 938
117 Ga0070715_10048517 3300006163 Bacteria 1816
118 Ga0070715_10072223 3300006163 Bacteria 1544
119 Ga0070716_101193084 3300006173 Bacteria 611
120 Ga0075362_10039492 3300006177 Bacteria 2075
121 Ga0075362_10218857 3300006177 Bacteria 930
122 Ga0075367_10019559 3300006178 Bacteria 3757
123 Ga0075367_10100363 3300006178 Bacteria 1769
124 Ga0075367_10276712 3300006178 Bacteria 1055
125 Ga0075369_10074307 3300006186 Bacteria 1499
126 Ga0075369_10177016 3300006186 Bacteria 981
127 Ga0097621_100013458 3300006237 Bacteria 6098
128 Ga0068871_100034631 3300006358 Bacteria 4008
129 Ga0075430_100001497 3300006846 Bacteria 19065
130 Ga0075433_10252369 3300006852 Bacteria 1565
131 Ga0075434_100273651 3300006871 Bacteria 1708
132 Ga0075434_100412338 3300006871 Bacteria 1372
133 Ga0075434_100539810 3300006871 Bacteria 1186
134 Ga0068865_100154503 3300006881 Bacteria 1744
135 Ga0075436_100328868 3300006914 Bacteria 1099
136 Ga0097620_100013818 3300006931 Bacteria 8096
137 Ga0097620_100023591 3300006931 Bacteria 6174
138 Ga0075435_100123067 3300007076 Bacteria 2166
139 Ga0075435_100353812 3300007076 Bacteria 1259
140 Ga0075435_101441635 3300007076 Bacteria 604
141 Ga0099795_10130458 3300007788 Bacteria 1014
142 Ga0105250_10627836 3300009092 Bacteria 500
143 Ga0105240_11162211 3300009093 Bacteria 819
144 Ga0105240_11844522 3300009093 Bacteria 630
145 Ga0111539_10000173 3300009094 Bacteria 74781
146 Ga0111539_12394325 3300009094 Bacteria 612
147 Ga0105247_10237957 3300009101 Bacteria 1239
148 Ga0105247_10342087 3300009101 Bacteria 1050
149 Ga0114129_11985533 3300009147 Bacteria 704
150 Ga0105243_10018869 3300009148 Bacteria 5229
151 Ga0105243_10359149 3300009148 Bacteria 1340
152 Ga0105241_10041671 3300009174 Bacteria 3470
153 Ga0105241_10666185 3300009174 Bacteria 947
154 Ga0105242_10071044 3300009176 Bacteria 2888
155 Ga0105248_10172536 3300009177 Bacteria 2438
156 Ga0105237_10064869 3300009545 Bacteria 3648
157 Ga0105237_10098866 3300009545 Bacteria 2909
158 Ga0105238_10267884 3300009551 Bacteria 1688
159 Ga0105238_10791034 3300009551 Bacteria 964
160 Ga0105249_10031510 3300009553 Bacteria 4796
161 Ga0105249_10457867 3300009553 Bacteria 1315
162 Ga0105239_10064952 3300010375 Bacteria 4007
163 Ga0105239_10088796 3300010375 Bacteria 3408
164 Ga0105239_11306246 3300010375 Bacteria 837
165 Ga0105239_11778250 3300010375 Bacteria 714
166 Ga0105246_10431156 3300011119 Bacteria 1103
167 Ga0105246_11852676 3300011119 Bacteria 578
168 Ga0157341_1002928 3300012494 Bacteria 1162
169 Ga0157339_1045891 3300012505 Bacteria 563
170 Ga0157371_11025420 3300013102 Bacteria 630
171 Ga0157374_10095124 3300013296 Bacteria 2848
172 Ga0157374_12610788 3300013296 Bacteria 533
173 Ga0157378_11227733 3300013297 Bacteria 790
174 Ga0163162_10007926 3300013306 Bacteria 10355
175 Ga0163162_10010575 3300013306 Bacteria 8975
176 Ga0157372_10147012 3300013307 Bacteria 2718
177 Ga0157372_10483242 3300013307 Bacteria 1444
178 Ga0157375_10035626 3300013308 Bacteria 4752
179 Ga0157375_10168732 3300013308 Bacteria 2335
180 Ga0157380_10293138 3300014326 Bacteria 1495
181 Ga0157377_10624975 3300014745 Bacteria 772
182 Ga0157379_10160924 3300014968 Bacteria 2026
183 Ga0157379_10566355 3300014968 Bacteria 1058
184 Ga0157376_10125199 3300014969 Bacteria 2284
185 Ga0157376_12285802 3300014969 Bacteria 580
186 Ga0163161_10079572 3300017792 Bacteria 2410
187 Ga0163161_11136711 3300017792 Bacteria 673
188 Ga0163161_11152406 3300017792 Bacteria 668
189 Ga0213873_10244876 3300021358 Bacteria 567
190 Ga0213876_10036004 3300021384 Bacteria 2611
191 Ga0213875_10000011 3300021388 Bacteria 332447
192 Ga0207697_10012186 3300025315 Bacteria 3614
193 Ga0207642_10067651 3300025899 Bacteria 1687
194 Ga0207642_10098659 3300025899 Bacteria 1461
195 Ga0207642_10296289 3300025899 Bacteria 936
196 Ga0207680_10337847 3300025903 Bacteria 1056
197 Ga0207680_10741627 3300025903 Bacteria 704
198 Ga0207647_10006251 3300025904 Bacteria 8674
199 Ga0207685_10037361 3300025905 Bacteria 1788
200 Ga0207645_10067436 3300025907 Bacteria 2287
201 Ga0207645_10377111 3300025907 Bacteria 952
202 Ga0207654_10198937 3300025911 Bacteria 1318
203 Ga0207707_10223895 3300025912 Bacteria 1637
204 Ga0207671_10047215 3300025914 Bacteria 3187
205 Ga0207671_10284894 3300025914 Bacteria 1304
206 Ga0207693_10013736 3300025915 Bacteria 6524
207 Ga0207663_10488292 3300025916 Bacteria 955
208 Ga0207660_10975642 3300025917 Bacteria 691
209 Ga0207662_10002365 3300025918 Bacteria 9453
210 Ga0207657_10020996 3300025919 Bacteria 6157
211 Ga0207657_10076546 3300025919 Bacteria 2822
212 Ga0207657_10623665 3300025919 Bacteria 840
213 Ga0207649_10505434 3300025920 Bacteria 920
214 Ga0207652_10379214 3300025921 Bacteria 1276
215 Ga0207652_10492006 3300025921 Bacteria 1104
216 Ga0207652_10947813 3300025921 Bacteria 758
217 Ga0207681_10393873 3300025923 Bacteria 1117
218 Ga0207694_10155961 3300025924 Bacteria 1841
219 Ga0207694_10499280 3300025924 Bacteria 1019
220 Ga0207650_10366554 3300025925 Bacteria 1188
221 Ga0207659_10016139 3300025926 Bacteria 4855
222 Ga0207659_10916157 3300025926 Bacteria 754
223 Ga0207687_10420836 3300025927 Bacteria 1102
224 Ga0207687_11829249 3300025927 Bacteria 520
225 Ga0207664_10352807 3300025929 Bacteria 1302
226 Ga0207664_10997645 3300025929 Bacteria 750
227 Ga0207644_10201166 3300025931 Bacteria 1571
228 Ga0207690_10005582 3300025932 Bacteria 7432
229 Ga0207706_10010936 3300025933 Bacteria 8277
230 Ga0207686_10144319 3300025934 Bacteria 1649
231 Ga0207709_10039857 3300025935 Bacteria 2809
232 Ga0207709_10074698 3300025935 Bacteria 2164
233 Ga0207709_10135681 3300025935 Bacteria 1684
234 Ga0207670_10022309 3300025936 Bacteria 3921
235 Ga0207669_10027011 3300025937 Bacteria 3134
236 Ga0207669_10063444 3300025937 Bacteria 2281
237 Ga0207704_10355221 3300025938 Bacteria 1142
238 Ga0207665_10233916 3300025939 Bacteria 1351
239 Ga0207665_10940009 3300025939 Bacteria 687
240 Ga0207691_10106675 3300025940 Bacteria 2494
241 Ga0207689_10207174 3300025942 Bacteria 1620
242 Ga0207679_10036800 3300025945 Bacteria 3474
243 Ga0207667_10745929 3300025949 Bacteria 979
244 Ga0207667_10910795 3300025949 Bacteria 871
245 Ga0207651_10109378 3300025960 Bacteria 2071
246 Ga0207668_10045364 3300025972 Bacteria 2997
247 Ga0207668_10472130 3300025972 Bacteria 1074
248 Ga0207668_11226892 3300025972 Bacteria 674
249 Ga0207640_10161307 3300025981 Bacteria 1659
250 Ga0207658_10359229 3300025986 Bacteria 1270
251 Ga0207658_12027273 3300025986 Bacteria 523
252 Ga0207677_10489004 3300026023 Bacteria 1062
253 Ga0207703_10028460 3300026035 Bacteria 4405
254 Ga0207703_10586978 3300026035 Bacteria 1053
255 Ga0207678_10015844 3300026067 Bacteria 6625
256 Ga0207678_10018846 3300026067 Bacteria 6061
257 Ga0207708_10002092 3300026075 Bacteria 14690
258 Ga0207702_10870314 3300026078 Bacteria 892
259 Ga0207648_10049509 3300026089 Bacteria 3676
260 Ga0207674_10062461 3300026116 Bacteria 3762
261 Ga0207675_100018465 3300026118 Bacteria 6505
262 Ga0207683_10061724 3300026121 Bacteria 3299
263 Ga0207698_11074062 3300026142 Bacteria 817
264 Ga0209966_1002229 3300027695 Bacteria 3239
265 Ga0209998_10008649 3300027717 Bacteria 2110
266 Ga0209813_10103731 3300027866 Bacteria 971
267 Ga0209974_10004573 3300027876 Bacteria 4922
268 Ga0207428_10000303 3300027907 Bacteria 65124
269 Ga0268266_10860137 3300028379 Bacteria 877
270 Ga0268265_10000249 3300028380 Bacteria 61376
271 Ga0268265_10088980 3300028380 Bacteria 2461
272 Ga0268265_10154212 3300028380 Bacteria 1941
273 Ga0268264_10000399 3300028381 Bacteria 62094
274 Ga0268264_10105766 3300028381 Bacteria 2455
275 Ga0268264_11075976 3300028381 Bacteria 812
276 Ga0265332_10078596 3300031238 Bacteria 1401
277 Ga0265325_10000029 3300031241 Bacteria 103942
278 Ga0265325_10133806 3300031241 Bacteria 1185
279 Ga0307408_100102899 3300031548 Bacteria 2179
280 Ga0265313_10006258 3300031595 Bacteria 8483
281 Ga0265314_10033108 3300031711 Bacteria 3794
282 Ga0307405_10128799 3300031731 Bacteria 1745
283 Ga0307412_10000182 3300031911 Bacteria 44103
284 Ga0307416_100378542 3300032002 Bacteria 1445
285 Ga0307416_100492014 3300032002 Bacteria 1289
286 Ga0307416_100763656 3300032002 Bacteria 1060
287 Ga0307414_10000100 3300032004 Bacteria 63343
288 Ga0316583_10066384 3300032133 Bacteria 1262
289 Ga0373930_0001384 3300034816 Bacteria 3593
290 Ga0373948_0000722 3300034817 Bacteria 4302
291 Ga0373950_0005745 3300034818 Bacteria 1862
292 Ga0373958_0000464 3300034819 Bacteria 4962
293 Ga0373958_0021840 3300034819 Bacteria 1191
294 Ga0373959_0000699 3300034820 Bacteria 5741
295 Ga0373938_0000022 3300034957 Bacteria 20030
296 Ga0373926_0026864 3300035083 Bacteria 2015
297 Ga0373926_0421960 3300035083 Bacteria 528
298 Ga0373928_0000047 3300035084 Bacteria 21023
299 Ga0373934_0085608 3300035086 Bacteria 1268
300 Ga0373940_0000137 3300035088 Bacteria 9375
301 Ga0373944_0000339 3300035089 Bacteria 10505
302 Ga0373944_0011605 3300035089 Bacteria 2416
303 Ga0373949_0000261 3300035090 Bacteria 19624
304 Ga0373949_0027333 3300035090 Bacteria 1341
305 Ga0373951_0021832 3300035091 Bacteria 1471
306 Ga0373952_0000105 3300035092 Bacteria 11290
307 Ga0373923_0003602 3300035111 Bacteria 4994
308 Ga0373932_0002247 3300035112 Bacteria 4945
309 Ga0373932_0092466 3300035112 Bacteria 973
310 Ga0373936_0001218 3300035113 Bacteria 9265
311 Ga0373936_0112072 3300035113 Bacteria 1159
312 Ga0373939_0000521 3300035114 Bacteria 9671
313 Ga0373941_0000221 3300035115 Bacteria 10967
314 Ga0373945_0026855 3300035116 Bacteria 2007
315 Ga0373945_0027800 3300035116 Bacteria 1977
316 Ga0373945_0158702 3300035116 Bacteria 921
317 Ga0373953_0408407 3300035117 Bacteria 598
318 Ga0373954_0203835 3300035118 Bacteria 972
319 Ga0373954_0261645 3300035118 Bacteria 852
320 Ga0373960_0000800 3300035121 Bacteria 6614
321 Ga0373943_0015372 3300035170 Bacteria 3475
322 Ga0373943_0225381 3300035170 Bacteria 1045
323 Ga0373946_0005578 3300035171 Bacteria 4541
324 Ga0373946_0007474 3300035171 Bacteria 3994
325 Ga0373946_0296974 3300035171 Bacteria 798
326 Ga0373955_0086881 3300035172 Bacteria 1776
327 Ga0373955_0284444 3300035172 Bacteria 995
328 Ga0373942_0004105 3300035207 Bacteria 3390
329 Ga0373961_0282171 3300035241 Bacteria 610
330 Ga0373962_0005237 3300035242 Bacteria 3134
331 Ga0373924_0028963 3300035410 Bacteria 2210
332 Ga0373924_0054791 3300035410 Bacteria 1659
333 Ga0373931_0008441 3300035691 Bacteria 4886
334 Ga0373931_1173161 3300035691 Bacteria 525
335 Ga0373935_0061734 3300035692 Bacteria 2399
336 Ga0373935_0084928 3300035692 Bacteria 2062
337 Ga0373935_0467169 3300035692 Bacteria 913
338 Ga0373935_0897083 3300035692 Bacteria 657
339 Ga0373927_0080881 3300035695 Bacteria 2105
340 Ga0373927_0624025 3300035695 Bacteria 712
341 Ga0373933_0005246 3300035724 Bacteria 7064
342 Ga0373947_0023736 3300035725 Bacteria 3569
343 Ga0373947_0356827 3300035725 Bacteria 981
344 Ga0373947_0405996 3300035725 Bacteria 919
345 Ga0373937_0010929 3300036401 Bacteria 7950
346 Ga0373937_0014834 3300036401 Bacteria 6883
347 Ga0373937_0020656 3300036401 Bacteria 5905
348 Ga0316582_0212509 3300036647 Bacteria 1322
349 Ga0373925_0013063 3300037068 Bacteria 6011
350 Ga0373925_0084779 3300037068 Bacteria 2415
351 Ga0395905_0609668 3300037471 Bacteria 993
352 Ga0436364_0728139 3300037853 Bacteria 64829
353 Ga0242419_012715 3300038698 Bacteria 659
354 Ga0436365_1021208 3300039437 Bacteria 1242
355 Ga0436365_1585928 3300039437 Bacteria 4367
356 Ga0436365_1707265 3300039437 Bacteria 2067
357 Ga0436365_1834914 3300039437 Bacteria 757
358 Ga0436360_1052710 3300039438 Bacteria 2519
359 Ga0436360_1365511 3300039438 Bacteria 611
360 Ga0436362_0286894 3300039453 Bacteria 842
361 Ga0436362_0327939 3300039453 Bacteria 877
362 Ga0436362_0452008 3300039453 Bacteria 585
363 Ga0439465_0322139 3300041413 Bacteria 581
364 Ga0451804_0756984 3300041463 Bacteria 563
365 Ga0453684_0701729 3300044712 Bacteria 1099
366 Ga0451576_0041842 3300045051 Bacteria 4841
367 Ga0495617_006471 3300046452 Bacteria 4104
368 Ga0495627_000697 3300046453 Bacteria 25632
369 Ga0495592_0017337 3300046454 Bacteria 5469
370 Ga0495592_0033884 3300046454 Bacteria 3851
371 Ga0495603_0064245 3300046455 Bacteria 2164
372 Ga0495603_0072032 3300046455 Bacteria 2030
373 Ga0495591_050254 3300046458 Bacteria 1142
374 Ga0495641_0014839 3300046461 Bacteria 4197
375 Ga0495641_0038513 3300046461 Bacteria 2233
376 Ga0495651_0000565 3300046462 Bacteria 28643
377 Ga0495651_0004021 3300046462 Bacteria 11241
378 Ga0495651_0654721 3300046462 Bacteria 658
379 Ga0495653_0003944 3300046463 Bacteria 11986
380 Ga0495653_0028052 3300046463 Bacteria 4505
381 Ga0495653_0103310 3300046463 Bacteria 2061
382 Ga0495653_0259940 3300046463 Bacteria 1148
383 Ga0495580_0003611 3300046472 Bacteria 13108
384 Ga0495580_0009325 3300046472 Bacteria 7723
385 Ga0495582_0051701 3300046473 Bacteria 2265
386 Ga0495605_0092635 3300046474 Bacteria 1399
387 Ga0495639_0016780 3300046475 Bacteria 3179
388 Ga0495639_0058662 3300046475 Bacteria 1761
389 Ga0495662_0008315 3300046476 Bacteria 5102
390 Ga0495662_0041990 3300046476 Bacteria 2207
391 Ga0495664_0059217 3300046477 Bacteria 2279
392 Ga0495584_0021723 3300046491 Bacteria 3259
393 Ga0495594_0047382 3300046499 Bacteria 2360
394 Ga0495607_0014794 3300046501 Bacteria 5071
395 Ga0495608_0001144 3300046511 Bacteria 18769
396 Ga0495608_0016557 3300046511 Bacteria 5102
397 Ga0495608_0071173 3300046511 Bacteria 2269
398 Ga0495610_0001390 3300046512 Bacteria 21508
399 Ga0495610_0123882 3300046512 Bacteria 1129
400 Ga0495618_0004839 3300046514 Bacteria 8225
401 Ga0495618_0043380 3300046514 Bacteria 2837
402 Ga0495628_0011958 3300046516 Bacteria 7319
403 Ga0495628_0018708 3300046516 Bacteria 5733
404 Ga0495630_0122079 3300046517 Bacteria 1976
405 Ga0495630_0231417 3300046517 Bacteria 1412
406 Ga0495630_0284054 3300046517 Bacteria 1264
407 Ga0495637_0093189 3300046520 Bacteria 1185
408 Ga0495644_0000434 3300046523 Bacteria 18447
409 Ga0495666_0014747 3300046526 Bacteria 3888
410 Ga0495666_0047120 3300046526 Bacteria 2076
411 Ga0495652_0013346 3300046529 Bacteria 7393
412 Ga0495665_0016153 3300046531 Bacteria 4022
413 Ga0495665_0046724 3300046531 Bacteria 2298
414 Ga0495640_0084136 3300046533 Bacteria 2110
415 Ga0495640_0105246 3300046533 Bacteria 1848
416 Ga0495640_0401120 3300046533 Bacteria 842
417 Ga0495586_0016732 3300046535 Bacteria 3901
418 Ga0495586_0164653 3300046535 Bacteria 1251
419 Ga0495587_0001158 3300046536 Bacteria 17349
420 Ga0495587_0050201 3300046536 Bacteria 2468
421 Ga0495645_0001112 3300046543 Bacteria 18197
422 Ga0495645_0631113 3300046543 Bacteria 656
423 Ga0495622_0003676 3300046557 Bacteria 7191
424 Ga0495622_0075529 3300046557 Bacteria 1553
425 Ga0495633_0000643 3300046558 Bacteria 32448
426 Ga0495667_0001683 3300046559 Bacteria 14667
427 Ga0495667_0005122 3300046559 Bacteria 8854
428 Ga0495667_0013412 3300046559 Bacteria 5549
429 Ga0495656_0000842 3300046615 Bacteria 9892
430 Ga0495656_0153106 3300046615 Bacteria 1115
431 Ga0495634_0026225 3300046642 Bacteria 4068
432 Ga0495634_0098236 3300046642 Bacteria 1894
433 Ga0495611_0011455 3300046648 Bacteria 3759
434 Ga0495635_0001131 3300046663 Bacteria 17773
435 Ga0495635_0001379 3300046663 Bacteria 16201
436 Ga0495659_0001236 3300046664 Bacteria 8840
437 Ga0495659_0411906 3300046664 Bacteria 584
438 Ga0495661_0075159 3300046665 Bacteria 1964
439 Ga0495588_0007035 3300046674 Bacteria 5101
440 Ga0495588_0113266 3300046674 Bacteria 1429
441 Ga0495657_0001824 3300046675 Bacteria 18223
442 Ga0495657_0134383 3300046675 Bacteria 1547
443 Ga0495599_0006333 3300046678 Bacteria 7135
444 Ga0495599_0060314 3300046678 Bacteria 2371
445 Ga0495646_0009098 3300046680 Bacteria 6298
446 Ga0495646_0047127 3300046680 Bacteria 2625
447 Ga0495646_0136171 3300046680 Bacteria 1378
448 Ga0495647_0003878 3300046681 Bacteria 4824
449 Ga0495647_0014512 3300046681 Bacteria 2746
450 Ga0495658_0017949 3300046683 Bacteria 3668
451 Ga0495658_0183562 3300046683 Bacteria 1298
452 Ga0495658_0373445 3300046683 Bacteria 907
453 Ga0495658_0499726 3300046683 Bacteria 778
454 Ga0495669_0388003 3300046684 Bacteria 676
455 Ga0495613_0055641 3300046689 Bacteria 2906
456 Ga0495613_0101348 3300046689 Bacteria 2080
457 Ga0495613_0333736 3300046689 Bacteria 1044
458 Ga0495624_0032110 3300046690 Bacteria 3406
459 Ga0495624_0038160 3300046690 Bacteria 3087
460 Ga0495624_0045203 3300046690 Bacteria 2805
461 Ga0495670_0009407 3300046691 Bacteria 4803
462 Ga0495589_0002200 3300046794 Bacteria 10979
463 Ga0495589_0044605 3300046794 Bacteria 2205
464 Ga0495600_0007387 3300046809 Bacteria 6720
465 Ga0495600_0009887 3300046809 Bacteria 5906
466 Ga0495581_0017918 3300047315 Bacteria 4115
467 Ga0495581_0050454 3300047315 Bacteria 2403
468 Ga0495581_0220182 3300047315 Bacteria 1110
469 Ga0495604_0007011 3300047317 Bacteria 8933
470 Ga0495604_0112757 3300047317 Bacteria 1980
471 Ga0495674_0077538 3300047319 Bacteria 2857
472 Ga0495674_0305201 3300047319 Bacteria 1299
473 Ga0495674_1333252 3300047319 Bacteria 537
474 Ga0495676_0133269 3300047321 Bacteria 1790
475 Ga0495680_0042427 3300047322 Bacteria 3609
476 Ga0495680_0045259 3300047322 Bacteria 3475
477 Ga0495680_0079889 3300047322 Bacteria 2472
478 Ga0495675_0005277 3300047444 Bacteria 7869
479 Ga0495679_007486 3300047446 Bacteria 4543
480 Ga0495673_0000039 3300047469 Bacteria 301943
481 Ga0495684_0008255 3300047471 Bacteria 8059
482 Ga0495684_0063099 3300047471 Bacteria 2817
483 Ga0495686_0011592 3300047472 Bacteria 6207
484 Ga0495593_0021550 3300047673 Bacteria 3597
485 Ga0495593_0149510 3300047673 Bacteria 1181
486 Ga0495593_0587499 3300047673 Bacteria 559
487 Ga0495602_0001602 3300048088 Bacteria 22477
488 Ga0495602_0205140 3300048088 Bacteria 1501
489 Ga0495602_0550885 3300048088 Bacteria 799
490 Ga0495614_0052027 3300048089 Bacteria 1755
491 Ga0495614_0184976 3300048089 Bacteria 938
492 Ga0496100_0058023 3300048903 Bacteria 2538
493 Ga0496101_0929440 3300048904 Bacteria 684
494 Ga0496102_0070639 3300048905 Bacteria 3206
495 Ga0496102_0133320 3300048905 Bacteria 2326
496 Ga0496103_0027430 3300048906 Bacteria 3451
497 Ga0496103_0077288 3300048906 Bacteria 2089
498 Ga0496103_0301415 3300048906 Bacteria 1031
499 Ga0496104_0145542 3300048907 Bacteria 2275
500 Ga0496106_0025487 3300048909 Bacteria 4401
501 Ga0496106_0083661 3300048909 Bacteria 2454
502 Ga0496106_0401093 3300048909 Bacteria 1102
503 Ga0496107_0012551 3300048910 Bacteria 5916
504 Ga0496107_0015459 3300048910 Bacteria 5349
505 Ga0496107_0101441 3300048910 Bacteria 2110
506 Ga0496109_0063529 3300048912 Bacteria 3378
507 Ga0496111_0059817 3300048914 Bacteria 2761
508 Ga0496111_0100304 3300048914 Bacteria 2127
509 Ga0496112_0278661 3300048915 Bacteria 1620
510 Ga0496113_0337142 3300048916 Bacteria 1209
511 Ga0496114_1554275 3300048917 Bacteria 550
512 Ga0496114_1577776 3300048917 Bacteria 544
513 Ga0496115_0022402 3300048918 Bacteria 4893
514 Ga0496115_0196332 3300048918 Bacteria 1667
515 Ga0496115_0649987 3300048918 Bacteria 833
516 Ga0496121_0591522 3300048924 Bacteria 686
517 Ga0501032_0464962 3300049569 Bacteria 810
518 Ga0501034_0167714 3300049571 Bacteria 2164
519 Ga0501034_0302186 3300049571 Bacteria 1537
520 Ga0501034_0398765 3300049571 Bacteria 1299
521 Ga0501036_1697263 3300049572 Bacteria 509
522 Ga0501037_0522088 3300049573 Bacteria 804
523 Ga0501047_0109912 3300049581 Bacteria 2640
524 Ga0501047_0288969 3300049581 Bacteria 1483
525 Ga0501067_0016531 3300049583 Bacteria 4077
526 Ga0501068_0559280 3300049584 Bacteria 744
527 Ga0501069_0037388 3300049585 Bacteria 2679
528 Ga0501069_0438398 3300049585 Bacteria 776
529 Ga0501070_0052929 3300049586 Bacteria 3369
530 Ga0501072_0268378 3300049588 Bacteria 1358
531 Ga0501073_0062857 3300049589 Bacteria 2589
532 Ga0501074_0148633 3300049590 Bacteria 1675
533 Ga0501074_0523446 3300049590 Bacteria 840
534 Ga0501223_000200 3300049663 Bacteria 15663
535 Ga0501224_000023 3300049664 Bacteria 62414
536 Ga0501233_002802 3300049668 Bacteria 3096
537 Ga0501235_015650 3300049669 Bacteria 1673
538 Ga0501225_0000397 3300049705 Bacteria 13754
539 Ga0501229_012152 3300049706 Bacteria 1097
540 Ga0501080_0221195 3300049742 Bacteria 1733
541 Ga0501083_0262415 3300049744 Bacteria 1124
542 Ga0501044_0017767 3300049823 Bacteria 7630
543 Ga0501226_000069 3300049853 Bacteria 32276
544 nmdc:mga03683_14914_c1 3300050489 Bacteria 2887
545 nmdc:mga03683_562077_c1 3300050489 Bacteria 556
546 nmdc:mga03n38_10890_c1 3300050490 Bacteria 3367
547 nmdc:mga03n38_831284_c1 3300050490 Bacteria 539
548 nmdc:mga00v17_218367_c1 3300050491 Bacteria 1234
549 nmdc:mga00v17_775241_c1 3300050491 Bacteria 612
550 nmdc:mga0yw44_167991_c1 3300050492 Bacteria 1439
551 nmdc:mga0yw44_421254_c1 3300050492 Bacteria 904
552 nmdc:mga0yw44_539243_c1 3300050492 Bacteria 792
553 nmdc:mga0k408_788411_c1 3300050493 Bacteria 554
554 nmdc:mga06z11_4849_c1 3300050494 Bacteria 5328
555 nmdc:mga06z11_629581_c1 3300050494 Bacteria 653
556 nmdc:mga06z11_68334_c1 3300050494 Bacteria 1872
557 nmdc:mga06z11_82948_c1 3300050494 Bacteria 1724
558 nmdc:mga04h51_122048_c1 3300050495 Bacteria 971
559 nmdc:mga0qj67_379067_c1 3300050509 Bacteria 1142
560 nmdc:mga06r32_1476084_c1 3300050510 Bacteria 620
561 nmdc:mga08y16_172_c1 3300050511 Bacteria 56716
562 nmdc:mga0n895_11539_c1 3300050512 Bacteria 7890
563 nmdc:mga0n895_289365_c1 3300050512 Bacteria 1661
564 nmdc:mga0rr50_216263_c1 3300050513 Bacteria 1581
565 nmdc:mga0rr50_256392_c1 3300050513 Bacteria 1454
566 nmdc:mga08x19_1333344_c1 3300050514 Bacteria 508
567 nmdc:mga0a205_134452_c1 3300050515 Bacteria 2373
568 nmdc:mga0sz30_67979_c1 3300050516 Bacteria 1530
569 Ga0495601_0003798 3300053077 Bacteria 8697
570 Ga0495601_0014348 3300053077 Bacteria 4772
571 Ga0495601_0041952 3300053077 Bacteria 2869
572 Ga0495601_0082870 3300053077 Bacteria 2059
573 Ga0495601_0372110 3300053077 Bacteria 928
574 Ga0495601_1024186 3300053077 Bacteria 518
575 Ga0495612_0000231 3300053078 Bacteria 23627
576 Ga0495612_0001917 3300053078 Bacteria 8566
577 Ga0495612_0204849 3300053078 Bacteria 871
578 Ga0495595_0002883 3300053084 Bacteria 6782
579 Ga0495595_0029771 3300053084 Bacteria 2445
580 Ga0495595_0068900 3300053084 Bacteria 1669
581 Ga0495619_0000799 3300053085 Bacteria 20602
582 Ga0495619_0006432 3300053085 Bacteria 7441
583 Ga0495619_0121560 3300053085 Bacteria 1790
584 Ga0495619_0431804 3300053085 Bacteria 908
585 Ga0500644_0044649 3300053088 Bacteria 1489
586 Ga0500566_0123939 3300053094 Bacteria 1390
587 Ga0500641_0002645 3300053096 Bacteria 6325
588 Ga0500657_091271 3300053728 Bacteria 1282
589 Ga0501084_1253320 3300054114 Bacteria 622
590 2511124159 2510917020 Bacteria 5657507
591 2643925038 2643221583 Bacteria 5218014
592 2792583360 2791355082 Bacteria 5973319
593 2848996125 2848992105 Bacteria 6810864
594 8049296671 8049293176 Bacteria 6128433
595 Ga0075436_100565955
596 2214745197
597 2214889674
598 ARcpr5oldR_c000160
599 ARSoilYngRDRAFT_c00063
600 ARcpr5yngRDRAFT_c000034
601 ARSoilOldRDRAFT_c000147
602 ARCol0oldRDRAFT_c02558
603 ARCol0yngRDRAFT_1000347
604 JGI24749J21850_1036802
605 Ga0065717_1002019
606 Ga0065716_1001981
607 Ga0065704_10002781
608 Ga0065712_10001661
609 Ga0065715_10008706
610 Ga0065707_10091175
611 Ga0070676_10013470
612 Ga0070690_100691296
613 Ga0070670_100961124
614 Ga0070670_101088201
615 Ga0070666_10550597
616 Ga0070680_100000616
617 Ga0070682_101334671
618 Ga0070682_101548632
619 Ga0068868_100103164
620 Ga0070660_100014093
621 Ga0070660_100537154
622 Ga0070689_100044803
623 Ga0070691_10025503
624 Ga0070691_10491702
625 Ga0070687_100056207
626 Ga0070661_100607115
627 Ga0070661_100819409
628 Ga0070692_10013927
629 Ga0070668_100001842
630 Ga0070668_100142687
631 Ga0070668_102249084
632 Ga0070669_100078360
633 Ga0070675_100137076
634 Ga0070671_100040517
635 Ga0070674_100095912
636 Ga0070674_101218882
637 Ga0070673_101712928
638 Ga0070688_100113846
639 Ga0070659_100024619
640 Ga0070659_100549322
641 Ga0070667_100718020
642 Ga0070667_101049944
643 Ga0070709_10447549
644 Ga0070714_100194281
645 Ga0070714_100281776
646 Ga0070713_101130167
647 Ga0070710_10229914
648 Ga0070701_10030760
649 Ga0070711_100691555
650 Ga0070705_100028421
651 Ga0070705_100066836
652 Ga0070700_100000664
653 Ga0070694_100031946
654 Ga0070694_100492022
655 Ga0070708_100928356
656 Ga0070663_100166240
657 Ga0070663_100270198
658 Ga0070678_101182809
659 Ga0070662_100007680
660 Ga0070662_100282180
661 Ga0070681_10289295
662 Ga0068867_100024962
663 Ga0070685_10039811
664 Ga0070698_101257356
665 Ga0074259_10432540
666 Ga0070679_100038959
667 Ga0070679_100081133
668 Ga0070679_101267294
669 Ga0070684_100112992
670 Ga0070697_101578986
671 Ga0068853_100003829
672 Ga0068853_100334253
673 Ga0070672_100347899
674 Ga0070686_100058274
675 Ga0070695_100020855
676 Ga0070695_100486937
677 Ga0070696_100015107
678 Ga0070696_101205970
679 Ga0070693_100081849
680 Ga0070693_100085761
681 Ga0070665_100797493
682 Ga0070665_101167462
683 Ga0070704_100262022
684 Ga0068855_101115301
685 Ga0068855_101125078
686 Ga0070664_100035390
687 Ga0070664_101524914
688 Ga0068857_100083002
689 Ga0068854_101149789
690 Ga0068856_100431451
691 Ga0070702_100028140
692 Ga0070702_100924351
693 Ga0068852_100196226
694 Ga0068859_100013817
695 Ga0068859_100023591
696 Ga0068866_10123530
697 Ga0068866_10182501
698 Ga0068866_10379843
699 Ga0068861_100011109
700 Ga0068861_101440665
701 Ga0068863_100391163
702 Ga0068858_100167944
703 Ga0068860_100176042
704 Ga0068860_100519105
705 Ga0068862_100001175
706 Ga0068862_100012389
707 Ga0068862_100069472
708 Ga0070717_10485623
709 Ga0075363_100274124
710 Ga0075364_10399456
711 Ga0070715_10048517
712 Ga0070715_10072223
713 Ga0070716_101193084
714 Ga0075362_10039492
715 Ga0075362_10218857
716 Ga0075367_10019559
717 Ga0075367_10100363
718 Ga0075367_10276712
719 Ga0075369_10074307
720 Ga0075369_10177016
721 Ga0097621_100013458
722 Ga0068871_100034631
723 Ga0075430_100001497
724 Ga0075433_10252369
725 Ga0075434_100273651
726 Ga0075434_100412338
727 Ga0075434_100539810
728 Ga0068865_100154503
729 Ga0075436_100328868
730 Ga0097620_100013818
731 Ga0097620_100023591
732 Ga0075435_100123067
733 Ga0075435_100353812
734 Ga0075435_101441635
735 Ga0099795_10130458
736 Ga0105250_10627836
737 Ga0105240_11162211
738 Ga0105240_11844522
739 Ga0111539_10000173
740 Ga0111539_12394325
741 Ga0105247_10237957
742 Ga0105247_10342087
743 Ga0114129_11985533
744 Ga0105243_10018869
745 Ga0105243_10359149
746 Ga0105241_10041671
747 Ga0105241_10666185
748 Ga0105242_10071044
749 Ga0105248_10172536
750 Ga0105237_10064869
751 Ga0105237_10098866
752 Ga0105238_10267884
753 Ga0105238_10791034
754 Ga0105249_10031510
755 Ga0105249_10457867
756 Ga0105239_10064952
757 Ga0105239_10088796
758 Ga0105239_11306246
759 Ga0105239_11778250
760 Ga0105246_10431156
761 Ga0105246_11852676
762 Ga0157341_1002928
763 Ga0157339_1045891
764 Ga0157371_11025420
765 Ga0157374_10095124
766 Ga0157374_12610788
767 Ga0157378_11227733
768 Ga0163162_10007926
769 Ga0163162_10010575
770 Ga0157372_10147012
771 Ga0157372_10483242
772 Ga0157375_10035626
773 Ga0157375_10168732
774 Ga0157380_10293138
775 Ga0157377_10624975
776 Ga0157379_10160924
777 Ga0157379_10566355
778 Ga0157376_10125199
779 Ga0157376_12285802
780 Ga0163161_10079572
781 Ga0163161_11136711
782 Ga0163161_11152406
783 Ga0213873_10244876
784 Ga0213876_10036004
785 Ga0213875_10000011
786 Ga0207697_10012186
787 Ga0207642_10067651
788 Ga0207642_10098659
789 Ga0207642_10296289
790 Ga0207680_10337847
791 Ga0207680_10741627
792 Ga0207647_10006251
793 Ga0207685_10037361
794 Ga0207645_10067436
795 Ga0207645_10377111
796 Ga0207654_10198937
797 Ga0207707_10223895
798 Ga0207671_10047215
799 Ga0207671_10284894
800 Ga0207693_10013736
801 Ga0207663_10488292
802 Ga0207660_10975642
803 Ga0207662_10002365
804 Ga0207657_10020996
805 Ga0207657_10076546
806 Ga0207657_10623665
807 Ga0207649_10505434
808 Ga0207652_10379214
809 Ga0207652_10492006
810 Ga0207652_10947813
811 Ga0207681_10393873
812 Ga0207694_10155961
813 Ga0207694_10499280
814 Ga0207650_10366554
815 Ga0207659_10016139
816 Ga0207659_10916157
817 Ga0207687_10420836
818 Ga0207687_11829249
819 Ga0207664_10352807
820 Ga0207664_10997645
821 Ga0207644_10201166
822 Ga0207690_10005582
823 Ga0207706_10010936
824 Ga0207686_10144319
825 Ga0207709_10039857
826 Ga0207709_10074698
827 Ga0207709_10135681
828 Ga0207670_10022309
829 Ga0207669_10027011
830 Ga0207669_10063444
831 Ga0207704_10355221
832 Ga0207665_10233916
833 Ga0207665_10940009
834 Ga0207691_10106675
835 Ga0207689_10207174
836 Ga0207679_10036800
837 Ga0207667_10745929
838 Ga0207667_10910795
839 Ga0207651_10109378
840 Ga0207668_10045364
841 Ga0207668_10472130
842 Ga0207668_11226892
843 Ga0207640_10161307
844 Ga0207658_10359229
845 Ga0207658_12027273
846 Ga0207677_10489004
847 Ga0207703_10028460
848 Ga0207703_10586978
849 Ga0207678_10015844
850 Ga0207678_10018846
851 Ga0207708_10002092
852 Ga0207702_10870314
853 Ga0207648_10049509
854 Ga0207674_10062461
855 Ga0207675_100018465
856 Ga0207683_10061724
857 Ga0207698_11074062
858 Ga0209966_1002229
859 Ga0209998_10008649
860 Ga0209813_10103731
861 Ga0209974_10004573
862 Ga0207428_10000303
863 Ga0268266_10860137
864 Ga0268265_10000249
865 Ga0268265_10088980
866 Ga0268265_10154212
867 Ga0268264_10000399
868 Ga0268264_10105766
869 Ga0268264_11075976
870 Ga0265332_10078596
871 Ga0265325_10000029
872 Ga0265325_10133806
873 Ga0307408_100102899
874 Ga0265313_10006258
875 Ga0265314_10033108
876 Ga0307405_10128799
877 Ga0307412_10000182
878 Ga0307416_100378542
879 Ga0307416_100492014
880 Ga0307416_100763656
881 Ga0307414_10000100
882 Ga0316583_10066384
883 Ga0373930_0001384
884 Ga0373948_0000722
885 Ga0373950_0005745
886 Ga0373958_0000464
887 Ga0373958_0021840
888 Ga0373959_0000699
889 Ga0373938_0000022
890 Ga0373926_0026864
891 Ga0373926_0421960
892 Ga0373928_0000047
893 Ga0373934_0085608
894 Ga0373940_0000137
895 Ga0373944_0000339
896 Ga0373944_0011605
897 Ga0373949_0000261
898 Ga0373949_0027333
899 Ga0373951_0021832
900 Ga0373952_0000105
901 Ga0373923_0003602
902 Ga0373932_0002247
903 Ga0373932_0092466
904 Ga0373936_0001218
905 Ga0373936_0112072
906 Ga0373939_0000521
907 Ga0373941_0000221
908 Ga0373945_0026855
909 Ga0373945_0027800
910 Ga0373945_0158702
911 Ga0373953_0408407
912 Ga0373954_0203835
913 Ga0373954_0261645
914 Ga0373960_0000800
915 Ga0373943_0015372
916 Ga0373943_0225381
917 Ga0373946_0005578
918 Ga0373946_0007474
919 Ga0373946_0296974
920 Ga0373955_0086881
921 Ga0373955_0284444
922 Ga0373942_0004105
923 Ga0373961_0282171
924 Ga0373962_0005237
925 Ga0373924_0028963
926 Ga0373924_0054791
927 Ga0373931_0008441
928 Ga0373931_1173161
929 Ga0373935_0061734
930 Ga0373935_0084928
931 Ga0373935_0467169
932 Ga0373935_0897083
933 Ga0373927_0080881
934 Ga0373927_0624025
935 Ga0373933_0005246
936 Ga0373947_0023736
937 Ga0373947_0356827
938 Ga0373947_0405996
939 Ga0373937_0010929
940 Ga0373937_0014834
941 Ga0373937_0020656
942 Ga0316582_0212509
943 Ga0373925_0013063
944 Ga0373925_0084779
945 Ga0395905_0609668
946 Ga0436364_0728139
947 Ga0242419_012715
948 Ga0436365_1021208
949 Ga0436365_1585928
950 Ga0436365_1707265
951 Ga0436365_1834914
952 Ga0436360_1052710
953 Ga0436360_1365511
954 Ga0436362_0286894
955 Ga0436362_0327939
956 Ga0436362_0452008
957 Ga0439465_0322139
958 Ga0451804_0756984
959 Ga0453684_0701729
960 Ga0451576_0041842
961 Ga0495617_006471
962 Ga0495627_000697
963 Ga0495592_0017337
964 Ga0495592_0033884
965 Ga0495603_0064245
966 Ga0495603_0072032
967 Ga0495591_050254
968 Ga0495641_0014839
969 Ga0495641_0038513
970 Ga0495651_0000565
971 Ga0495651_0004021
972 Ga0495651_0654721
973 Ga0495653_0003944
974 Ga0495653_0028052
975 Ga0495653_0103310
976 Ga0495653_0259940
977 Ga0495580_0003611
978 Ga0495580_0009325
979 Ga0495582_0051701
980 Ga0495605_0092635
981 Ga0495639_0016780
982 Ga0495639_0058662
983 Ga0495662_0008315
984 Ga0495662_0041990
985 Ga0495664_0059217
986 Ga0495584_0021723
987 Ga0495594_0047382
988 Ga0495607_0014794
989 Ga0495608_0001144
990 Ga0495608_0016557
991 Ga0495608_0071173
992 Ga0495610_0001390
993 Ga0495610_0123882
994 Ga0495618_0004839
995 Ga0495618_0043380
996 Ga0495628_0011958
997 Ga0495628_0018708
998 Ga0495630_0122079
999 Ga0495630_0231417
1000 Ga0495630_0284054
1001 Ga0495637_0093189
1002 Ga0495644_0000434
1003 Ga0495666_0014747
1004 Ga0495666_0047120
1005 Ga0495652_0013346
1006 Ga0495665_0016153
1007 Ga0495665_0046724
1008 Ga0495640_0084136
1009 Ga0495640_0105246
1010 Ga0495640_0401120
1011 Ga0495586_0016732
1012 Ga0495586_0164653
1013 Ga0495587_0001158
1014 Ga0495587_0050201
1015 Ga0495645_0001112
1016 Ga0495645_0631113
1017 Ga0495622_0003676
1018 Ga0495622_0075529
1019 Ga0495633_0000643
1020 Ga0495667_0001683
1021 Ga0495667_0005122
1022 Ga0495667_0013412
1023 Ga0495656_0000842
1024 Ga0495656_0153106
1025 Ga0495634_0026225
1026 Ga0495634_0098236
1027 Ga0495611_0011455
1028 Ga0495635_0001131
1029 Ga0495635_0001379
1030 Ga0495659_0001236
1031 Ga0495659_0411906
1032 Ga0495661_0075159
1033 Ga0495588_0007035
1034 Ga0495588_0113266
1035 Ga0495657_0001824
1036 Ga0495657_0134383
1037 Ga0495599_0006333
1038 Ga0495599_0060314
1039 Ga0495646_0009098
1040 Ga0495646_0047127
1041 Ga0495646_0136171
1042 Ga0495647_0003878
1043 Ga0495647_0014512
1044 Ga0495658_0017949
1045 Ga0495658_0183562
1046 Ga0495658_0373445
1047 Ga0495658_0499726
1048 Ga0495669_0388003
1049 Ga0495613_0055641
1050 Ga0495613_0101348
1051 Ga0495613_0333736
1052 Ga0495624_0032110
1053 Ga0495624_0038160
1054 Ga0495624_0045203
1055 Ga0495670_0009407
1056 Ga0495589_0002200
1057 Ga0495589_0044605
1058 Ga0495600_0007387
1059 Ga0495600_0009887
1060 Ga0495581_0017918
1061 Ga0495581_0050454
1062 Ga0495581_0220182
1063 Ga0495604_0007011
1064 Ga0495604_0112757
1065 Ga0495674_0077538
1066 Ga0495674_0305201
1067 Ga0495674_1333252
1068 Ga0495676_0133269
1069 Ga0495680_0042427
1070 Ga0495680_0045259
1071 Ga0495680_0079889
1072 Ga0495675_0005277
1073 Ga0495679_007486
1074 Ga0495673_0000039
1075 Ga0495684_0008255
1076 Ga0495684_0063099
1077 Ga0495686_0011592
1078 Ga0495593_0021550
1079 Ga0495593_0149510
1080 Ga0495593_0587499
1081 Ga0495602_0001602
1082 Ga0495602_0205140
1083 Ga0495602_0550885
1084 Ga0495614_0052027
1085 Ga0495614_0184976
1086 Ga0496100_0058023
1087 Ga0496101_0929440
1088 Ga0496102_0070639
1089 Ga0496102_0133320
1090 Ga0496103_0027430
1091 Ga0496103_0077288
1092 Ga0496103_0301415
1093 Ga0496104_0145542
1094 Ga0496106_0025487
1095 Ga0496106_0083661
1096 Ga0496106_0401093
1097 Ga0496107_0012551
1098 Ga0496107_0015459
1099 Ga0496107_0101441
1100 Ga0496109_0063529
1101 Ga0496111_0059817
1102 Ga0496111_0100304
1103 Ga0496112_0278661
1104 Ga0496113_0337142
1105 Ga0496114_1554275
1106 Ga0496114_1577776
1107 Ga0496115_0022402
1108 Ga0496115_0196332
1109 Ga0496115_0649987
1110 Ga0496121_0591522
1111 Ga0501032_0464962
1112 Ga0501034_0167714
1113 Ga0501034_0302186
1114 Ga0501034_0398765
1115 Ga0501036_1697263
1116 Ga0501037_0522088
1117 Ga0501047_0109912
1118 Ga0501047_0288969
1119 Ga0501067_0016531
1120 Ga0501068_0559280
1121 Ga0501069_0037388
1122 Ga0501069_0438398
1123 Ga0501070_0052929
1124 Ga0501072_0268378
1125 Ga0501073_0062857
1126 Ga0501074_0148633
1127 Ga0501074_0523446
1128 Ga0501223_000200
1129 Ga0501224_000023
1130 Ga0501233_002802
1131 Ga0501235_015650
1132 Ga0501225_0000397
1133 Ga0501229_012152
1134 Ga0501080_0221195
1135 Ga0501083_0262415
1136 Ga0501044_0017767
1137 Ga0501226_000069
1138 nmdc:mga03683_14914_c1
1139 nmdc:mga03683_562077_c1
1140 nmdc:mga03n38_10890_c1
1141 nmdc:mga03n38_831284_c1
1142 nmdc:mga00v17_218367_c1
1143 nmdc:mga00v17_775241_c1
1144 nmdc:mga0yw44_167991_c1
1145 nmdc:mga0yw44_421254_c1
1146 nmdc:mga0yw44_539243_c1
1147 nmdc:mga0k408_788411_c1
1148 nmdc:mga06z11_4849_c1
1149 nmdc:mga06z11_629581_c1
1150 nmdc:mga06z11_68334_c1
1151 nmdc:mga06z11_82948_c1
1152 nmdc:mga04h51_122048_c1
1153 nmdc:mga0qj67_379067_c1
1154 nmdc:mga06r32_1476084_c1
1155 nmdc:mga08y16_172_c1
1156 nmdc:mga0n895_11539_c1
1157 nmdc:mga0n895_289365_c1
1158 nmdc:mga0rr50_216263_c1
1159 nmdc:mga0rr50_256392_c1
1160 nmdc:mga08x19_1333344_c1
1161 nmdc:mga0a205_134452_c1
1162 nmdc:mga0sz30_67979_c1
1163 Ga0495601_0003798
1164 Ga0495601_0014348
1165 Ga0495601_0041952
1166 Ga0495601_0082870
1167 Ga0495601_0372110
1168 Ga0495601_1024186
1169 Ga0495612_0000231
1170 Ga0495612_0001917
1171 Ga0495612_0204849
1172 Ga0495595_0002883
1173 Ga0495595_0029771
1174 Ga0495595_0068900
1175 Ga0495619_0000799
1176 Ga0495619_0006432
1177 Ga0495619_0121560
1178 Ga0495619_0431804
1179 Ga0500644_0044649
1180 Ga0500566_0123939
1181 Ga0500641_0002645
1182 Ga0500657_091271
1183 Ga0501084_1253320
1184 2511124159
1185 2643925038
1186 2792583360
1187 2848996125
1188 8049296671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

18

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9749 3 116
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9583 3 116
8a4k-assembly1.cif.gz_B human gdap1, r282h mutant 0.9458 2 32
8a4j-assembly1.cif.gz_A human gdap1, a247v mutant 0.9428 2 32
8a4j-assembly1.cif.gz_B human gdap1, a247v mutant 0.9424 2 32
ID Description Score Start End Superfamily
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9736 3 116 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9683 3 31 3.40.30.10
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9566 3 116 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9559 3 115 3.40.30.10
3cbuB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9544 4 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1W9JND3-F1-model_v4 deleted 0.9913 3 116
AF-A0A270BW18-F1-model_v4 ArsC family reductase 0.9883 2 116
AF-A0A6A8QK62-F1-model_v4 ArsC family reductase 0.9883 2 113
AF-A0A7V9MYQ8-F1-model_v4 ArsC family reductase 0.9882 3 116
AF-A0A7W7AK81-F1-model_v4 Spx/MgsR family transcriptional regulator 0.988 1 113

Map