F467335

General Info

Members Datasets Scaffolds Average Seq Length
594 241 594 248

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10299340|Ga0157380_102993402
Length 263
Sequence MKQQRRMPRRVFIKGLASSAAGVLLAGCTRMDPPTYGNVLRMGDLFTYKAHRLLLPAHSLAREYDYSDISSVPAIGTTNPADPAKCGFFSDEYGPVYEQLLAKRFADWRLVVEGSVARPRAFSLDELRRMPSRTQITRHTCEEGWSAISQWTGVPLRAVLEAAGVHSSARFVQYYSYDDWADGIDMLDALHPQTILAYGMNGRDLPISHGAPLRLRVEKQLGYKSMKFLRRIVVTDYFDDNGSKGNIQNGWMRLANASVADRD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
224 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
225 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
226 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
233 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
234 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 2.53
Rhizosphere 93.77
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5265137 2162886012 Bacteria 6157
2 JGI24736J21556_1005357 3300001904 Bacteria 2168
3 JGI24736J21556_1013368 3300001904 Bacteria 1325
4 JGI24736J21556_1022349 3300001904 Bacteria 989
5 JGI24741J21665_1002526 3300001915 Bacteria 4725
6 JGI24740J21852_10014992 3300001979 Bacteria 2843
7 JGI24739J22299_10002950 3300001989 Bacteria 6521
8 JGI24737J22298_10015622 3300001990 Bacteria 2456
9 JGI24735J21928_10010809 3300002067 Bacteria 2900
10 JGI24738J21930_10007984 3300002075 Bacteria 2418
11 rootH1_10087869 3300003316 Bacteria 10235
12 rootH2_10272373 3300003320 Unclassified 1149
13 Ga0065714_10153640 3300005288 Bacteria 1091
14 Ga0065704_10080179 3300005289 Unclassified 3988
15 Ga0065712_10000823 3300005290 Bacteria 14394
16 Ga0065712_10027855 3300005290 Bacteria 2156
17 Ga0065715_10090806 3300005293 Bacteria 6440
18 Ga0065715_10149612 3300005293 Bacteria 1745
19 Ga0065707_10277873 3300005295 Bacteria 1055
20 Ga0070658_10000008 3300005327 Bacteria 319912
21 Ga0070658_10002474 3300005327 Bacteria 15441
22 Ga0070658_10042912 3300005327 Bacteria 3654
23 Ga0070658_10518176 3300005327 Bacteria 1031
24 Ga0070676_10000015 3300005328 Bacteria 52703
25 Ga0070676_10087844 3300005328 Unclassified 1898
26 Ga0070676_10177550 3300005328 Bacteria 1382
27 Ga0070683_100213104 3300005329 Bacteria 1835
28 Ga0070683_100223241 3300005329 Bacteria 1790
29 Ga0070670_100015818 3300005331 Bacteria 6476
30 Ga0070670_100124705 3300005331 Bacteria 2223
31 Ga0070670_100127687 3300005331 Bacteria 2195
32 Ga0070670_100266644 3300005331 Unclassified 1494
33 Ga0070670_100325855 3300005331 Unclassified 1346
34 Ga0070677_10115863 3300005333 Bacteria 1203
35 Ga0068869_100050853 3300005334 Bacteria 3005
36 Ga0068869_100205589 3300005334 Bacteria 1554
37 Ga0068869_100357672 3300005334 Bacteria 1191
38 Ga0068869_100547013 3300005334 Bacteria 972
39 Ga0070666_10155208 3300005335 Bacteria 1598
40 Ga0070680_100042765 3300005336 Unclassified 3677
41 Ga0068868_100019741 3300005338 Bacteria 5054
42 Ga0068868_100038928 3300005338 Bacteria 3691
43 Ga0068868_100236041 3300005338 Bacteria 1535
44 Ga0068868_100350412 3300005338 Bacteria 1264
45 Ga0070660_100056566 3300005339 Bacteria 3035
46 Ga0070660_100252486 3300005339 Unclassified 1438
47 Ga0070689_100009063 3300005340 Bacteria 7043
48 Ga0070689_100012455 3300005340 Bacteria 6128
49 Ga0070661_100007515 3300005344 Bacteria 7517
50 Ga0070661_100029702 3300005344 Bacteria 3946
51 Ga0070661_100074220 3300005344 Bacteria 2504
52 Ga0070692_10317777 3300005345 Bacteria 956
53 Ga0070668_100007229 3300005347 Bacteria 8233
54 Ga0070668_100061866 3300005347 Bacteria 2901
55 Ga0070669_100048942 3300005353 Bacteria 3086
56 Ga0070669_100587585 3300005353 Bacteria 932
57 Ga0070675_100072550 3300005354 Bacteria 2858
58 Ga0070675_100255438 3300005354 Bacteria 1535
59 Ga0070675_100377641 3300005354 Unclassified 1261
60 Ga0070671_100028501 3300005355 Bacteria 4598
61 Ga0070673_100000424 3300005364 Bacteria 22339
62 Ga0070673_100069192 3300005364 Unclassified 2828
63 Ga0070673_100209881 3300005364 Bacteria 1681
64 Ga0070673_100382886 3300005364 Bacteria 1254
65 Ga0070688_100008010 3300005365 Bacteria 5717
66 Ga0070688_100017514 3300005365 Bacteria 4114
67 Ga0070688_100203776 3300005365 Bacteria 1385
68 Ga0070659_100106470 3300005366 Bacteria 2260
69 Ga0070667_100055666 3300005367 Bacteria 3340
70 Ga0070667_100097267 3300005367 Bacteria 2539
71 Ga0070667_100247217 3300005367 Bacteria 1594
72 Ga0070667_100290072 3300005367 Bacteria 1471
73 Ga0070667_100332706 3300005367 Bacteria 1372
74 Ga0070701_10021214 3300005438 Bacteria 3096
75 Ga0070701_10053196 3300005438 Bacteria 2106
76 Ga0070711_100073457 3300005439 Bacteria 2416
77 Ga0070700_100040140 3300005441 Bacteria 2864
78 Ga0070694_100125181 3300005444 Unclassified 1849
79 Ga0070694_100278811 3300005444 Bacteria 1274
80 Ga0070694_100417651 3300005444 Bacteria 1053
81 Ga0070663_100655019 3300005455 Bacteria 888
82 Ga0070678_100125227 3300005456 Bacteria 2033
83 Ga0070678_100179378 3300005456 Unclassified 1732
84 Ga0070662_100000449 3300005457 Bacteria 24260
85 Ga0070662_100001866 3300005457 Bacteria 12913
86 Ga0070681_10015536 3300005458 Bacteria 7583
87 Ga0068867_100000210 3300005459 Bacteria 39145
88 Ga0068867_100003116 3300005459 Bacteria 11694
89 Ga0068867_100322649 3300005459 Bacteria 1280
90 Ga0068867_100334252 3300005459 Bacteria 1259
91 Ga0070685_10016226 3300005466 Bacteria 3966
92 Ga0070685_10066053 3300005466 Bacteria 2131
93 Ga0070685_10141975 3300005466 Unclassified 1513
94 Ga0070698_100031725 3300005471 Bacteria 5476
95 Ga0070698_100390706 3300005471 Bacteria 1324
96 Ga0070679_100128667 3300005530 Bacteria 2513
97 Ga0070679_100178533 3300005530 Bacteria 2096
98 Ga0070684_100000961 3300005535 Bacteria 20526
99 Ga0070684_100060808 3300005535 Bacteria 3305
100 Ga0070684_100101342 3300005535 Bacteria 2573
101 Ga0070697_100150102 3300005536 Bacteria 1964
102 Ga0068853_100018610 3300005539 Bacteria 5751
103 Ga0068853_100020619 3300005539 Bacteria 5482
104 Ga0068853_100239368 3300005539 Bacteria 1663
105 Ga0068853_100523873 3300005539 Unclassified 1121
106 Ga0070672_100100312 3300005543 Bacteria 2348
107 Ga0070672_100234807 3300005543 Unclassified 1541
108 Ga0070686_100004719 3300005544 Bacteria 7516
109 Ga0070686_100401212 3300005544 Bacteria 1043
110 Ga0070665_100012386 3300005548 Bacteria 8595
111 Ga0070665_100033852 3300005548 Bacteria 5140
112 Ga0070704_100006533 3300005549 Bacteria 6876
113 Ga0068855_100000066 3300005563 Bacteria 125787
114 Ga0068855_100038975 3300005563 Bacteria 5641
115 Ga0068855_100081841 3300005563 Bacteria 3742
116 Ga0068855_100110104 3300005563 Bacteria 3162
117 Ga0068855_100329255 3300005563 Bacteria 1686
118 Ga0070664_100002746 3300005564 Bacteria 14208
119 Ga0070664_100003622 3300005564 Bacteria 12446
120 Ga0070664_100007635 3300005564 Bacteria 8734
121 Ga0068857_100007917 3300005577 Bacteria 9169
122 Ga0068857_100051779 3300005577 Bacteria 3643
123 Ga0068857_100110261 3300005577 Bacteria 2473
124 Ga0068854_100003441 3300005578 Bacteria 9875
125 Ga0068854_100068317 3300005578 Bacteria 2591
126 Ga0068856_100003461 3300005614 Bacteria 15957
127 Ga0068856_100168450 3300005614 Unclassified 2202
128 Ga0070702_100011307 3300005615 Bacteria 4435
129 Ga0068852_100000071 3300005616 Bacteria 70039
130 Ga0068852_100043899 3300005616 Bacteria 3793
131 Ga0068852_100067765 3300005616 Bacteria 3121
132 Ga0068852_100094991 3300005616 Unclassified 2676
133 Ga0068852_100181544 3300005616 Bacteria 1979
134 Ga0068852_100722847 3300005616 Bacteria 1007
135 Ga0068852_100822370 3300005616 Bacteria 944
136 Ga0068859_100003353 3300005617 Bacteria 16293
137 Ga0068859_100005804 3300005617 Bacteria 12536
138 Ga0068859_100009246 3300005617 Bacteria 9952
139 Ga0068859_100010690 3300005617 Bacteria 9239
140 Ga0068859_100010940 3300005617 Bacteria 9133
141 Ga0068859_100051479 3300005617 Bacteria 4140
142 Ga0068859_100194832 3300005617 Bacteria 2110
143 Ga0068859_100549106 3300005617 Bacteria 1250
144 Ga0068864_100001004 3300005618 Bacteria 23590
145 Ga0068864_100003123 3300005618 Bacteria 13683
146 Ga0068864_100041299 3300005618 Bacteria 3945
147 Ga0068864_100087150 3300005618 Unclassified 2748
148 Ga0068864_100201296 3300005618 Bacteria 1829
149 Ga0068864_100693870 3300005618 Unclassified 994
150 Ga0068866_10331050 3300005718 Bacteria 961
151 Ga0068861_100000084 3300005719 Bacteria 45078
152 Ga0068861_100004245 3300005719 Bacteria 9606
153 Ga0068861_100160589 3300005719 Unclassified 1853
154 Ga0068861_100202682 3300005719 Bacteria 1666
155 Ga0068851_10080472 3300005834 Bacteria 1700
156 Ga0068851_10103712 3300005834 Bacteria 1511
157 Ga0068851_10172812 3300005834 Bacteria 1193
158 Ga0068870_10049077 3300005840 Unclassified 2225
159 Ga0068863_100002861 3300005841 Bacteria 17086
160 Ga0068863_100031147 3300005841 Bacteria 5092
161 Ga0068863_100478402 3300005841 Unclassified 1224
162 Ga0068858_100001593 3300005842 Bacteria 23127
163 Ga0068858_100003200 3300005842 Bacteria 16359
164 Ga0068858_100003959 3300005842 Bacteria 14619
165 Ga0068860_100002159 3300005843 Bacteria 20717
166 Ga0068860_100019671 3300005843 Bacteria 6547
167 Ga0068860_100072861 3300005843 Unclassified 3265
168 Ga0068860_100224996 3300005843 Bacteria 1822
169 Ga0068860_100309201 3300005843 Bacteria 1549
170 Ga0068862_100000397 3300005844 Bacteria 47021
171 Ga0068862_100002089 3300005844 Bacteria 18008
172 Ga0068862_100002390 3300005844 Bacteria 16689
173 Ga0068862_100099692 3300005844 Bacteria 2539
174 Ga0068862_100478382 3300005844 Bacteria 1178
175 Ga0081455_10053881 3300005937 Bacteria 3433
176 Ga0097621_100000308 3300006237 Bacteria 33071
177 Ga0097621_100049355 3300006237 Bacteria 3418
178 Ga0097621_100170478 3300006237 Bacteria 1876
179 Ga0068871_100000046 3300006358 Bacteria 66964
180 Ga0068871_100017127 3300006358 Bacteria 5476
181 Ga0068871_100824194 3300006358 Unclassified 856
182 Ga0075428_100000063 3300006844 Bacteria 86012
183 Ga0075428_100003292 3300006844 Bacteria 17664
184 Ga0075428_100006823 3300006844 Bacteria 12697
185 Ga0075428_100012806 3300006844 Bacteria 9328
186 Ga0075428_100020345 3300006844 Bacteria 7350
187 Ga0075428_100064492 3300006844 Plasmid 4012
188 Ga0075428_100891413 3300006844 Bacteria 944
189 Ga0075430_100003094 3300006846 Bacteria 13901
190 Ga0075430_100008747 3300006846 Bacteria 8545
191 Ga0075430_100170080 3300006846 Bacteria 1813
192 Ga0075430_100451062 3300006846 Unclassified 1061
193 Ga0075431_100000153 3300006847 Bacteria 47318
194 Ga0075431_100010031 3300006847 Bacteria 9515
195 Ga0075431_100024347 3300006847 Bacteria 6202
196 Ga0075431_100029698 3300006847 Bacteria 5628
197 Ga0075433_10297585 3300006852 Bacteria 1429
198 Ga0075429_100007378 3300006880 Bacteria 9543
199 Ga0075429_100010572 3300006880 Bacteria 7982
200 Ga0075429_100052386 3300006880 Bacteria 3551
201 Ga0075429_100141795 3300006880 Bacteria 2104
202 Ga0068865_100000041 3300006881 Bacteria 72569
203 Ga0068865_100648619 3300006881 Bacteria 897
204 Ga0097620_100003353 3300006931 Bacteria 16293
205 Ga0097620_100005804 3300006931 Bacteria 12536
206 Ga0097620_100009246 3300006931 Bacteria 9952
207 Ga0097620_100010690 3300006931 Bacteria 9239
208 Ga0097620_100010940 3300006931 Bacteria 9133
209 Ga0097620_100051480 3300006931 Bacteria 4140
210 Ga0097620_100194820 3300006931 Bacteria 2110
211 Ga0097620_100549133 3300006931 Bacteria 1250
212 Ga0105240_10003822 3300009093 Bacteria 23283
213 Ga0105240_10152567 3300009093 Bacteria 2750
214 Ga0111539_10004806 3300009094 Bacteria 17620
215 Ga0111539_10006853 3300009094 Bacteria 14639
216 Ga0111539_10008355 3300009094 Bacteria 13171
217 Ga0111539_10019225 3300009094 Bacteria 8437
218 Ga0111539_10029782 3300009094 Bacteria 6643
219 Ga0111539_10084743 3300009094 Unclassified 3725
220 Ga0111539_10156418 3300009094 Bacteria 2667
221 Ga0111539_10680187 3300009094 Bacteria 1198
222 Ga0111539_10799356 3300009094 Bacteria 1098
223 Ga0105245_10000244 3300009098 Bacteria 52007
224 Ga0105245_10003333 3300009098 Bacteria 14415
225 Ga0105247_10001916 3300009101 Bacteria 14514
226 Ga0105247_10039067 3300009101 Bacteria 2899
227 Ga0114129_10002649 3300009147 Bacteria 24917
228 Ga0114129_10003090 3300009147 Bacteria 23352
229 Ga0114129_10017297 3300009147 Bacteria 10267
230 Ga0114129_10175222 3300009147 Bacteria 2921
231 Ga0114129_10422097 3300009147 Bacteria 1754
232 Ga0105243_10012589 3300009148 Bacteria 6394
233 Ga0105243_10024998 3300009148 Bacteria 4560
234 Ga0105243_10048482 3300009148 Bacteria 3348
235 Ga0105243_10249475 3300009148 Bacteria 1584
236 Ga0105241_10000217 3300009174 Bacteria 43160
237 Ga0105241_10033710 3300009174 Unclassified 3845
238 Ga0105241_10033715 3300009174 Bacteria 3844
239 Ga0105241_10114987 3300009174 Unclassified 2159
240 Ga0105241_10131113 3300009174 Unclassified 2030
241 Ga0105242_10003079 3300009176 Bacteria 13014
242 Ga0105242_10023218 3300009176 Bacteria 4889
243 Ga0105242_10128337 3300009176 Bacteria 2185
244 Ga0105242_10397212 3300009176 Bacteria 1286
245 Ga0105248_10001781 3300009177 Bacteria 23940
246 Ga0105248_10010569 3300009177 Bacteria 10170
247 Ga0105248_10029951 3300009177 Bacteria 6074
248 Ga0105248_10115500 3300009177 Bacteria 3027
249 Ga0105248_10179508 3300009177 Bacteria 2386
250 Ga0105237_10001818 3300009545 Bacteria 27514
251 Ga0105237_10144032 3300009545 Bacteria 2377
252 Ga0105237_10189439 3300009545 Bacteria 2057
253 Ga0105237_10238219 3300009545 Bacteria 1821
254 Ga0105238_10002068 3300009551 Bacteria 20258
255 Ga0105238_10013185 3300009551 Bacteria 8343
256 Ga0105238_10192709 3300009551 Unclassified 2014
257 Ga0105238_10239965 3300009551 Bacteria 1790
258 Ga0105238_10475684 3300009551 Bacteria 1248
259 Ga0105249_10005396 3300009553 Bacteria 11034
260 Ga0105249_10008641 3300009553 Bacteria 8875
261 Ga0105249_10009842 3300009553 Bacteria 8379
262 Ga0105249_10444090 3300009553 Bacteria 1335
263 Ga0105239_10038845 3300010375 Bacteria 5215
264 Ga0105239_10043033 3300010375 Bacteria 4948
265 Ga0105239_10085224 3300010375 Bacteria 3481
266 Ga0105239_10192996 3300010375 Bacteria 2280
267 Ga0105239_10234507 3300010375 Bacteria 2059
268 Ga0105239_10335242 3300010375 Bacteria 1707
269 Ga0157373_10050797 3300013100 Bacteria 2952
270 Ga0157373_10325157 3300013100 Bacteria 1094
271 Ga0157370_10061358 3300013104 Bacteria 3568
272 Ga0157370_10362725 3300013104 Unclassified 1335
273 Ga0157369_10163629 3300013105 Unclassified 2347
274 Ga0157374_10000137 3300013296 Bacteria 66006
275 Ga0157374_10007556 3300013296 Bacteria 9275
276 Ga0157374_10036591 3300013296 Bacteria 4497
277 Ga0157378_10239322 3300013297 Unclassified 1733
278 Ga0163162_10033551 3300013306 Bacteria 5102
279 Ga0163162_10046070 3300013306 Unclassified 4371
280 Ga0163162_10089871 3300013306 Bacteria 3152
281 Ga0163162_10126217 3300013306 Unclassified 2665
282 Ga0163162_10567767 3300013306 Bacteria 1262
283 Ga0157372_10273401 3300013307 Unclassified 1964
284 Ga0157372_10390266 3300013307 Bacteria 1622
285 Ga0157372_10827164 3300013307 Unclassified 1075
286 Ga0157372_11003355 3300013307 Unclassified 967
287 Ga0157375_10031067 3300013308 Bacteria 5042
288 Ga0157375_10072400 3300013308 Bacteria 3463
289 Ga0157375_10243233 3300013308 Bacteria 1959
290 Ga0157375_10911636 3300013308 Unclassified 1022
291 Ga0157375_11408031 3300013308 Bacteria 821
292 Ga0163163_10001446 3300014325 Bacteria 20050
293 Ga0163163_10002680 3300014325 Bacteria 15055
294 Ga0163163_10011196 3300014325 Bacteria 8126
295 Ga0163163_10076845 3300014325 Unclassified 3335
296 Ga0163163_10121386 3300014325 Bacteria 2647
297 Ga0163163_10213119 3300014325 Unclassified 1980
298 Ga0163163_10310517 3300014325 Bacteria 1630
299 Ga0163163_10419151 3300014325 Bacteria 1398
300 Ga0163163_10800626 3300014325 Bacteria 1006
301 Ga0157380_10014265 3300014326 Bacteria 5813
302 Ga0157380_10107843 3300014326 Bacteria 2333
303 Ga0157380_10299340 3300014326 Bacteria 1481
304 Ga0157380_10416855 3300014326 Unclassified 1279
305 Ga0157377_10008780 3300014745 Bacteria 4940
306 Ga0157377_10011478 3300014745 Unclassified 4423
307 Ga0157377_10082561 3300014745 Bacteria 1881
308 Ga0157376_10013623 3300014969 Bacteria 6074
309 Ga0157376_10019212 3300014969 Bacteria 5261
310 Ga0157376_10043672 3300014969 Bacteria 3680
311 Ga0163161_10013480 3300017792 Bacteria 5690
312 Ga0163161_10236837 3300017792 Bacteria 1418
313 Ga0209050_1036755 3300025298 Bacteria 1425
314 Ga0207656_10022333 3300025321 Bacteria 2538
315 Ga0207696_1061173 3300025711 Bacteria 1059
316 Ga0207642_10123051 3300025899 Bacteria 1341
317 Ga0207710_10000896 3300025900 Bacteria 15935
318 Ga0207710_10126229 3300025900 Bacteria 1226
319 Ga0207680_10196445 3300025903 Unclassified 1372
320 Ga0207647_10000117 3300025904 Bacteria 61849
321 Ga0207647_10020871 3300025904 Bacteria 4384
322 Ga0207647_10061232 3300025904 Bacteria 2298
323 Ga0207645_10001441 3300025907 Bacteria 19478
324 Ga0207645_10041147 3300025907 Bacteria 2959
325 Ga0207645_10172270 3300025907 Bacteria 1419
326 Ga0207645_10220293 3300025907 Unclassified 1251
327 Ga0207643_10020733 3300025908 Bacteria 3608
328 Ga0207705_10000026 3300025909 Bacteria 256051
329 Ga0207705_10000296 3300025909 Bacteria 46440
330 Ga0207705_10366755 3300025909 Bacteria 1111
331 Ga0207654_10002373 3300025911 Bacteria 9641
332 Ga0207654_10049443 3300025911 Bacteria 2412
333 Ga0207654_10402626 3300025911 Unclassified 952
334 Ga0207707_10317271 3300025912 Unclassified 1346
335 Ga0207695_10008061 3300025913 Bacteria 13257
336 Ga0207695_10025591 3300025913 Bacteria 6603
337 Ga0207695_10029753 3300025913 Bacteria 6026
338 Ga0207695_10048208 3300025913 Unclassified 4501
339 Ga0207671_10010627 3300025914 Bacteria 7575
340 Ga0207671_10029169 3300025914 Unclassified 4121
341 Ga0207671_10137992 3300025914 Bacteria 1877
342 Ga0207663_10229242 3300025916 Bacteria 1356
343 Ga0207660_10355668 3300025917 Bacteria 1174
344 Ga0207660_10392065 3300025917 Unclassified 1117
345 Ga0207662_10189347 3300025918 Bacteria 1327
346 Ga0207662_10402373 3300025918 Bacteria 928
347 Ga0207657_10007889 3300025919 Bacteria 10860
348 Ga0207657_10060400 3300025919 Bacteria 3253
349 Ga0207657_10064681 3300025919 Bacteria 3121
350 Ga0207657_10073247 3300025919 Unclassified 2895
351 Ga0207649_10079748 3300025920 Bacteria 2115
352 Ga0207649_10105212 3300025920 Bacteria 1875
353 Ga0207652_10092363 3300025921 Bacteria 2662
354 Ga0207681_10003519 3300025923 Bacteria 9751
355 Ga0207681_10005940 3300025923 Bacteria 7485
356 Ga0207694_10015294 3300025924 Bacteria 5790
357 Ga0207694_10053546 3300025924 Bacteria 3129
358 Ga0207694_10117865 3300025924 Bacteria 2117
359 Ga0207694_10171645 3300025924 Bacteria 1756
360 Ga0207694_10199605 3300025924 Bacteria 1627
361 Ga0207694_10445164 3300025924 Bacteria 1081
362 Ga0207650_10070925 3300025925 Bacteria 2620
363 Ga0207650_10108722 3300025925 Bacteria 2144
364 Ga0207650_10149552 3300025925 Bacteria 1842
365 Ga0207650_10515537 3300025925 Bacteria 1000
366 Ga0207659_10290200 3300025926 Bacteria 1340
367 Ga0207687_10001686 3300025927 Bacteria 15217
368 Ga0207644_10013563 3300025931 Bacteria 5437
369 Ga0207644_10018309 3300025931 Bacteria 4736
370 Ga0207644_10118769 3300025931 Bacteria 2010
371 Ga0207644_10224519 3300025931 Bacteria 1490
372 Ga0207690_10068599 3300025932 Bacteria 2437
373 Ga0207706_10000044 3300025933 Bacteria 123576
374 Ga0207706_10001385 3300025933 Bacteria 24183
375 Ga0207706_10309784 3300025933 Bacteria 1375
376 Ga0207686_10031290 3300025934 Bacteria 3158
377 Ga0207686_10064257 3300025934 Bacteria 2336
378 Ga0207686_10593784 3300025934 Bacteria 871
379 Ga0207709_10006502 3300025935 Bacteria 6563
380 Ga0207709_10071719 3300025935 Bacteria 2201
381 Ga0207670_10006974 3300025936 Bacteria 6287
382 Ga0207670_10107013 3300025936 Bacteria 2007
383 Ga0207669_10769056 3300025937 Bacteria 797
384 Ga0207704_10000061 3300025938 Bacteria 76480
385 Ga0207691_10216303 3300025940 Bacteria 1663
386 Ga0207691_10227360 3300025940 Unclassified 1616
387 Ga0207691_10359138 3300025940 Bacteria 1246
388 Ga0207711_10016998 3300025941 Bacteria 6042
389 Ga0207711_10017862 3300025941 Bacteria 5893
390 Ga0207711_10209071 3300025941 Bacteria 1782
391 Ga0207689_10031688 3300025942 Bacteria 4399
392 Ga0207689_10042769 3300025942 Bacteria 3746
393 Ga0207689_10068433 3300025942 Bacteria 2918
394 Ga0207689_10157040 3300025942 Bacteria 1875
395 Ga0207689_10516760 3300025942 Bacteria 1001
396 Ga0207661_10196631 3300025944 Bacteria 1771
397 Ga0207661_10578684 3300025944 Bacteria 1030
398 Ga0207679_10050517 3300025945 Unclassified 3039
399 Ga0207679_10052505 3300025945 Bacteria 2990
400 Ga0207679_10086225 3300025945 Bacteria 2414
401 Ga0207679_10282591 3300025945 Bacteria 1424
402 Ga0207679_10462816 3300025945 Bacteria 1126
403 Ga0207667_10000137 3300025949 Bacteria 110326
404 Ga0207667_10024806 3300025949 Bacteria 6577
405 Ga0207667_10061361 3300025949 Bacteria 3932
406 Ga0207667_10422433 3300025949 Bacteria 1356
407 Ga0207651_10017991 3300025960 Bacteria 4192
408 Ga0207712_10007325 3300025961 Bacteria 6964
409 Ga0207712_10028546 3300025961 Bacteria 3733
410 Ga0207712_10471938 3300025961 Bacteria 1068
411 Ga0207668_10004798 3300025972 Bacteria 7959
412 Ga0207668_10046414 3300025972 Bacteria 2968
413 Ga0207640_10002183 3300025981 Bacteria 10521
414 Ga0207640_10015976 3300025981 Unclassified 4356
415 Ga0207640_10134001 3300025981 Bacteria 1795
416 Ga0207640_10254247 3300025981 Bacteria 1365
417 Ga0207658_10024024 3300025986 Bacteria 4259
418 Ga0207658_10633805 3300025986 Unclassified 962
419 Ga0207677_10013948 3300026023 Bacteria 4673
420 Ga0207677_10013950 3300026023 Bacteria 4673
421 Ga0207677_10018604 3300026023 Bacteria 4173
422 Ga0207677_10204541 3300026023 Unclassified 1572
423 Ga0207677_10527788 3300026023 Bacteria 1025
424 Ga0207703_10002039 3300026035 Bacteria 17835
425 Ga0207703_10016370 3300026035 Bacteria 5780
426 Ga0207639_10006607 3300026041 Bacteria 7887
427 Ga0207639_10092146 3300026041 Bacteria 2428
428 Ga0207639_10116283 3300026041 Bacteria 2189
429 Ga0207639_10302359 3300026041 Unclassified 1415
430 Ga0207639_10397618 3300026041 Unclassified 1241
431 Ga0207678_10180936 3300026067 Bacteria 1800
432 Ga0207708_10037804 3300026075 Bacteria 3677
433 Ga0207708_10049663 3300026075 Bacteria 3195
434 Ga0207708_10082338 3300026075 Bacteria 2474
435 Ga0207708_10105662 3300026075 Bacteria 2182
436 Ga0207702_10008059 3300026078 Bacteria 8911
437 Ga0207702_10019770 3300026078 Bacteria 5576
438 Ga0207702_10043447 3300026078 Unclassified 3773
439 Ga0207702_10217734 3300026078 Bacteria 1778
440 Ga0207641_10015129 3300026088 Bacteria 6322
441 Ga0207648_10001009 3300026089 Bacteria 31692
442 Ga0207648_10005323 3300026089 Bacteria 12978
443 Ga0207648_10031735 3300026089 Bacteria 4669
444 Ga0207648_10067507 3300026089 Bacteria 3117
445 Ga0207676_10012870 3300026095 Bacteria 6007
446 Ga0207676_10018688 3300026095 Bacteria 5044
447 Ga0207676_10029622 3300026095 Bacteria 4101
448 Ga0207676_10439746 3300026095 Bacteria 1227
449 Ga0207676_10601759 3300026095 Bacteria 1056
450 Ga0207674_10001416 3300026116 Bacteria 30981
451 Ga0207674_10006473 3300026116 Bacteria 13769
452 Ga0207674_10169456 3300026116 Bacteria 2137
453 Ga0207674_10173064 3300026116 Bacteria 2112
454 Ga0207674_10259381 3300026116 Bacteria 1685
455 Ga0207675_100000301 3300026118 Bacteria 47388
456 Ga0207675_100003846 3300026118 Bacteria 14597
457 Ga0207675_100004752 3300026118 Bacteria 13079
458 Ga0207675_100008570 3300026118 Bacteria 9618
459 Ga0207675_100010800 3300026118 Bacteria 8557
460 Ga0207675_100657677 3300026118 Bacteria 1054
461 Ga0207683_10005351 3300026121 Bacteria 11005
462 Ga0207683_10071326 3300026121 Bacteria 3071
463 Ga0207683_10114073 3300026121 Unclassified 2421
464 Ga0207698_10000062 3300026142 Bacteria 72806
465 Ga0207698_10050835 3300026142 Unclassified 3165
466 Ga0207698_10061036 3300026142 Bacteria 2935
467 Ga0207698_10130300 3300026142 Unclassified 2148
468 Ga0207698_10172194 3300026142 Unclassified 1908
469 Ga0209974_10133224 3300027876 Bacteria 887
470 Ga0207428_10016699 3300027907 Bacteria 6313
471 Ga0207428_10024531 3300027907 Bacteria 5063
472 Ga0207428_10033815 3300027907 Bacteria 4194
473 Ga0207428_10053650 3300027907 Bacteria 3214
474 Ga0268266_10006954 3300028379 Bacteria 10283
475 Ga0268266_10086297 3300028379 Bacteria 2744
476 Ga0268265_10012350 3300028380 Bacteria 5787
477 Ga0268265_10023322 3300028380 Bacteria 4361
478 Ga0268265_10095064 3300028380 Bacteria 2392
479 Ga0268265_10699649 3300028380 Bacteria 979
480 Ga0268264_10016604 3300028381 Bacteria 6028
481 Ga0268264_10153014 3300028381 Bacteria 2070
482 Ga0268264_10439218 3300028381 Bacteria 1262
483 Ga0307517_10000929 3300028786 Bacteria 49793
484 Ga0307511_10000421 3300030521 Bacteria 45250
485 Ga0265327_10001786 3300031251 Bacteria 25271
486 Ga0265327_10018425 3300031251 Bacteria 4328
487 Ga0265327_10102920 3300031251 Bacteria 1375
488 Ga0307509_10000001 3300031507 Bacteria 629324
489 Ga0307408_100006655 3300031548 Bacteria 7663
490 Ga0307408_100057086 3300031548 Bacteria 2833
491 Ga0307408_100270892 3300031548 Bacteria 1409
492 Ga0307408_100371043 3300031548 Bacteria 1220
493 Ga0307405_10041640 3300031731 Unclassified 2790
494 Ga0307405_10200906 3300031731 Bacteria 1447
495 Ga0307405_10286964 3300031731 Bacteria 1242
496 Ga0316577_10072546 3300031733 Bacteria 1922
497 Ga0307413_10072270 3300031824 Bacteria 2177
498 Ga0307406_10047396 3300031901 Bacteria 2708
499 Ga0307406_10087139 3300031901 Bacteria 2092
500 Ga0307406_10130922 3300031901 Bacteria 1761
501 Ga0307406_10719340 3300031901 Bacteria 835
502 Ga0307407_10101783 3300031903 Bacteria 1785
503 Ga0307412_10009610 3300031911 Bacteria 5555
504 Ga0307412_10022027 3300031911 Bacteria 3900
505 Ga0307412_10045565 3300031911 Bacteria 2867
506 Ga0307412_10594813 3300031911 Bacteria 936
507 Ga0307409_100559726 3300031995 Bacteria 1124
508 Ga0307416_100008445 3300032002 Bacteria 6648
509 Ga0307416_100244288 3300032002 Bacteria 1742
510 Ga0307416_100247699 3300032002 Unclassified 1732
511 Ga0307416_100281282 3300032002 Bacteria 1640
512 Ga0307414_10038517 3300032004 Bacteria 3211
513 Ga0307411_10065447 3300032005 Bacteria 2438
514 Ga0307411_10067423 3300032005 Bacteria 2408
515 Ga0307510_10006655 3300033180 Bacteria 13787
516 Ga0373941_0067683 3300035115 Bacteria 1178
517 Ga0316584_0328575 3300036712 Unclassified 1102
518 Ga0395905_0594813 3300037471 Bacteria 1008
519 Ga0436365_0727391 3300039437 Bacteria 1807
520 Ga0436360_1151390 3300039438 Bacteria 1025
521 Ga0436363_0142755 3300039450 Unclassified 1093
522 Ga0439450_061695 3300042008 Bacteria 907
523 Ga0439464_0000238 3300042439 Bacteria 10114
524 Ga0439464_0023226 3300042439 Unclassified 1711
525 Ga0439460_0075797 3300042461 Bacteria 1049
526 Ga0451577_0084182 3300042876 Bacteria 2838
527 Ga0453683_0074506 3300044673 Bacteria 2125
528 Ga0453684_0549722 3300044712 Bacteria 1272
529 Ga0451576_0013203 3300045051 Bacteria 9243
530 Ga0451576_0029776 3300045051 Bacteria 5840
531 Ga0495603_0106393 3300046455 Bacteria 1637
532 Ga0495629_0124263 3300046459 Bacteria 1798
533 Ga0495606_0220510 3300046507 Bacteria 1069
534 Ga0495616_0151463 3300046513 Bacteria 1049
535 Ga0495631_0083404 3300046518 Bacteria 1377
536 Ga0495633_0109660 3300046558 Bacteria 1280
537 Ga0495623_0124032 3300046679 Bacteria 1552
538 Ga0495613_0000461 3300046689 Bacteria 34821
539 Ga0496101_0208880 3300048904 Bacteria 1512
540 Ga0496102_0018421 3300048905 Bacteria 6136
541 Ga0496102_0118072 3300048905 Bacteria 2476
542 Ga0496104_0195822 3300048907 Bacteria 1933
543 Ga0496106_0228939 3300048909 Bacteria 1484
544 Ga0496107_0025766 3300048910 Bacteria 4166
545 Ga0496108_0351374 3300048911 Bacteria 1286
546 Ga0496110_0274383 3300048913 Bacteria 1535
547 Ga0496112_0189663 3300048915 Bacteria 2018
548 Ga0496113_0069148 3300048916 Bacteria 2681
549 Ga0496114_0001110 3300048917 Bacteria 20326
550 Ga0496114_0015982 3300048917 Bacteria 6039
551 Ga0496114_0140767 3300048917 Unclassified 2089
552 Ga0496115_0000519 3300048918 Bacteria 29990
553 Ga0496115_0182372 3300048918 Bacteria 1735
554 Ga0496118_0032250 3300048921 Bacteria 4321
555 Ga0496121_0003359 3300048924 Bacteria 22946
556 Ga0496125_0012336 3300048928 Bacteria 8491
557 Ga0496126_0110209 3300048929 Unclassified 2398
558 Ga0501202_016942 3300049652 Bacteria 1419
559 Ga0501276_009443 3300049773 Bacteria 808
560 Ga0501283_027912 3300049779 Bacteria 935
561 Ga0501212_007661 3300049851 Bacteria 1487
562 nmdc:mga05p37_15188_c1 3300050507 Bacteria 9247
563 nmdc:mga05p37_178794_c1 3300050507 Bacteria 2583
564 nmdc:mga05p37_4486_c1 3300050507 Bacteria 16320
565 nmdc:mga09592_11835_c1 3300050508 Bacteria 7096
566 nmdc:mga09592_190104_c1 3300050508 Bacteria 1777
567 nmdc:mga09592_8711_c1 3300050508 Bacteria 8254
568 nmdc:mga0qj67_193955_c1 3300050509 Bacteria 1650
569 nmdc:mga0qj67_244505_c1 3300050509 Unclassified 1456
570 nmdc:mga0qj67_2471_c1 3300050509 Bacteria 13171
571 nmdc:mga0qj67_25849_c1 3300050509 Unclassified 4541
572 nmdc:mga06r32_10475_c1 3300050510 Bacteria 8362
573 nmdc:mga06r32_1081_c1 3300050510 Bacteria 24484
574 nmdc:mga06r32_1893_c1 3300050510 Bacteria 18646
575 nmdc:mga06r32_267142_c1 3300050510 Bacteria 1698
576 nmdc:mga06r32_314217_c1 3300050510 Bacteria 1552
577 nmdc:mga06r32_775385_c1 3300050510 Unclassified 921
578 nmdc:mga08y16_13852_c1 3300050511 Bacteria 8487
579 nmdc:mga08y16_239036_c1 3300050511 Bacteria 1878
580 nmdc:mga08y16_24559_c1 3300050511 Bacteria 6360
581 nmdc:mga08y16_3118_c1 3300050511 Bacteria 17163
582 nmdc:mga08y16_410782_c1 3300050511 Bacteria 1384
583 nmdc:mga08y16_5162_c1 3300050511 Bacteria 13635
584 nmdc:mga08y16_6079_c1 3300050511 Bacteria 12659
585 Ga0500583_0248641 3300053092 Bacteria 878
586 Ga0500650_0089911 3300053098 Bacteria 1437
587 Ga0500660_090480 3300053100 Bacteria 1369
588 Ga0500595_033240 3300053119 Bacteria 1713
589 Ga0500608_000870 3300053122 Bacteria 10900
590 Ga0500617_093947 3300053124 Bacteria 1278
591 Ga0500658_0054397 3300053134 Bacteria 1645
592 Ga0500559_0028705 3300053136 Bacteria 2378
593 Ga0500616_0000068 3300053153 Bacteria 235628
594 Ga0590071_043148 3300059421 Bacteria 1087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10029782 Ga0111539_100297822 193
2 3300009147 Ga0114129_10175222 Ga0114129_101752223 193
3 3300009553 Ga0105249_10005396 Ga0105249_100053969 193
4 3300013100 Ga0157373_10325157 Ga0157373_103251572 193
5 3300050510 nmdc:mga06r32_314217_c1 nmdc:mga06r32_314217_c1_902_1540 193
6 3300053092 Ga0500583_0248641 Ga0500583_0248641_246_860 201
7 3300013308 Ga0157375_11408031 Ga0157375_114080312 206
8 3300014325 Ga0163163_10419151 Ga0163163_104191513 206
9 3300046558 Ga0495633_0109660 Ga0495633_0109660_89_709 206
10 3300048911 Ga0496108_0351374 Ga0496108_0351374_641_1270 206
11 3300042008 Ga0439450_061695 Ga0439450_061695_261_896 208
12 3300053098 Ga0500650_0089911 Ga0500650_0089911_734_1366 208
13 3300009551 Ga0105238_10192709 Ga0105238_101927091 212
14 3300036712 Ga0316584_0328575 Ga0316584_0328575_71_721 212
15 3300046679 Ga0495623_0124032 Ga0495623_0124032_75_722 212
16 3300048913 Ga0496110_0274383 Ga0496110_0274383_882_1520 212
17 3300053124 Ga0500617_093947 Ga0500617_093947_40_687 212
18 3300005444 Ga0070694_100125181 Ga0070694_1001251813 218
19 3300006844 Ga0075428_100891413 Ga0075428_1008914131 218
20 3300006880 Ga0075429_100141795 Ga0075429_1001417953 218
21 3300025945 Ga0207679_10462816 Ga0207679_104628162 218
22 3300027907 Ga0207428_10053650 Ga0207428_100536504 218
23 3300050508 nmdc:mga09592_190104_c1 nmdc:mga09592_190104_c1_215_928 218
24 3300050511 nmdc:mga08y16_24559_c1 nmdc:mga08y16_24559_c1_3980_4693 218
25 3300046689 Ga0495613_0000461 Ga0495613_0000461_20597_21361 222
26 3300005336 Ga0070680_100042765 Ga0070680_1000427651 225
27 3300005339 Ga0070660_100252486 Ga0070660_1002524862 225
28 3300005354 Ga0070675_100377641 Ga0070675_1003776412 225
29 3300005366 Ga0070659_100106470 Ga0070659_1001064703 225
30 3300005458 Ga0070681_10015536 Ga0070681_100155363 225
31 3300005530 Ga0070679_100128667 Ga0070679_1001286673 225
32 3300005539 Ga0068853_100523873 Ga0068853_1005238731 225
33 3300005564 Ga0070664_100007635 Ga0070664_1000076359 225
34 3300005577 Ga0068857_100007917 Ga0068857_1000079175 225
35 3300005618 Ga0068864_100041299 Ga0068864_1000412993 225
36 3300009174 Ga0105241_10114987 Ga0105241_101149873 225
37 3300013307 Ga0157372_10827164 Ga0157372_108271641 225
38 3300014325 Ga0163163_10076845 Ga0163163_100768451 225
39 3300025912 Ga0207707_10317271 Ga0207707_103172712 225
40 3300025917 Ga0207660_10392065 Ga0207660_103920652 225
41 3300025919 Ga0207657_10064681 Ga0207657_100646813 225
42 3300025921 Ga0207652_10092363 Ga0207652_100923632 225
43 3300025945 Ga0207679_10050517 Ga0207679_100505173 225
44 3300026041 Ga0207639_10302359 Ga0207639_103023592 225
45 3300026116 Ga0207674_10001416 Ga0207674_1000141623 225
46 3300049773 Ga0501276_009443 Ga0501276_009443_18_707 225
47 3300009177 Ga0105248_10029951 Ga0105248_100299516 226
48 3300013306 Ga0163162_10126217 Ga0163162_101262174 226
49 3300014325 Ga0163163_10011196 Ga0163163_100111969 226
50 3300005328 Ga0070676_10177550 Ga0070676_101775501 228
51 3300005331 Ga0070670_100127687 Ga0070670_1001276872 228
52 3300005347 Ga0070668_100007229 Ga0070668_1000072295 228
53 3300005353 Ga0070669_100048942 Ga0070669_1000489423 228
54 3300005457 Ga0070662_100001866 Ga0070662_10000186612 228
55 3300005459 Ga0068867_100322649 Ga0068867_1003226491 228
56 3300005530 Ga0070679_100178533 Ga0070679_1001785332 228
57 3300005719 Ga0068861_100004245 Ga0068861_10000424510 228
58 3300005844 Ga0068862_100000397 Ga0068862_10000039719 228
59 3300009148 Ga0105243_10012589 Ga0105243_100125891 228
60 3300025907 Ga0207645_10172270 Ga0207645_101722701 228
61 3300025923 Ga0207681_10003519 Ga0207681_100035198 228
62 3300025925 Ga0207650_10149552 Ga0207650_101495522 228
63 3300025933 Ga0207706_10001385 Ga0207706_100013854 228
64 3300025961 Ga0207712_10007325 Ga0207712_100073255 228
65 3300025972 Ga0207668_10004798 Ga0207668_100047986 228
66 3300026075 Ga0207708_10037804 Ga0207708_100378043 228
67 3300026118 Ga0207675_100003846 Ga0207675_1000038465 228
68 3300005617 Ga0068859_100194832 Ga0068859_1001948322 229
69 3300006931 Ga0097620_100194820 Ga0097620_1001948202 229
70 3300005331 Ga0070670_100325855 Ga0070670_1003258551 230
71 3300046459 Ga0495629_0124263 Ga0495629_0124263_487_1203 230
72 3300048929 Ga0496126_0110209 Ga0496126_0110209_1474_2175 230
73 3300005471 Ga0070698_100031725 Ga0070698_1000317251 232
74 3300025298 Ga0209050_1036755 Ga0209050_10367552 234
75 3300053153 Ga0500616_0000068 Ga0500616_0000068_70534_71262 234
76 3300031911 Ga0307412_10594813 Ga0307412_105948132 235
77 3300032002 Ga0307416_100247699 Ga0307416_1002476993 235
78 3300042461 Ga0439460_0075797 Ga0439460_0075797_274_993 235
79 3300049779 Ga0501283_027912 Ga0501283_027912_34_759 235
80 3300006844 Ga0075428_100003292 Ga0075428_1000032923 236
81 3300006846 Ga0075430_100451062 Ga0075430_1004510621 236
82 3300006847 Ga0075431_100029698 Ga0075431_1000296982 236
83 3300006880 Ga0075429_100010572 Ga0075429_1000105726 236
84 3300027907 Ga0207428_10033815 Ga0207428_100338152 236
85 3300031548 Ga0307408_100006655 Ga0307408_1000066558 236
86 3300031901 Ga0307406_10087139 Ga0307406_100871392 236
87 3300031903 Ga0307407_10101783 Ga0307407_101017832 236
88 3300031911 Ga0307412_10009610 Ga0307412_100096104 236
89 3300031911 Ga0307412_10022027 Ga0307412_100220272 236
90 3300032002 Ga0307416_100008445 Ga0307416_1000084453 236
91 3300032002 Ga0307416_100244288 Ga0307416_1002442882 236
92 3300032005 Ga0307411_10065447 Ga0307411_100654474 236
93 3300053119 Ga0500595_033240 Ga0500595_033240_869_1651 236
94 3300025918 Ga0207662_10189347 Ga0207662_101893471 237
95 3300025932 Ga0207690_10068599 Ga0207690_100685993 237
96 3300026142 Ga0207698_10172194 Ga0207698_101721942 237
97 3300005327 Ga0070658_10518176 Ga0070658_105181761 239
98 3300005842 Ga0068858_100003200 Ga0068858_1000032004 239
99 3300009098 Ga0105245_10000244 Ga0105245_100002446 239
100 3300009148 Ga0105243_10249475 Ga0105243_102494752 239
101 3300013296 Ga0157374_10036591 Ga0157374_100365913 239
102 3300025909 Ga0207705_10366755 Ga0207705_103667552 239
103 3300025927 Ga0207687_10001686 Ga0207687_1000168614 239
104 3300026035 Ga0207703_10002039 Ga0207703_100020394 239
105 3300005288 Ga0065714_10153640 Ga0065714_101536402 240
106 3300005290 Ga0065712_10027855 Ga0065712_100278552 240
107 3300005293 Ga0065715_10149612 Ga0065715_101496122 240
108 3300005331 Ga0070670_100266644 Ga0070670_1002666442 240
109 3300005333 Ga0070677_10115863 Ga0070677_101158632 240
110 3300005334 Ga0068869_100205589 Ga0068869_1002055892 240
111 3300005334 Ga0068869_100547013 Ga0068869_1005470131 240
112 3300005335 Ga0070666_10155208 Ga0070666_101552081 240
113 3300005338 Ga0068868_100236041 Ga0068868_1002360411 240
114 3300005353 Ga0070669_100587585 Ga0070669_1005875852 240
115 3300005354 Ga0070675_100255438 Ga0070675_1002554382 240
116 3300005364 Ga0070673_100209881 Ga0070673_1002098813 240
117 3300005364 Ga0070673_100382886 Ga0070673_1003828862 240
118 3300005365 Ga0070688_100203776 Ga0070688_1002037761 240
119 3300005367 Ga0070667_100055666 Ga0070667_1000556664 240
120 3300005466 Ga0070685_10066053 Ga0070685_100660532 240
121 3300005539 Ga0068853_100239368 Ga0068853_1002393681 240
122 3300005543 Ga0070672_100100312 Ga0070672_1001003122 240
123 3300005616 Ga0068852_100067765 Ga0068852_1000677652 240
124 3300005616 Ga0068852_100722847 Ga0068852_1007228471 240
125 3300005617 Ga0068859_100051479 Ga0068859_1000514792 240
126 3300005718 Ga0068866_10331050 Ga0068866_103310502 240
127 3300005834 Ga0068851_10172812 Ga0068851_101728122 240
128 3300005843 Ga0068860_100309201 Ga0068860_1003092012 240
129 3300005844 Ga0068862_100478382 Ga0068862_1004783822 240
130 3300006237 Ga0097621_100049355 Ga0097621_1000493553 240
131 3300006237 Ga0097621_100170478 Ga0097621_1001704782 240
132 3300006358 Ga0068871_100017127 Ga0068871_1000171278 240
133 3300006881 Ga0068865_100648619 Ga0068865_1006486191 240
134 3300006931 Ga0097620_100051480 Ga0097620_1000514804 240
135 3300009094 Ga0111539_10680187 Ga0111539_106801872 240
136 3300009176 Ga0105242_10023218 Ga0105242_100232188 240
137 3300009176 Ga0105242_10128337 Ga0105242_101283373 240
138 3300009176 Ga0105242_10397212 Ga0105242_103972121 240
139 3300013104 Ga0157370_10362725 Ga0157370_103627252 240
140 3300013105 Ga0157369_10163629 Ga0157369_101636292 240
141 3300013297 Ga0157378_10239322 Ga0157378_102393222 240
142 3300013306 Ga0163162_10089871 Ga0163162_100898712 240
143 3300013306 Ga0163162_10567767 Ga0163162_105677672 240
144 3300013308 Ga0157375_10031067 Ga0157375_100310674 240
145 3300013308 Ga0157375_10243233 Ga0157375_102432332 240
146 3300014325 Ga0163163_10800626 Ga0163163_108006262 240
147 3300014326 Ga0157380_10107843 Ga0157380_101078432 240
148 3300014969 Ga0157376_10019212 Ga0157376_100192129 240
149 3300017792 Ga0163161_10013480 Ga0163161_100134807 240
150 3300017792 Ga0163161_10236837 Ga0163161_102368372 240
151 3300025899 Ga0207642_10123051 Ga0207642_101230512 240
152 3300025907 Ga0207645_10220293 Ga0207645_102202931 240
153 3300025917 Ga0207660_10355668 Ga0207660_103556682 240
154 3300025918 Ga0207662_10402373 Ga0207662_104023731 240
155 3300025925 Ga0207650_10515537 Ga0207650_105155371 240
156 3300025926 Ga0207659_10290200 Ga0207659_102902002 240
157 3300025931 Ga0207644_10224519 Ga0207644_102245192 240
158 3300025934 Ga0207686_10064257 Ga0207686_100642574 240
159 3300025936 Ga0207670_10107013 Ga0207670_101070132 240
160 3300025940 Ga0207691_10216303 Ga0207691_102163031 240
161 3300025940 Ga0207691_10359138 Ga0207691_103591382 240
162 3300025941 Ga0207711_10209071 Ga0207711_102090713 240
163 3300025942 Ga0207689_10042769 Ga0207689_100427692 240
164 3300026023 Ga0207677_10527788 Ga0207677_105277881 240
165 3300026075 Ga0207708_10105662 Ga0207708_101056623 240
166 3300026089 Ga0207648_10031735 Ga0207648_100317352 240
167 3300026116 Ga0207674_10259381 Ga0207674_102593811 240
168 3300026118 Ga0207675_100657677 Ga0207675_1006576771 240
169 3300026121 Ga0207683_10071326 Ga0207683_100713262 240
170 3300026121 Ga0207683_10114073 Ga0207683_101140732 240
171 3300026142 Ga0207698_10050835 Ga0207698_100508352 240
172 3300028380 Ga0268265_10699649 Ga0268265_106996492 240
173 3300042876 Ga0451577_0084182 Ga0451577_0084182_1399_2145 240
174 3300044673 Ga0453683_0074506 Ga0453683_0074506_463_1209 240
175 3300045051 Ga0451576_0029776 Ga0451576_0029776_1039_1785 240
176 3300048904 Ga0496101_0208880 Ga0496101_0208880_542_1294 240
177 3300048907 Ga0496104_0195822 Ga0496104_0195822_525_1277 240
178 3300048910 Ga0496107_0025766 Ga0496107_0025766_313_1065 240
179 3300048917 Ga0496114_0015982 Ga0496114_0015982_1374_2126 240
180 3300048917 Ga0496114_0140767 Ga0496114_0140767_61_807 240
181 3300005328 Ga0070676_10087844 Ga0070676_100878443 241
182 3300005331 Ga0070670_100124705 Ga0070670_1001247053 241
183 3300005347 Ga0070668_100061866 Ga0070668_1000618661 241
184 3300005354 Ga0070675_100072550 Ga0070675_1000725502 241
185 3300005365 Ga0070688_100017514 Ga0070688_1000175141 241
186 3300005466 Ga0070685_10141975 Ga0070685_101419752 241
187 3300005577 Ga0068857_100110261 Ga0068857_1001102612 241
188 3300005617 Ga0068859_100010940 Ga0068859_1000109402 241
189 3300005618 Ga0068864_100201296 Ga0068864_1002012962 241
190 3300005719 Ga0068861_100160589 Ga0068861_1001605893 241
191 3300005840 Ga0068870_10049077 Ga0068870_100490773 241
192 3300005843 Ga0068860_100002159 Ga0068860_10000215916 241
193 3300005844 Ga0068862_100002089 Ga0068862_1000020895 241
194 3300005844 Ga0068862_100099692 Ga0068862_1000996922 241
195 3300006931 Ga0097620_100010940 Ga0097620_1000109402 241
196 3300009094 Ga0111539_10019225 Ga0111539_100192252 241
197 3300014326 Ga0157380_10014265 Ga0157380_100142655 241
198 3300014745 Ga0157377_10008780 Ga0157377_100087805 241
199 3300025907 Ga0207645_10041147 Ga0207645_100411472 241
200 3300025908 Ga0207643_10020733 Ga0207643_100207332 241
201 3300025923 Ga0207681_10005940 Ga0207681_100059405 241
202 3300025925 Ga0207650_10070925 Ga0207650_100709252 241
203 3300025937 Ga0207669_10769056 Ga0207669_107690561 241
204 3300025972 Ga0207668_10046414 Ga0207668_100464143 241
205 3300026089 Ga0207648_10067507 Ga0207648_100675072 241
206 3300026116 Ga0207674_10173064 Ga0207674_101730643 241
207 3300026118 Ga0207675_100010800 Ga0207675_1000108008 241
208 3300027907 Ga0207428_10024531 Ga0207428_100245314 241
209 3300028380 Ga0268265_10023322 Ga0268265_100233224 241
210 3300028381 Ga0268264_10016604 Ga0268264_100166043 241
211 3300050511 nmdc:mga08y16_13852_c1 nmdc:mga08y16_13852_c1_7524_8273 241
212 3300059421 Ga0590071_043148 Ga0590071_043148_22_771 241
213 3300005289 Ga0065704_10080179 Ga0065704_100801792 242
214 3300005295 Ga0065707_10277873 Ga0065707_102778731 242
215 3300005334 Ga0068869_100050853 Ga0068869_1000508532 242
216 3300005338 Ga0068868_100350412 Ga0068868_1003504122 242
217 3300005459 Ga0068867_100334252 Ga0068867_1003342522 242
218 3300005536 Ga0070697_100150102 Ga0070697_1001501022 242
219 3300005617 Ga0068859_100549106 Ga0068859_1005491061 242
220 3300005618 Ga0068864_100087150 Ga0068864_1000871502 242
221 3300005618 Ga0068864_100693870 Ga0068864_1006938701 242
222 3300005843 Ga0068860_100072861 Ga0068860_1000728613 242
223 3300006931 Ga0097620_100549133 Ga0097620_1005491332 242
224 3300009094 Ga0111539_10006853 Ga0111539_1000685310 242
225 3300009094 Ga0111539_10799356 Ga0111539_107993562 242
226 3300009147 Ga0114129_10003090 Ga0114129_1000309012 242
227 3300009147 Ga0114129_10422097 Ga0114129_104220974 242
228 3300009177 Ga0105248_10115500 Ga0105248_101155002 242
229 3300013306 Ga0163162_10046070 Ga0163162_100460702 242
230 3300013308 Ga0157375_10911636 Ga0157375_109116362 242
231 3300014325 Ga0163163_10121386 Ga0163163_101213863 242
232 3300014326 Ga0157380_10416855 Ga0157380_104168552 242
233 3300025931 Ga0207644_10118769 Ga0207644_101187692 242
234 3300025933 Ga0207706_10309784 Ga0207706_103097842 242
235 3300025942 Ga0207689_10031688 Ga0207689_100316883 242
236 3300026023 Ga0207677_10204541 Ga0207677_102045412 242
237 3300026095 Ga0207676_10029622 Ga0207676_100296223 242
238 3300026095 Ga0207676_10601759 Ga0207676_106017591 242
239 3300028381 Ga0268264_10439218 Ga0268264_104392182 242
240 3300031901 Ga0307406_10719340 Ga0307406_107193401 242
241 3300031995 Ga0307409_100559726 Ga0307409_1005597261 242
242 3300037471 Ga0395905_0594813 Ga0395905_0594813_107_865 242
243 3300042439 Ga0439464_0000238 Ga0439464_0000238_8219_8977 242
244 3300049652 Ga0501202_016942 Ga0501202_016942_249_1007 242
245 3300049851 Ga0501212_007661 Ga0501212_007661_709_1467 242
246 3300050507 nmdc:mga05p37_15188_c1 nmdc:mga05p37_15188_c1_7352_8110 242
247 3300050508 nmdc:mga09592_11835_c1 nmdc:mga09592_11835_c1_724_1482 242
248 3300050509 nmdc:mga0qj67_244505_c1 nmdc:mga0qj67_244505_c1_548_1306 242
249 3300050510 nmdc:mga06r32_267142_c1 nmdc:mga06r32_267142_c1_675_1433 242
250 3300050511 nmdc:mga08y16_6079_c1 nmdc:mga08y16_6079_c1_185_943 242
251 3300001904 JGI24736J21556_1013368 JGI24736J21556_10133681 243
252 3300003316 rootH1_10087869 rootH1_100878692 243
253 3300005327 Ga0070658_10000008 Ga0070658_1000000827 243
254 3300005328 Ga0070676_10000015 Ga0070676_1000001537 243
255 3300005338 Ga0068868_100019741 Ga0068868_1000197412 243
256 3300005338 Ga0068868_100038928 Ga0068868_1000389282 243
257 3300005339 Ga0070660_100056566 Ga0070660_1000565664 243
258 3300005364 Ga0070673_100069192 Ga0070673_1000691923 243
259 3300005456 Ga0070678_100179378 Ga0070678_1001793781 243
260 3300005457 Ga0070662_100000449 Ga0070662_10000044919 243
261 3300005459 Ga0068867_100000210 Ga0068867_10000021028 243
262 3300005543 Ga0070672_100234807 Ga0070672_1002348072 243
263 3300005563 Ga0068855_100038975 Ga0068855_1000389757 243
264 3300005614 Ga0068856_100168450 Ga0068856_1001684504 243
265 3300005616 Ga0068852_100094991 Ga0068852_1000949912 243
266 3300006237 Ga0097621_100000308 Ga0097621_1000003086 243
267 3300006358 Ga0068871_100000046 Ga0068871_10000004618 243
268 3300006844 Ga0075428_100012806 Ga0075428_1000128063 243
269 3300006881 Ga0068865_100000041 Ga0068865_10000004135 243
270 3300009093 Ga0105240_10152567 Ga0105240_101525673 243
271 3300009148 Ga0105243_10048482 Ga0105243_100484822 243
272 3300009174 Ga0105241_10000217 Ga0105241_1000021719 243
273 3300009174 Ga0105241_10131113 Ga0105241_101311133 243
274 3300009176 Ga0105242_10003079 Ga0105242_100030798 243
275 3300009545 Ga0105237_10001818 Ga0105237_100018183 243
276 3300009551 Ga0105238_10002068 Ga0105238_1000206813 243
277 3300010375 Ga0105239_10038845 Ga0105239_100388453 243
278 3300010375 Ga0105239_10043033 Ga0105239_100430335 243
279 3300013296 Ga0157374_10000137 Ga0157374_1000013752 243
280 3300013296 Ga0157374_10007556 Ga0157374_100075569 243
281 3300013307 Ga0157372_10390266 Ga0157372_103902662 243
282 3300013308 Ga0157375_10072400 Ga0157375_100724002 243
283 3300025904 Ga0207647_10000117 Ga0207647_1000011730 243
284 3300025907 Ga0207645_10001441 Ga0207645_1000144110 243
285 3300025909 Ga0207705_10000026 Ga0207705_1000002627 243
286 3300025911 Ga0207654_10002373 Ga0207654_100023733 243
287 3300025911 Ga0207654_10402626 Ga0207654_104026261 243
288 3300025913 Ga0207695_10025591 Ga0207695_100255912 243
289 3300025914 Ga0207671_10010627 Ga0207671_100106273 243
290 3300025919 Ga0207657_10060400 Ga0207657_100604001 243
291 3300025919 Ga0207657_10073247 Ga0207657_100732472 243
292 3300025924 Ga0207694_10015294 Ga0207694_100152945 243
293 3300025933 Ga0207706_10000044 Ga0207706_1000004419 243
294 3300025934 Ga0207686_10031290 Ga0207686_100312901 243
295 3300025935 Ga0207709_10006502 Ga0207709_100065022 243
296 3300025938 Ga0207704_10000061 Ga0207704_1000006153 243
297 3300025940 Ga0207691_10227360 Ga0207691_102273602 243
298 3300025949 Ga0207667_10061361 Ga0207667_100613615 243
299 3300025960 Ga0207651_10017991 Ga0207651_100179913 243
300 3300026023 Ga0207677_10013948 Ga0207677_100139486 243
301 3300026023 Ga0207677_10018604 Ga0207677_100186042 243
302 3300026041 Ga0207639_10397618 Ga0207639_103976181 243
303 3300026078 Ga0207702_10019770 Ga0207702_100197702 243
304 3300026089 Ga0207648_10001009 Ga0207648_1000100925 243
305 3300026121 Ga0207683_10005351 Ga0207683_100053518 243
306 3300026142 Ga0207698_10130300 Ga0207698_101303002 243
307 3300028786 Ga0307517_10000929 Ga0307517_1000092946 243
308 3300031251 Ga0265327_10102920 Ga0265327_101029202 243
309 3300033180 Ga0307510_10006655 Ga0307510_1000665516 243
310 3300035115 Ga0373941_0067683 Ga0373941_0067683_18_773 243
311 3300044712 Ga0453684_0549722 Ga0453684_0549722_48_812 243
312 3300046507 Ga0495606_0220510 Ga0495606_0220510_140_895 243
313 3300046518 Ga0495631_0083404 Ga0495631_0083404_83_838 243
314 3300053122 Ga0500608_000870 Ga0500608_000870_381_1136 243
315 3300005367 Ga0070667_100247217 Ga0070667_1002472172 244
316 3300009094 Ga0111539_10004806 Ga0111539_100048065 244
317 3300028380 Ga0268265_10095064 Ga0268265_100950642 244
318 3300031251 Ga0265327_10018425 Ga0265327_100184253 244
319 3300042439 Ga0439464_0023226 Ga0439464_0023226_844_1602 244
320 3300050511 nmdc:mga08y16_5162_c1 nmdc:mga08y16_5162_c1_3897_4655 244
321 3300005563 Ga0068855_100000066 Ga0068855_10000006672 245
322 3300010375 Ga0105239_10335242 Ga0105239_103352422 245
323 3300014325 Ga0163163_10310517 Ga0163163_103105172 245
324 3300025949 Ga0207667_10000137 Ga0207667_1000013752 245
325 3300026095 Ga0207676_10439746 Ga0207676_104397462 245
326 3300031251 Ga0265327_10001786 Ga0265327_1000178619 245
327 3300003320 rootH2_10272373 rootH2_102723732 246
328 3300005616 Ga0068852_100181544 Ga0068852_1001815442 246
329 3300005617 Ga0068859_100005804 Ga0068859_1000058043 246
330 3300005617 Ga0068859_100010690 Ga0068859_10001069012 246
331 3300005719 Ga0068861_100000084 Ga0068861_10000008439 246
332 3300006931 Ga0097620_100005804 Ga0097620_10000580410 246
333 3300006931 Ga0097620_100010690 Ga0097620_10001069012 246
334 3300009094 Ga0111539_10008355 Ga0111539_1000835510 246
335 3300009147 Ga0114129_10017297 Ga0114129_100172979 246
336 3300009177 Ga0105248_10001781 Ga0105248_100017817 246
337 3300025941 Ga0207711_10017862 Ga0207711_100178624 246
338 3300026118 Ga0207675_100000301 Ga0207675_10000030112 246
339 3300039438 Ga0436360_1151390 Ga0436360_1151390_255_1013 246
340 3300046513 Ga0495616_0151463 Ga0495616_0151463_68_817 246
341 3300048918 Ga0496115_0000519 Ga0496115_0000519_6061_6831 246
342 3300050507 nmdc:mga05p37_178794_c1 nmdc:mga05p37_178794_c1_140_889 246
343 3300050510 nmdc:mga06r32_1081_c1 nmdc:mga06r32_1081_c1_10029_10778 246
344 3300050511 nmdc:mga08y16_3118_c1 nmdc:mga08y16_3118_c1_2660_3409 246
345 3300053134 Ga0500658_0054397 Ga0500658_0054397_444_1193 246
346 3300053136 Ga0500559_0028705 Ga0500559_0028705_1269_2036 246
347 2162886012 MBSR1b_contig_5265137 MBSR1b_0415.00000880 247
348 3300001904 JGI24736J21556_1005357 JGI24736J21556_10053571 247
349 3300001904 JGI24736J21556_1022349 JGI24736J21556_10223492 247
350 3300001915 JGI24741J21665_1002526 JGI24741J21665_10025261 247
351 3300001979 JGI24740J21852_10014992 JGI24740J21852_100149922 247
352 3300001989 JGI24739J22299_10002950 JGI24739J22299_100029507 247
353 3300001990 JGI24737J22298_10015622 JGI24737J22298_100156222 247
354 3300002067 JGI24735J21928_10010809 JGI24735J21928_100108093 247
355 3300002075 JGI24738J21930_10007984 JGI24738J21930_100079842 247
356 3300005290 Ga0065712_10000823 Ga0065712_100008232 247
357 3300005293 Ga0065715_10090806 Ga0065715_100908062 247
358 3300005327 Ga0070658_10002474 Ga0070658_1000247411 247
359 3300005327 Ga0070658_10042912 Ga0070658_100429121 247
360 3300005329 Ga0070683_100213104 Ga0070683_1002131042 247
361 3300005329 Ga0070683_100223241 Ga0070683_1002232411 247
362 3300005331 Ga0070670_100015818 Ga0070670_1000158182 247
363 3300005334 Ga0068869_100357672 Ga0068869_1003576722 247
364 3300005340 Ga0070689_100009063 Ga0070689_1000090636 247
365 3300005340 Ga0070689_100012455 Ga0070689_1000124553 247
366 3300005344 Ga0070661_100007515 Ga0070661_1000075157 247
367 3300005344 Ga0070661_100029702 Ga0070661_1000297025 247
368 3300005344 Ga0070661_100074220 Ga0070661_1000742202 247
369 3300005345 Ga0070692_10317777 Ga0070692_103177771 247
370 3300005355 Ga0070671_100028501 Ga0070671_1000285013 247
371 3300005364 Ga0070673_100000424 Ga0070673_1000004246 247
372 3300005365 Ga0070688_100008010 Ga0070688_1000080104 247
373 3300005367 Ga0070667_100097267 Ga0070667_1000972672 247
374 3300005367 Ga0070667_100290072 Ga0070667_1002900722 247
375 3300005367 Ga0070667_100332706 Ga0070667_1003327062 247
376 3300005438 Ga0070701_10021214 Ga0070701_100212142 247
377 3300005438 Ga0070701_10053196 Ga0070701_100531962 247
378 3300005439 Ga0070711_100073457 Ga0070711_1000734572 247
379 3300005441 Ga0070700_100040140 Ga0070700_1000401403 247
380 3300005444 Ga0070694_100278811 Ga0070694_1002788112 247
381 3300005444 Ga0070694_100417651 Ga0070694_1004176512 247
382 3300005455 Ga0070663_100655019 Ga0070663_1006550191 247
383 3300005456 Ga0070678_100125227 Ga0070678_1001252273 247
384 3300005459 Ga0068867_100003116 Ga0068867_1000031166 247
385 3300005466 Ga0070685_10016226 Ga0070685_100162264 247
386 3300005471 Ga0070698_100390706 Ga0070698_1003907061 247
387 3300005535 Ga0070684_100000961 Ga0070684_1000009612 247
388 3300005535 Ga0070684_100060808 Ga0070684_1000608083 247
389 3300005535 Ga0070684_100101342 Ga0070684_1001013422 247
390 3300005539 Ga0068853_100018610 Ga0068853_1000186105 247
391 3300005539 Ga0068853_100020619 Ga0068853_1000206193 247
392 3300005544 Ga0070686_100004719 Ga0070686_1000047197 247
393 3300005544 Ga0070686_100401212 Ga0070686_1004012121 247
394 3300005548 Ga0070665_100012386 Ga0070665_1000123866 247
395 3300005548 Ga0070665_100033852 Ga0070665_1000338524 247
396 3300005549 Ga0070704_100006533 Ga0070704_1000065333 247
397 3300005563 Ga0068855_100081841 Ga0068855_1000818415 247
398 3300005563 Ga0068855_100110104 Ga0068855_1001101043 247
399 3300005563 Ga0068855_100329255 Ga0068855_1003292551 247
400 3300005564 Ga0070664_100002746 Ga0070664_1000027464 247
401 3300005564 Ga0070664_100003622 Ga0070664_1000036227 247
402 3300005577 Ga0068857_100051779 Ga0068857_1000517793 247
403 3300005578 Ga0068854_100003441 Ga0068854_1000034415 247
404 3300005578 Ga0068854_100068317 Ga0068854_1000683172 247
405 3300005614 Ga0068856_100003461 Ga0068856_1000034615 247
406 3300005615 Ga0070702_100011307 Ga0070702_1000113074 247
407 3300005616 Ga0068852_100000071 Ga0068852_1000000715 247
408 3300005616 Ga0068852_100043899 Ga0068852_1000438993 247
409 3300005616 Ga0068852_100822370 Ga0068852_1008223702 247
410 3300005617 Ga0068859_100003353 Ga0068859_1000033532 247
411 3300005617 Ga0068859_100009246 Ga0068859_1000092464 247
412 3300005618 Ga0068864_100001004 Ga0068864_10000100414 247
413 3300005618 Ga0068864_100003123 Ga0068864_1000031236 247
414 3300005719 Ga0068861_100202682 Ga0068861_1002026822 247
415 3300005834 Ga0068851_10080472 Ga0068851_100804722 247
416 3300005834 Ga0068851_10103712 Ga0068851_101037122 247
417 3300005841 Ga0068863_100002861 Ga0068863_1000028618 247
418 3300005841 Ga0068863_100031147 Ga0068863_1000311474 247
419 3300005841 Ga0068863_100478402 Ga0068863_1004784022 247
420 3300005842 Ga0068858_100001593 Ga0068858_10000159311 247
421 3300005842 Ga0068858_100003959 Ga0068858_10000395910 247
422 3300005843 Ga0068860_100019671 Ga0068860_1000196712 247
423 3300005843 Ga0068860_100224996 Ga0068860_1002249961 247
424 3300005844 Ga0068862_100002390 Ga0068862_10000239013 247
425 3300005937 Ga0081455_10053881 Ga0081455_100538811 247
426 3300006358 Ga0068871_100824194 Ga0068871_1008241942 247
427 3300006844 Ga0075428_100000063 Ga0075428_10000006313 247
428 3300006844 Ga0075428_100006823 Ga0075428_10000682310 247
429 3300006844 Ga0075428_100020345 Ga0075428_1000203452 247
430 3300006844 Ga0075428_100064492 Ga0075428_1000644925 247
431 3300006846 Ga0075430_100003094 Ga0075430_1000030944 247
432 3300006846 Ga0075430_100008747 Ga0075430_1000087473 247
433 3300006846 Ga0075430_100170080 Ga0075430_1001700801 247
434 3300006847 Ga0075431_100000153 Ga0075431_10000015314 247
435 3300006847 Ga0075431_100010031 Ga0075431_1000100319 247
436 3300006847 Ga0075431_100024347 Ga0075431_1000243472 247
437 3300006852 Ga0075433_10297585 Ga0075433_102975851 247
438 3300006880 Ga0075429_100007378 Ga0075429_1000073783 247
439 3300006880 Ga0075429_100052386 Ga0075429_1000523863 247
440 3300006931 Ga0097620_100003353 Ga0097620_1000033532 247
441 3300006931 Ga0097620_100009246 Ga0097620_1000092464 247
442 3300009093 Ga0105240_10003822 Ga0105240_100038228 247
443 3300009094 Ga0111539_10084743 Ga0111539_100847433 247
444 3300009094 Ga0111539_10156418 Ga0111539_101564182 247
445 3300009098 Ga0105245_10003333 Ga0105245_100033333 247
446 3300009101 Ga0105247_10001916 Ga0105247_100019163 247
447 3300009101 Ga0105247_10039067 Ga0105247_100390673 247
448 3300009147 Ga0114129_10002649 Ga0114129_1000264913 247
449 3300009148 Ga0105243_10024998 Ga0105243_100249984 247
450 3300009174 Ga0105241_10033710 Ga0105241_100337103 247
451 3300009174 Ga0105241_10033715 Ga0105241_100337153 247
452 3300009177 Ga0105248_10010569 Ga0105248_100105696 247
453 3300009177 Ga0105248_10179508 Ga0105248_101795082 247
454 3300009545 Ga0105237_10144032 Ga0105237_101440321 247
455 3300009545 Ga0105237_10189439 Ga0105237_101894393 247
456 3300009545 Ga0105237_10238219 Ga0105237_102382192 247
457 3300009551 Ga0105238_10013185 Ga0105238_100131853 247
458 3300009551 Ga0105238_10239965 Ga0105238_102399652 247
459 3300009551 Ga0105238_10475684 Ga0105238_104756842 247
460 3300009553 Ga0105249_10008641 Ga0105249_100086417 247
461 3300009553 Ga0105249_10009842 Ga0105249_100098422 247
462 3300009553 Ga0105249_10444090 Ga0105249_104440902 247
463 3300010375 Ga0105239_10085224 Ga0105239_100852242 247
464 3300010375 Ga0105239_10192996 Ga0105239_101929962 247
465 3300010375 Ga0105239_10234507 Ga0105239_102345071 247
466 3300013100 Ga0157373_10050797 Ga0157373_100507973 247
467 3300013104 Ga0157370_10061358 Ga0157370_100613583 247
468 3300013306 Ga0163162_10033551 Ga0163162_100335518 247
469 3300013307 Ga0157372_10273401 Ga0157372_102734013 247
470 3300013307 Ga0157372_11003355 Ga0157372_110033551 247
471 3300014325 Ga0163163_10001446 Ga0163163_1000144622 247
472 3300014325 Ga0163163_10002680 Ga0163163_100026803 247
473 3300014325 Ga0163163_10213119 Ga0163163_102131192 247
474 3300014326 Ga0157380_10299340 Ga0157380_102993402 247
475 3300014745 Ga0157377_10011478 Ga0157377_100114782 247
476 3300014745 Ga0157377_10082561 Ga0157377_100825612 247
477 3300014969 Ga0157376_10013623 Ga0157376_100136232 247
478 3300014969 Ga0157376_10043672 Ga0157376_100436723 247
479 3300025321 Ga0207656_10022333 Ga0207656_100223332 247
480 3300025711 Ga0207696_1061173 Ga0207696_10611732 247
481 3300025900 Ga0207710_10000896 Ga0207710_100008962 247
482 3300025900 Ga0207710_10126229 Ga0207710_101262292 247
483 3300025903 Ga0207680_10196445 Ga0207680_101964451 247
484 3300025904 Ga0207647_10020871 Ga0207647_100208715 247
485 3300025904 Ga0207647_10061232 Ga0207647_100612322 247
486 3300025909 Ga0207705_10000296 Ga0207705_1000029643 247
487 3300025911 Ga0207654_10049443 Ga0207654_100494433 247
488 3300025913 Ga0207695_10008061 Ga0207695_100080618 247
489 3300025913 Ga0207695_10029753 Ga0207695_100297537 247
490 3300025913 Ga0207695_10048208 Ga0207695_100482083 247
491 3300025914 Ga0207671_10029169 Ga0207671_100291694 247
492 3300025914 Ga0207671_10137992 Ga0207671_101379922 247
493 3300025916 Ga0207663_10229242 Ga0207663_102292422 247
494 3300025919 Ga0207657_10007889 Ga0207657_1000788913 247
495 3300025920 Ga0207649_10079748 Ga0207649_100797483 247
496 3300025920 Ga0207649_10105212 Ga0207649_101052123 247
497 3300025924 Ga0207694_10053546 Ga0207694_100535463 247
498 3300025924 Ga0207694_10117865 Ga0207694_101178651 247
499 3300025924 Ga0207694_10171645 Ga0207694_101716452 247
500 3300025924 Ga0207694_10199605 Ga0207694_101996052 247
501 3300025924 Ga0207694_10445164 Ga0207694_104451642 247
502 3300025925 Ga0207650_10108722 Ga0207650_101087222 247
503 3300025931 Ga0207644_10013563 Ga0207644_100135632 247
504 3300025931 Ga0207644_10018309 Ga0207644_100183096 247
505 3300025934 Ga0207686_10593784 Ga0207686_105937841 247
506 3300025935 Ga0207709_10071719 Ga0207709_100717193 247
507 3300025936 Ga0207670_10006974 Ga0207670_100069742 247
508 3300025941 Ga0207711_10016998 Ga0207711_100169983 247
509 3300025942 Ga0207689_10068433 Ga0207689_100684333 247
510 3300025942 Ga0207689_10157040 Ga0207689_101570402 247
511 3300025942 Ga0207689_10516760 Ga0207689_105167602 247
512 3300025944 Ga0207661_10196631 Ga0207661_101966312 247
513 3300025944 Ga0207661_10578684 Ga0207661_105786842 247
514 3300025945 Ga0207679_10052505 Ga0207679_100525053 247
515 3300025945 Ga0207679_10086225 Ga0207679_100862252 247
516 3300025945 Ga0207679_10282591 Ga0207679_102825912 247
517 3300025949 Ga0207667_10024806 Ga0207667_100248062 247
518 3300025949 Ga0207667_10422433 Ga0207667_104224331 247
519 3300025961 Ga0207712_10028546 Ga0207712_100285463 247
520 3300025961 Ga0207712_10471938 Ga0207712_104719382 247
521 3300025981 Ga0207640_10002183 Ga0207640_100021838 247
522 3300025981 Ga0207640_10015976 Ga0207640_100159763 247
523 3300025981 Ga0207640_10134001 Ga0207640_101340012 247
524 3300025981 Ga0207640_10254247 Ga0207640_102542472 247
525 3300025986 Ga0207658_10024024 Ga0207658_100240242 247
526 3300025986 Ga0207658_10633805 Ga0207658_106338051 247
527 3300026023 Ga0207677_10013950 Ga0207677_100139502 247
528 3300026035 Ga0207703_10016370 Ga0207703_100163704 247
529 3300026041 Ga0207639_10006607 Ga0207639_100066074 247
530 3300026041 Ga0207639_10092146 Ga0207639_100921463 247
531 3300026041 Ga0207639_10116283 Ga0207639_101162832 247
532 3300026067 Ga0207678_10180936 Ga0207678_101809361 247
533 3300026075 Ga0207708_10049663 Ga0207708_100496634 247
534 3300026075 Ga0207708_10082338 Ga0207708_100823382 247
535 3300026078 Ga0207702_10008059 Ga0207702_100080594 247
536 3300026078 Ga0207702_10043447 Ga0207702_100434474 247
537 3300026078 Ga0207702_10217734 Ga0207702_102177342 247
538 3300026088 Ga0207641_10015129 Ga0207641_100151292 247
539 3300026089 Ga0207648_10005323 Ga0207648_100053239 247
540 3300026095 Ga0207676_10012870 Ga0207676_100128705 247
541 3300026095 Ga0207676_10018688 Ga0207676_100186881 247
542 3300026116 Ga0207674_10006473 Ga0207674_1000647314 247
543 3300026116 Ga0207674_10169456 Ga0207674_101694562 247
544 3300026118 Ga0207675_100004752 Ga0207675_1000047522 247
545 3300026118 Ga0207675_100008570 Ga0207675_1000085703 247
546 3300026142 Ga0207698_10000062 Ga0207698_1000006267 247
547 3300026142 Ga0207698_10061036 Ga0207698_100610364 247
548 3300027876 Ga0209974_10133224 Ga0209974_101332241 247
549 3300027907 Ga0207428_10016699 Ga0207428_100166993 247
550 3300028379 Ga0268266_10006954 Ga0268266_100069545 247
551 3300028379 Ga0268266_10086297 Ga0268266_100862973 247
552 3300028380 Ga0268265_10012350 Ga0268265_100123504 247
553 3300028381 Ga0268264_10153014 Ga0268264_101530141 247
554 3300030521 Ga0307511_10000421 Ga0307511_1000042112 247
555 3300031507 Ga0307509_10000001 Ga0307509_10000001421 247
556 3300031548 Ga0307408_100057086 Ga0307408_1000570863 247
557 3300031548 Ga0307408_100270892 Ga0307408_1002708922 247
558 3300031548 Ga0307408_100371043 Ga0307408_1003710432 247
559 3300031731 Ga0307405_10041640 Ga0307405_100416402 247
560 3300031731 Ga0307405_10200906 Ga0307405_102009062 247
561 3300031731 Ga0307405_10286964 Ga0307405_102869642 247
562 3300031733 Ga0316577_10072546 Ga0316577_100725462 247
563 3300031824 Ga0307413_10072270 Ga0307413_100722701 247
564 3300031901 Ga0307406_10047396 Ga0307406_100473964 247
565 3300031901 Ga0307406_10130922 Ga0307406_101309222 247
566 3300031911 Ga0307412_10045565 Ga0307412_100455652 247
567 3300032002 Ga0307416_100281282 Ga0307416_1002812821 247
568 3300032004 Ga0307414_10038517 Ga0307414_100385173 247
569 3300032005 Ga0307411_10067423 Ga0307411_100674232 247
570 3300039437 Ga0436365_0727391 Ga0436365_0727391_501_1274 247
571 3300039450 Ga0436363_0142755 Ga0436363_0142755_120_893 247
572 3300045051 Ga0451576_0013203 Ga0451576_0013203_4869_5612 247
573 3300046455 Ga0495603_0106393 Ga0495603_0106393_733_1503 247
574 3300048905 Ga0496102_0018421 Ga0496102_0018421_5229_5981 247
575 3300048905 Ga0496102_0118072 Ga0496102_0118072_444_1220 247
576 3300048909 Ga0496106_0228939 Ga0496106_0228939_148_891 247
577 3300048915 Ga0496112_0189663 Ga0496112_0189663_888_1631 247
578 3300048916 Ga0496113_0069148 Ga0496113_0069148_1402_2172 247
579 3300048917 Ga0496114_0001110 Ga0496114_0001110_8065_8835 247
580 3300048918 Ga0496115_0182372 Ga0496115_0182372_893_1663 247
581 3300048921 Ga0496118_0032250 Ga0496118_0032250_1747_2499 247
582 3300048924 Ga0496121_0003359 Ga0496121_0003359_18702_19478 247
583 3300048928 Ga0496125_0012336 Ga0496125_0012336_954_1730 247
584 3300050507 nmdc:mga05p37_4486_c1 nmdc:mga05p37_4486_c1_6775_7542 247
585 3300050508 nmdc:mga09592_8711_c1 nmdc:mga09592_8711_c1_5813_6580 247
586 3300050509 nmdc:mga0qj67_193955_c1 nmdc:mga0qj67_193955_c1_757_1521 247
587 3300050509 nmdc:mga0qj67_2471_c1 nmdc:mga0qj67_2471_c1_4356_5123 247
588 3300050509 nmdc:mga0qj67_25849_c1 nmdc:mga0qj67_25849_c1_1174_1956 247
589 3300050510 nmdc:mga06r32_10475_c1 nmdc:mga06r32_10475_c1_1192_1959 247
590 3300050510 nmdc:mga06r32_1893_c1 nmdc:mga06r32_1893_c1_9746_10528 247
591 3300050510 nmdc:mga06r32_775385_c1 nmdc:mga06r32_775385_c1_33_800 247
592 3300050511 nmdc:mga08y16_239036_c1 nmdc:mga08y16_239036_c1_186_950 247
593 3300050511 nmdc:mga08y16_410782_c1 nmdc:mga08y16_410782_c1_425_1192 247
594 3300053100 Ga0500660_090480 Ga0500660_090480_68_850 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

95

242

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.9292 99 232
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9224 101 234
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.9105 101 241
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.9102 101 241
2bpb-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella 0.91 99 241
ID Description Score Start End Superfamily
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9279 99 234 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9202 99 234 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9185 101 241 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9067 99 237 3.90.420.10
af_A0A0R4IKF7_192_441_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9 99 232 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A7X8KVW6-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9561 101 227 GO:0006790
GO:0008482
GO:0020037
GO:0043546
AF-A0A2E5KMI3-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.952 99 232 GO:0006790
GO:0008482
GO:0020037
GO:0043546
AF-A0A6J7TS42-F1-model_v4 Unannotated protein 0.9497 99 235
AF-A0A849QLQ0-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9492 99 235
AF-A0A3D1TRN0-F1-model_v4 Oxidoreductase 0.9459 99 234 GO:0016020

Feature Viewer

pLDDT pTM Quality
80.16 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map