F467363
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 594 | 292 | 1188 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0003369|Ga0495638_0003369_5243_6127 |
| Length | 294 |
| Sequence | LQHPAAAIPHFDDAPATPSPYKCSVLISSEVDAVKQAPPYVPGHQLLAGKSVLITAAAGAGIGYSAARRSAEEGCRALMISDVHARRLEEAVERLKAETGLQAIYGQVCNVTIEDEVQALVAAAEEALGGVDVLINNAGLGGQKRVMDMSDEEWLRVLDVTLTGTFRMTRAMLPHMQRRGAGAIVNNASVLGWRAQKEQAHYAAAKAGVMAFTRCSALEAAEFGVRINAVSPSIALHDFLKKASSEELLASLAGREAFGRAAEVWEVANVMMFLASDYASYMVGEVLSVSSQQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 139 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 148 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 153 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 154 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 155 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 220 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 229 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 230 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 231 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 232 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 246 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 247 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 248 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 254 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 256 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 259 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 260 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 261 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 262 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 263 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 273 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 277 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 278 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 279 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 280 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 281 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 282 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 283 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 284 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 285 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 286 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 287 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 288 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 289 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 290 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 291 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 292 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.31 |
| Metatranscriptomes | 0.17 |
| Isolates | 2.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 0.34 |
| Rhizoplane | 8.42 |
| Rhizosphere | 78.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495638_0003369 | 3300046460 | Bacteria | 12604 |
| 2 | SwRhRL2b_contig_2149026 | 2162886007 | Bacteria | 5324 |
| 3 | SwRhRL2b_contig_2334788 | 2162886007 | Bacteria | 75171 |
| 4 | JGI24752J21851_1005971 | 3300001976 | Bacteria | 1591 |
| 5 | JGI24740J21852_10009422 | 3300001979 | Bacteria | 3824 |
| 6 | JGI24737J22298_10008340 | 3300001990 | Bacteria | 3473 |
| 7 | JGI24735J21928_10008586 | 3300002067 | Bacteria | 3299 |
| 8 | JGI24748J21848_1002846 | 3300002074 | Bacteria | 1970 |
| 9 | JGI24749J21850_1000150 | 3300002076 | Bacteria | 11138 |
| 10 | JGI24034J26672_10000934 | 3300002239 | Bacteria | 3796 |
| 11 | JGI24034J26672_10002693 | 3300002239 | Bacteria | 2448 |
| 12 | JGI24034J26672_10006054 | 3300002239 | Bacteria | 1743 |
| 13 | JGI24751J29686_10000002 | 3300002459 | Bacteria | 160619 |
| 14 | JGI24751J29686_10021053 | 3300002459 | Bacteria | 1352 |
| 15 | Ga0055536_1000120 | 3300003781 | Bacteria | 68066 |
| 16 | Ga0065714_10005046 | 3300005288 | Bacteria | 5440 |
| 17 | Ga0065704_10000342 | 3300005289 | Bacteria | 36460 |
| 18 | Ga0065704_10002516 | 3300005289 | Bacteria | 5892 |
| 19 | Ga0065704_10070166 | 3300005289 | Bacteria | 176609 |
| 20 | Ga0065704_10072848 | 3300005289 | Bacteria | 7929 |
| 21 | Ga0065707_10081815 | 3300005295 | Bacteria | 36952 |
| 22 | Ga0065707_10082422 | 3300005295 | Bacteria | 15385 |
| 23 | Ga0065707_10095831 | 3300005295 | Bacteria | 3333 |
| 24 | Ga0070658_10000304 | 3300005327 | Bacteria | 42569 |
| 25 | Ga0070658_10008332 | 3300005327 | Bacteria | 8338 |
| 26 | Ga0070683_100262035 | 3300005329 | Bacteria | 1644 |
| 27 | Ga0070670_100000012 | 3300005331 | Bacteria | 256314 |
| 28 | Ga0070670_100000026 | 3300005331 | Bacteria | 187946 |
| 29 | Ga0070670_100005694 | 3300005331 | Bacteria | 10524 |
| 30 | Ga0070670_100028959 | 3300005331 | Bacteria | 4767 |
| 31 | Ga0070670_100086870 | 3300005331 | Bacteria | 2687 |
| 32 | Ga0070677_10054674 | 3300005333 | Bacteria | 1627 |
| 33 | Ga0070666_10017345 | 3300005335 | Bacteria | 4615 |
| 34 | Ga0070680_100279011 | 3300005336 | Bacteria | 1416 |
| 35 | Ga0070661_100009928 | 3300005344 | Bacteria | 6605 |
| 36 | Ga0070668_100000642 | 3300005347 | Bacteria | 23581 |
| 37 | Ga0070668_100001679 | 3300005347 | Bacteria | 16043 |
| 38 | Ga0070668_100021926 | 3300005347 | Bacteria | 4825 |
| 39 | Ga0070668_100033923 | 3300005347 | Bacteria | 3889 |
| 40 | Ga0070668_100164416 | 3300005347 | Bacteria | 1803 |
| 41 | Ga0070669_100000064 | 3300005353 | Bacteria | 107033 |
| 42 | Ga0070669_100000077 | 3300005353 | Bacteria | 95577 |
| 43 | Ga0070669_100000199 | 3300005353 | Bacteria | 52239 |
| 44 | Ga0070669_100001050 | 3300005353 | Bacteria | 20195 |
| 45 | Ga0070669_100002158 | 3300005353 | Bacteria | 14232 |
| 46 | Ga0070669_100006689 | 3300005353 | Bacteria | 8298 |
| 47 | Ga0070669_100013893 | 3300005353 | Bacteria | 5726 |
| 48 | Ga0070671_100000077 | 3300005355 | Bacteria | 62532 |
| 49 | Ga0070671_100000863 | 3300005355 | Bacteria | 22137 |
| 50 | Ga0070671_100001302 | 3300005355 | Bacteria | 18731 |
| 51 | Ga0070671_100003136 | 3300005355 | Bacteria | 12877 |
| 52 | Ga0070671_100023407 | 3300005355 | Bacteria | 5055 |
| 53 | Ga0070688_100277321 | 3300005365 | Bacteria | 1203 |
| 54 | Ga0070659_100023370 | 3300005366 | Bacteria | 4729 |
| 55 | Ga0070667_100000002 | 3300005367 | Bacteria | 504831 |
| 56 | Ga0070667_100000828 | 3300005367 | Bacteria | 28754 |
| 57 | Ga0070667_100001698 | 3300005367 | Bacteria | 19689 |
| 58 | Ga0070667_100002772 | 3300005367 | Bacteria | 15143 |
| 59 | Ga0070667_100015584 | 3300005367 | Bacteria | 6284 |
| 60 | Ga0070667_100036976 | 3300005367 | Bacteria | 4093 |
| 61 | Ga0070709_10199934 | 3300005434 | Bacteria | 1415 |
| 62 | Ga0070713_100003202 | 3300005436 | Bacteria | 10776 |
| 63 | Ga0070713_100085797 | 3300005436 | Bacteria | 2697 |
| 64 | Ga0070710_10008731 | 3300005437 | Bacteria | 4942 |
| 65 | Ga0070710_10052968 | 3300005437 | Bacteria | 2284 |
| 66 | Ga0070711_100006415 | 3300005439 | Bacteria | 7094 |
| 67 | Ga0070705_100124955 | 3300005440 | Bacteria | 1668 |
| 68 | Ga0070663_100007527 | 3300005455 | Bacteria | 6633 |
| 69 | Ga0070678_100059574 | 3300005456 | Bacteria | 2807 |
| 70 | Ga0070662_100044811 | 3300005457 | Bacteria | 3170 |
| 71 | Ga0068867_100040064 | 3300005459 | Bacteria | 3417 |
| 72 | Ga0070685_10000009 | 3300005466 | Bacteria | 166260 |
| 73 | Ga0070685_10008897 | 3300005466 | Bacteria | 5177 |
| 74 | Ga0070684_100137999 | 3300005535 | Bacteria | 2203 |
| 75 | Ga0070672_100071928 | 3300005543 | Bacteria | 2752 |
| 76 | Ga0070665_100000163 | 3300005548 | Bacteria | 121320 |
| 77 | Ga0070665_100013238 | 3300005548 | Bacteria | 8309 |
| 78 | Ga0070665_100026151 | 3300005548 | Bacteria | 5876 |
| 79 | Ga0070665_100107348 | 3300005548 | Bacteria | 2794 |
| 80 | Ga0070665_100153609 | 3300005548 | Bacteria | 2304 |
| 81 | Ga0070665_100200590 | 3300005548 | Bacteria | 1995 |
| 82 | Ga0068855_100003651 | 3300005563 | Bacteria | 18824 |
| 83 | Ga0068855_100020494 | 3300005563 | Bacteria | 7928 |
| 84 | Ga0068855_100111522 | 3300005563 | Bacteria | 3140 |
| 85 | Ga0068857_100584268 | 3300005577 | Bacteria | 1055 |
| 86 | Ga0068854_100000322 | 3300005578 | Bacteria | 31553 |
| 87 | Ga0068854_100434966 | 3300005578 | Bacteria | 1092 |
| 88 | Ga0068852_100000357 | 3300005616 | Bacteria | 30774 |
| 89 | Ga0068852_100005824 | 3300005616 | Bacteria | 8850 |
| 90 | Ga0068859_100022203 | 3300005617 | Bacteria | 6363 |
| 91 | Ga0068859_100121149 | 3300005617 | Bacteria | 2682 |
| 92 | Ga0068859_100145896 | 3300005617 | Bacteria | 2441 |
| 93 | Ga0068859_100164400 | 3300005617 | Bacteria | 2299 |
| 94 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 95 | Ga0068864_100000010 | 3300005618 | Bacteria | 358723 |
| 96 | Ga0068864_100365999 | 3300005618 | Bacteria | 1363 |
| 97 | Ga0068861_100006004 | 3300005719 | Bacteria | 8255 |
| 98 | Ga0068861_100015123 | 3300005719 | Bacteria | 5431 |
| 99 | Ga0068861_100274352 | 3300005719 | Bacteria | 1449 |
| 100 | Ga0068851_10027096 | 3300005834 | Bacteria | 2822 |
| 101 | Ga0068863_100054520 | 3300005841 | Bacteria | 3788 |
| 102 | Ga0068863_100197837 | 3300005841 | Bacteria | 1932 |
| 103 | Ga0068863_100272119 | 3300005841 | Bacteria | 1640 |
| 104 | Ga0068858_100052357 | 3300005842 | Bacteria | 3777 |
| 105 | Ga0068858_100070810 | 3300005842 | Bacteria | 3233 |
| 106 | Ga0068858_100118826 | 3300005842 | Bacteria | 2471 |
| 107 | Ga0068860_100000450 | 3300005843 | Bacteria | 52006 |
| 108 | Ga0068860_100000474 | 3300005843 | Bacteria | 49979 |
| 109 | Ga0068860_100001423 | 3300005843 | Bacteria | 25915 |
| 110 | Ga0068860_100021734 | 3300005843 | Bacteria | 6209 |
| 111 | Ga0068860_100086783 | 3300005843 | Bacteria | 2978 |
| 112 | Ga0068860_100232945 | 3300005843 | Bacteria | 1790 |
| 113 | Ga0068862_100000016 | 3300005844 | Bacteria | 250031 |
| 114 | Ga0068862_100000105 | 3300005844 | Bacteria | 99930 |
| 115 | Ga0068862_100011447 | 3300005844 | Bacteria | 7322 |
| 116 | Ga0068862_100061327 | 3300005844 | Bacteria | 3232 |
| 117 | Ga0068862_100080104 | 3300005844 | Bacteria | 2831 |
| 118 | Ga0070717_10165463 | 3300006028 | Bacteria | 1921 |
| 119 | Ga0070717_10244363 | 3300006028 | Bacteria | 1584 |
| 120 | Ga0075432_10006547 | 3300006058 | Bacteria | 3965 |
| 121 | Ga0075432_10035849 | 3300006058 | Bacteria | 1723 |
| 122 | Ga0070715_10000618 | 3300006163 | Bacteria | 9385 |
| 123 | Ga0070716_100005358 | 3300006173 | Bacteria | 6206 |
| 124 | Ga0070712_100002095 | 3300006175 | Bacteria | 12257 |
| 125 | Ga0097621_100016928 | 3300006237 | Bacteria | 5526 |
| 126 | Ga0075436_100087011 | 3300006914 | Bacteria | 2170 |
| 127 | Ga0097620_100022203 | 3300006931 | Bacteria | 6363 |
| 128 | Ga0097620_100121150 | 3300006931 | Bacteria | 2682 |
| 129 | Ga0097620_100145893 | 3300006931 | Bacteria | 2441 |
| 130 | Ga0097620_100164402 | 3300006931 | Bacteria | 2299 |
| 131 | Ga0105251_10001177 | 3300009011 | Bacteria | 22695 |
| 132 | Ga0105251_10025901 | 3300009011 | Bacteria | 2992 |
| 133 | Ga0105250_10000186 | 3300009092 | Bacteria | 53643 |
| 134 | Ga0105250_10004727 | 3300009092 | Bacteria | 6217 |
| 135 | Ga0105240_10008858 | 3300009093 | Bacteria | 14330 |
| 136 | Ga0105245_10013559 | 3300009098 | Bacteria | 7100 |
| 137 | Ga0105247_10051785 | 3300009101 | Bacteria | 2530 |
| 138 | Ga0114129_10075734 | 3300009147 | Bacteria | 4685 |
| 139 | Ga0114129_10467360 | 3300009147 | Bacteria | 1652 |
| 140 | Ga0114129_10712933 | 3300009147 | Bacteria | 1288 |
| 141 | Ga0105242_10036936 | 3300009176 | Bacteria | 3922 |
| 142 | Ga0105248_10003755 | 3300009177 | Bacteria | 16832 |
| 143 | Ga0105248_10007376 | 3300009177 | Bacteria | 12073 |
| 144 | Ga0105248_10029610 | 3300009177 | Bacteria | 6108 |
| 145 | Ga0105248_10051605 | 3300009177 | Bacteria | 4615 |
| 146 | Ga0105248_10079599 | 3300009177 | Bacteria | 3683 |
| 147 | Ga0105248_10132984 | 3300009177 | Bacteria | 2807 |
| 148 | Ga0105248_10418436 | 3300009177 | Bacteria | 1509 |
| 149 | Ga0105237_10224366 | 3300009545 | Bacteria | 1879 |
| 150 | Ga0105238_10004267 | 3300009551 | Bacteria | 14204 |
| 151 | Ga0105249_10000004 | 3300009553 | Bacteria | 368014 |
| 152 | Ga0105249_10030205 | 3300009553 | Bacteria | 4897 |
| 153 | Ga0105249_10047668 | 3300009553 | Bacteria | 3905 |
| 154 | Ga0105249_10095271 | 3300009553 | Bacteria | 2791 |
| 155 | Ga0105148_100366 | 3300009978 | Bacteria | 5050 |
| 156 | Ga0157373_10118934 | 3300013100 | Bacteria | 1857 |
| 157 | Ga0157369_10068106 | 3300013105 | Bacteria | 3824 |
| 158 | Ga0157378_10098766 | 3300013297 | Bacteria | 2663 |
| 159 | Ga0163162_10043682 | 3300013306 | Bacteria | 4487 |
| 160 | Ga0163162_10196113 | 3300013306 | Bacteria | 2148 |
| 161 | Ga0157372_10032844 | 3300013307 | Bacteria | 5693 |
| 162 | Ga0157375_10060892 | 3300013308 | Bacteria | 3746 |
| 163 | Ga0163163_10000081 | 3300014325 | Bacteria | 104678 |
| 164 | Ga0163163_10131859 | 3300014325 | Bacteria | 2539 |
| 165 | Ga0163163_10320707 | 3300014325 | Bacteria | 1603 |
| 166 | Ga0157380_10000025 | 3300014326 | Bacteria | 107388 |
| 167 | Ga0157380_10001518 | 3300014326 | Bacteria | 15240 |
| 168 | Ga0157380_10006959 | 3300014326 | Bacteria | 8003 |
| 169 | Ga0157380_10180702 | 3300014326 | Bacteria | 1853 |
| 170 | Ga0157379_10000207 | 3300014968 | Bacteria | 45489 |
| 171 | Ga0157379_10012452 | 3300014968 | Bacteria | 7428 |
| 172 | Ga0157379_10224363 | 3300014968 | Bacteria | 1703 |
| 173 | Ga0163161_10001576 | 3300017792 | Bacteria | 16816 |
| 174 | Ga0163161_10016614 | 3300017792 | Bacteria | 5140 |
| 175 | Ga0163161_10079152 | 3300017792 | Bacteria | 2416 |
| 176 | Ga0163161_10330035 | 3300017792 | Bacteria | 1208 |
| 177 | Ga0209676_1000081 | 3300025292 | Bacteria | 285297 |
| 178 | Ga0209050_1000232 | 3300025298 | Bacteria | 121822 |
| 179 | Ga0209050_1001468 | 3300025298 | Bacteria | 25215 |
| 180 | Ga0207697_10087619 | 3300025315 | Bacteria | 1317 |
| 181 | Ga0207696_1000455 | 3300025711 | Bacteria | 35742 |
| 182 | Ga0207696_1001933 | 3300025711 | Bacteria | 10530 |
| 183 | Ga0207713_1000436 | 3300025735 | Bacteria | 43987 |
| 184 | Ga0207713_1010386 | 3300025735 | Bacteria | 5153 |
| 185 | Ga0207713_1037853 | 3300025735 | Bacteria | 2052 |
| 186 | Ga0207692_10024356 | 3300025898 | Bacteria | 2813 |
| 187 | Ga0207680_10005804 | 3300025903 | Bacteria | 5926 |
| 188 | Ga0207680_10098349 | 3300025903 | Bacteria | 1875 |
| 189 | Ga0207680_10108045 | 3300025903 | Bacteria | 1799 |
| 190 | Ga0207680_10299123 | 3300025903 | Bacteria | 1121 |
| 191 | Ga0207647_10012068 | 3300025904 | Bacteria | 6030 |
| 192 | Ga0207647_10013300 | 3300025904 | Bacteria | 5710 |
| 193 | Ga0207685_10034338 | 3300025905 | Bacteria | 1842 |
| 194 | Ga0207699_10127061 | 3300025906 | Bacteria | 1657 |
| 195 | Ga0207645_10001237 | 3300025907 | Bacteria | 21011 |
| 196 | Ga0207643_10269161 | 3300025908 | Bacteria | 1054 |
| 197 | Ga0207705_10000007 | 3300025909 | Bacteria | 597387 |
| 198 | Ga0207654_10004912 | 3300025911 | Bacteria | 6770 |
| 199 | Ga0207695_10004035 | 3300025913 | Bacteria | 20196 |
| 200 | Ga0207671_10021901 | 3300025914 | Bacteria | 4842 |
| 201 | Ga0207671_10088527 | 3300025914 | Bacteria | 2329 |
| 202 | Ga0207693_10000379 | 3300025915 | Bacteria | 40846 |
| 203 | Ga0207660_10102410 | 3300025917 | Bacteria | 2140 |
| 204 | Ga0207657_10006357 | 3300025919 | Bacteria | 12272 |
| 205 | Ga0207646_10151843 | 3300025922 | Bacteria | 2089 |
| 206 | Ga0207646_10607910 | 3300025922 | Bacteria | 981 |
| 207 | Ga0207681_10000013 | 3300025923 | Bacteria | 357411 |
| 208 | Ga0207681_10000081 | 3300025923 | Bacteria | 85588 |
| 209 | Ga0207681_10000255 | 3300025923 | Bacteria | 40599 |
| 210 | Ga0207681_10001754 | 3300025923 | Bacteria | 13928 |
| 211 | Ga0207681_10007751 | 3300025923 | Bacteria | 6578 |
| 212 | Ga0207681_10023665 | 3300025923 | Bacteria | 3932 |
| 213 | Ga0207681_10045258 | 3300025923 | Bacteria | 2954 |
| 214 | Ga0207681_10174143 | 3300025923 | Bacteria | 1633 |
| 215 | Ga0207694_10009301 | 3300025924 | Bacteria | 7416 |
| 216 | Ga0207694_10019117 | 3300025924 | Bacteria | 5179 |
| 217 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 218 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 219 | Ga0207650_10030450 | 3300025925 | Bacteria | 3888 |
| 220 | Ga0207664_10047178 | 3300025929 | Bacteria | 3383 |
| 221 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 222 | Ga0207644_10000020 | 3300025931 | Bacteria | 165455 |
| 223 | Ga0207644_10001897 | 3300025931 | Bacteria | 13580 |
| 224 | Ga0207644_10005491 | 3300025931 | Bacteria | 8256 |
| 225 | Ga0207644_10016838 | 3300025931 | Bacteria | 4924 |
| 226 | Ga0207644_10254375 | 3300025931 | Bacteria | 1402 |
| 227 | Ga0207706_10008905 | 3300025933 | Bacteria | 9238 |
| 228 | Ga0207706_10060741 | 3300025933 | Bacteria | 3329 |
| 229 | Ga0207686_10059971 | 3300025934 | Bacteria | 2406 |
| 230 | Ga0207670_10214601 | 3300025936 | Bacteria | 1469 |
| 231 | Ga0207704_10018191 | 3300025938 | Bacteria | 3664 |
| 232 | Ga0207665_10002705 | 3300025939 | Bacteria | 11892 |
| 233 | Ga0207691_10001275 | 3300025940 | Bacteria | 25192 |
| 234 | Ga0207711_10001343 | 3300025941 | Bacteria | 23216 |
| 235 | Ga0207711_10001838 | 3300025941 | Bacteria | 19346 |
| 236 | Ga0207711_10001851 | 3300025941 | Bacteria | 19297 |
| 237 | Ga0207711_10031863 | 3300025941 | Bacteria | 4454 |
| 238 | Ga0207711_10096446 | 3300025941 | Bacteria | 2610 |
| 239 | Ga0207711_10246433 | 3300025941 | Bacteria | 1639 |
| 240 | Ga0207667_10004045 | 3300025949 | Bacteria | 18017 |
| 241 | Ga0207667_10008291 | 3300025949 | Bacteria | 12361 |
| 242 | Ga0207667_10018025 | 3300025949 | Bacteria | 7929 |
| 243 | Ga0207712_10000008 | 3300025961 | Bacteria | 527957 |
| 244 | Ga0207712_10067845 | 3300025961 | Bacteria | 2554 |
| 245 | Ga0207712_10077736 | 3300025961 | Bacteria | 2406 |
| 246 | Ga0207712_10148305 | 3300025961 | Bacteria | 1809 |
| 247 | Ga0207712_10256033 | 3300025961 | Bacteria | 1417 |
| 248 | Ga0207668_10003751 | 3300025972 | Bacteria | 8946 |
| 249 | Ga0207668_10004561 | 3300025972 | Bacteria | 8148 |
| 250 | Ga0207668_10005445 | 3300025972 | Bacteria | 7495 |
| 251 | Ga0207668_10060017 | 3300025972 | Bacteria | 2668 |
| 252 | Ga0207668_10310800 | 3300025972 | Bacteria | 1304 |
| 253 | Ga0207640_10000279 | 3300025981 | Bacteria | 34340 |
| 254 | Ga0207640_10016415 | 3300025981 | Bacteria | 4307 |
| 255 | Ga0207640_10292998 | 3300025981 | Bacteria | 1284 |
| 256 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 257 | Ga0207658_10001301 | 3300025986 | Bacteria | 19696 |
| 258 | Ga0207658_10003517 | 3300025986 | Bacteria | 11057 |
| 259 | Ga0207658_10007936 | 3300025986 | Bacteria | 7230 |
| 260 | Ga0207658_10015482 | 3300025986 | Bacteria | 5231 |
| 261 | Ga0207658_10066958 | 3300025986 | Bacteria | 2704 |
| 262 | Ga0207703_10010844 | 3300026035 | Bacteria | 7107 |
| 263 | Ga0207703_10012379 | 3300026035 | Bacteria | 6648 |
| 264 | Ga0207703_10083095 | 3300026035 | Bacteria | 2675 |
| 265 | Ga0207678_10016055 | 3300026067 | Bacteria | 6576 |
| 266 | Ga0207641_10005772 | 3300026088 | Bacteria | 10509 |
| 267 | Ga0207641_10043161 | 3300026088 | Bacteria | 3785 |
| 268 | Ga0207641_10050239 | 3300026088 | Bacteria | 3527 |
| 269 | Ga0207641_10295210 | 3300026088 | Bacteria | 1529 |
| 270 | Ga0207648_10006902 | 3300026089 | Bacteria | 11248 |
| 271 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 272 | Ga0207676_10000012 | 3300026095 | Bacteria | 353971 |
| 273 | Ga0207674_10004418 | 3300026116 | Bacteria | 16920 |
| 274 | Ga0207674_10152143 | 3300026116 | Bacteria | 2270 |
| 275 | Ga0207675_100000057 | 3300026118 | Bacteria | 81804 |
| 276 | Ga0207675_100007183 | 3300026118 | Bacteria | 10523 |
| 277 | Ga0207675_100014762 | 3300026118 | Bacteria | 7286 |
| 278 | Ga0207683_10000798 | 3300026121 | Bacteria | 28764 |
| 279 | Ga0207683_10763074 | 3300026121 | Bacteria | 897 |
| 280 | Ga0207698_10000919 | 3300026142 | Bacteria | 17125 |
| 281 | Ga0207698_10003339 | 3300026142 | Bacteria | 9657 |
| 282 | Ga0207698_10213872 | 3300026142 | Bacteria | 1736 |
| 283 | Ga0209971_1001080 | 3300027682 | Bacteria | 6932 |
| 284 | Ga0209966_1022150 | 3300027695 | Bacteria | 1241 |
| 285 | Ga0209998_10009053 | 3300027717 | Bacteria | 2062 |
| 286 | Ga0209974_10009783 | 3300027876 | Bacteria | 3250 |
| 287 | Ga0209974_10029862 | 3300027876 | Bacteria | 1807 |
| 288 | Ga0207428_10003679 | 3300027907 | Bacteria | 14756 |
| 289 | Ga0207428_10076296 | 3300027907 | Bacteria | 2625 |
| 290 | Ga0207428_10171339 | 3300027907 | Bacteria | 1644 |
| 291 | Ga0268266_10000205 | 3300028379 | Bacteria | 103915 |
| 292 | Ga0268266_10000945 | 3300028379 | Bacteria | 36992 |
| 293 | Ga0268266_10008275 | 3300028379 | Bacteria | 9268 |
| 294 | Ga0268266_10011566 | 3300028379 | Bacteria | 7660 |
| 295 | Ga0268266_10122578 | 3300028379 | Bacteria | 2315 |
| 296 | Ga0268266_10125830 | 3300028379 | Bacteria | 2287 |
| 297 | Ga0268266_10130268 | 3300028379 | Bacteria | 2249 |
| 298 | Ga0268266_10155668 | 3300028379 | Bacteria | 2064 |
| 299 | Ga0268266_10257209 | 3300028379 | Bacteria | 1617 |
| 300 | Ga0268265_10000006 | 3300028380 | Bacteria | 466482 |
| 301 | Ga0268265_10000216 | 3300028380 | Bacteria | 66604 |
| 302 | Ga0268265_10004038 | 3300028380 | Bacteria | 10333 |
| 303 | Ga0268265_10013639 | 3300028380 | Bacteria | 5527 |
| 304 | Ga0268265_10014446 | 3300028380 | Bacteria | 5380 |
| 305 | Ga0268265_10022817 | 3300028380 | Bacteria | 4403 |
| 306 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 307 | Ga0268264_10001169 | 3300028381 | Bacteria | 25510 |
| 308 | Ga0268264_10004485 | 3300028381 | Bacteria | 11912 |
| 309 | Ga0268264_10022075 | 3300028381 | Bacteria | 5195 |
| 310 | Ga0268264_10035438 | 3300028381 | Bacteria | 4108 |
| 311 | Ga0268264_10043053 | 3300028381 | Bacteria | 3740 |
| 312 | Ga0307517_10190725 | 3300028786 | Bacteria | 1302 |
| 313 | Ga0307515_10000192 | 3300028794 | Bacteria | 149030 |
| 314 | Ga0307515_10078846 | 3300028794 | Bacteria | 4324 |
| 315 | Ga0307512_10015238 | 3300030522 | Bacteria | 7135 |
| 316 | Ga0265331_10007423 | 3300031250 | Bacteria | 6344 |
| 317 | Ga0265327_10000229 | 3300031251 | Bacteria | 113907 |
| 318 | Ga0307509_10022794 | 3300031507 | Bacteria | 7047 |
| 319 | Ga0307516_10046421 | 3300031730 | Bacteria | 4286 |
| 320 | Ga0307405_10000504 | 3300031731 | Bacteria | 14716 |
| 321 | Ga0307406_10316255 | 3300031901 | Bacteria | 1206 |
| 322 | Ga0307412_10040364 | 3300031911 | Bacteria | 3019 |
| 323 | Ga0307414_10006131 | 3300032004 | Bacteria | 6678 |
| 324 | Ga0307414_10566588 | 3300032004 | Bacteria | 1014 |
| 325 | Ga0373934_0083460 | 3300035086 | Bacteria | 1284 |
| 326 | Ga0373935_0057225 | 3300035692 | Bacteria | 2487 |
| 327 | Ga0373933_0062920 | 3300035724 | Bacteria | 2242 |
| 328 | Ga0373933_0068470 | 3300035724 | Bacteria | 2156 |
| 329 | Ga0373937_0033412 | 3300036401 | Bacteria | 4671 |
| 330 | Ga0373937_0078930 | 3300036401 | Bacteria | 3042 |
| 331 | Ga0439438_001613 | 3300041405 | Bacteria | 9898 |
| 332 | Ga0439466_0007737 | 3300041411 | Bacteria | 4059 |
| 333 | Ga0450902_000064 | 3300042137 | Bacteria | 10289 |
| 334 | Ga0450903_000363 | 3300042138 | Bacteria | 9996 |
| 335 | Ga0451576_0236858 | 3300045051 | Bacteria | 1906 |
| 336 | Ga0466967_0009262 | 3300045976 | Bacteria | 7295 |
| 337 | Ga0495627_005890 | 3300046453 | Bacteria | 4870 |
| 338 | Ga0495590_0008769 | 3300046457 | Bacteria | 3846 |
| 339 | Ga0495638_0001649 | 3300046460 | Bacteria | 19767 |
| 340 | Ga0495638_0023345 | 3300046460 | Bacteria | 4045 |
| 341 | Ga0495638_0039020 | 3300046460 | Bacteria | 3016 |
| 342 | Ga0495651_0031298 | 3300046462 | Bacteria | 4149 |
| 343 | Ga0495653_0328959 | 3300046463 | Bacteria | 988 |
| 344 | Ga0495650_0001059 | 3300046471 | Bacteria | 30518 |
| 345 | Ga0495650_0012749 | 3300046471 | Bacteria | 4501 |
| 346 | Ga0495580_0000466 | 3300046472 | Bacteria | 33634 |
| 347 | Ga0495605_0007541 | 3300046474 | Bacteria | 6168 |
| 348 | Ga0495605_0034178 | 3300046474 | Bacteria | 2575 |
| 349 | Ga0495584_0068326 | 3300046491 | Bacteria | 1785 |
| 350 | Ga0495585_0035350 | 3300046492 | Bacteria | 2824 |
| 351 | Ga0495596_0000103 | 3300046500 | Bacteria | 60746 |
| 352 | Ga0495607_0003627 | 3300046501 | Bacteria | 11724 |
| 353 | Ga0495606_0006542 | 3300046507 | Bacteria | 10716 |
| 354 | Ga0495608_0119934 | 3300046511 | Bacteria | 1687 |
| 355 | Ga0495610_0006384 | 3300046512 | Bacteria | 8132 |
| 356 | Ga0495610_0009726 | 3300046512 | Bacteria | 6046 |
| 357 | Ga0495610_0031804 | 3300046512 | Bacteria | 2749 |
| 358 | Ga0495616_0015454 | 3300046513 | Bacteria | 4246 |
| 359 | Ga0495616_0109498 | 3300046513 | Bacteria | 1284 |
| 360 | Ga0495620_0006696 | 3300046515 | Bacteria | 6311 |
| 361 | Ga0495632_0002493 | 3300046519 | Bacteria | 13971 |
| 362 | Ga0495632_0011723 | 3300046519 | Bacteria | 5103 |
| 363 | Ga0495632_0106674 | 3300046519 | Bacteria | 1317 |
| 364 | Ga0495637_0000467 | 3300046520 | Bacteria | 29562 |
| 365 | Ga0495637_0026547 | 3300046520 | Bacteria | 2597 |
| 366 | Ga0495637_0047797 | 3300046520 | Bacteria | 1805 |
| 367 | Ga0495643_0002438 | 3300046522 | Bacteria | 14759 |
| 368 | Ga0495643_0021097 | 3300046522 | Bacteria | 3743 |
| 369 | Ga0495643_0029858 | 3300046522 | Bacteria | 3048 |
| 370 | Ga0495644_0002086 | 3300046523 | Bacteria | 8051 |
| 371 | Ga0495644_0021105 | 3300046523 | Bacteria | 2484 |
| 372 | Ga0495648_0026436 | 3300046524 | Bacteria | 3907 |
| 373 | Ga0495648_0045723 | 3300046524 | Bacteria | 2720 |
| 374 | Ga0495654_0002758 | 3300046530 | Bacteria | 11067 |
| 375 | Ga0495654_0064396 | 3300046530 | Bacteria | 1752 |
| 376 | Ga0495597_0002575 | 3300046542 | Bacteria | 11330 |
| 377 | Ga0495597_0072603 | 3300046542 | Bacteria | 1480 |
| 378 | Ga0495668_0000610 | 3300046616 | Bacteria | 43140 |
| 379 | Ga0495625_0018910 | 3300046660 | Bacteria | 5362 |
| 380 | Ga0495661_0013071 | 3300046665 | Bacteria | 5585 |
| 381 | Ga0495661_0045175 | 3300046665 | Bacteria | 2695 |
| 382 | Ga0495599_0000339 | 3300046678 | Bacteria | 27900 |
| 383 | Ga0495623_0006086 | 3300046679 | Bacteria | 7849 |
| 384 | Ga0495623_0032584 | 3300046679 | Bacteria | 3349 |
| 385 | Ga0495623_0075626 | 3300046679 | Bacteria | 2091 |
| 386 | Ga0495670_0162524 | 3300046691 | Bacteria | 1173 |
| 387 | Ga0495671_0022237 | 3300046692 | Bacteria | 3323 |
| 388 | Ga0495671_0119081 | 3300046692 | Bacteria | 1288 |
| 389 | Ga0495649_0017371 | 3300046694 | Bacteria | 4059 |
| 390 | Ga0495589_0006215 | 3300046794 | Bacteria | 6307 |
| 391 | Ga0495660_0016542 | 3300046810 | Bacteria | 4252 |
| 392 | Ga0495660_0078837 | 3300046810 | Bacteria | 1730 |
| 393 | Ga0495660_0129005 | 3300046810 | Bacteria | 1270 |
| 394 | Ga0495604_0017565 | 3300047317 | Bacteria | 5728 |
| 395 | Ga0495604_0032772 | 3300047317 | Bacteria | 4116 |
| 396 | Ga0495604_0035994 | 3300047317 | Bacteria | 3905 |
| 397 | Ga0495672_0008145 | 3300047320 | Bacteria | 7782 |
| 398 | Ga0495672_0130979 | 3300047320 | Bacteria | 1319 |
| 399 | Ga0495683_0004060 | 3300047323 | Bacteria | 8390 |
| 400 | Ga0495683_0026253 | 3300047323 | Bacteria | 2980 |
| 401 | Ga0495673_0044582 | 3300047469 | Bacteria | 1977 |
| 402 | Ga0495681_0019780 | 3300047470 | Bacteria | 3666 |
| 403 | Ga0495681_0027952 | 3300047470 | Bacteria | 2910 |
| 404 | Ga0495686_0081504 | 3300047472 | Bacteria | 1976 |
| 405 | Ga0495602_0044914 | 3300048088 | Bacteria | 4003 |
| 406 | Ga0495626_0000803 | 3300048091 | Bacteria | 28383 |
| 407 | Ga0496100_0063446 | 3300048903 | Bacteria | 2441 |
| 408 | Ga0496100_0091619 | 3300048903 | Bacteria | 2075 |
| 409 | Ga0496100_0234821 | 3300048903 | Bacteria | 1351 |
| 410 | Ga0496101_0004403 | 3300048904 | Bacteria | 8854 |
| 411 | Ga0496101_0006175 | 3300048904 | Bacteria | 7700 |
| 412 | Ga0496102_0000149 | 3300048905 | Bacteria | 95638 |
| 413 | Ga0496102_0000178 | 3300048905 | Bacteria | 86174 |
| 414 | Ga0496102_0017774 | 3300048905 | Bacteria | 6234 |
| 415 | Ga0496102_0238128 | 3300048905 | Bacteria | 1716 |
| 416 | Ga0496103_0000049 | 3300048906 | Bacteria | 154466 |
| 417 | Ga0496103_0000119 | 3300048906 | Bacteria | 86194 |
| 418 | Ga0496103_0009374 | 3300048906 | Bacteria | 5798 |
| 419 | Ga0496103_0020412 | 3300048906 | Bacteria | 3979 |
| 420 | Ga0496103_0053753 | 3300048906 | Bacteria | 2496 |
| 421 | Ga0496103_0121596 | 3300048906 | Bacteria | 1663 |
| 422 | Ga0496104_0000165 | 3300048907 | Bacteria | 58816 |
| 423 | Ga0496104_0005808 | 3300048907 | Bacteria | 10806 |
| 424 | Ga0496104_0103714 | 3300048907 | Bacteria | 2724 |
| 425 | Ga0496105_0000193 | 3300048908 | Bacteria | 40676 |
| 426 | Ga0496105_0000384 | 3300048908 | Bacteria | 29011 |
| 427 | Ga0496105_0196696 | 3300048908 | Bacteria | 1647 |
| 428 | Ga0496106_0005649 | 3300048909 | Bacteria | 9255 |
| 429 | Ga0496106_0291584 | 3300048909 | Bacteria | 1308 |
| 430 | Ga0496107_0005680 | 3300048910 | Bacteria | 8533 |
| 431 | Ga0496107_0025742 | 3300048910 | Bacteria | 4167 |
| 432 | Ga0496108_0007112 | 3300048911 | Bacteria | 9066 |
| 433 | Ga0496108_0023884 | 3300048911 | Bacteria | 5032 |
| 434 | Ga0496108_0237754 | 3300048911 | Bacteria | 1584 |
| 435 | Ga0496109_0128962 | 3300048912 | Bacteria | 2360 |
| 436 | Ga0496109_0508989 | 3300048912 | Bacteria | 1136 |
| 437 | Ga0496109_0584802 | 3300048912 | Bacteria | 1052 |
| 438 | Ga0496110_0003920 | 3300048913 | Bacteria | 11449 |
| 439 | Ga0496110_0005735 | 3300048913 | Bacteria | 9754 |
| 440 | Ga0496110_0006512 | 3300048913 | Bacteria | 9264 |
| 441 | Ga0496110_0117251 | 3300048913 | Bacteria | 2397 |
| 442 | Ga0496111_0088124 | 3300048914 | Bacteria | 2272 |
| 443 | Ga0496112_0018100 | 3300048915 | Bacteria | 6629 |
| 444 | Ga0496112_0092432 | 3300048915 | Bacteria | 2995 |
| 445 | Ga0496112_0203638 | 3300048915 | Bacteria | 1937 |
| 446 | Ga0496112_0524401 | 3300048915 | Bacteria | 1119 |
| 447 | Ga0496112_0620366 | 3300048915 | Bacteria | 1012 |
| 448 | Ga0496113_0002690 | 3300048916 | Bacteria | 10426 |
| 449 | Ga0496113_0008095 | 3300048916 | Bacteria | 6825 |
| 450 | Ga0496113_0030410 | 3300048916 | Bacteria | 3909 |
| 451 | Ga0496113_0038501 | 3300048916 | Bacteria | 3516 |
| 452 | Ga0496114_0002414 | 3300048917 | Bacteria | 14245 |
| 453 | Ga0496114_0022512 | 3300048917 | Bacteria | 5136 |
| 454 | Ga0496115_0000253 | 3300048918 | Bacteria | 47511 |
| 455 | Ga0496115_0164396 | 3300048918 | Bacteria | 1835 |
| 456 | Ga0496115_0354721 | 3300048918 | Bacteria | 1196 |
| 457 | Ga0496116_0000078 | 3300048919 | Bacteria | 227712 |
| 458 | Ga0496116_0088573 | 3300048919 | Bacteria | 1891 |
| 459 | Ga0496117_0000123 | 3300048920 | Bacteria | 169805 |
| 460 | Ga0496117_0000318 | 3300048920 | Bacteria | 84351 |
| 461 | Ga0496117_0007958 | 3300048920 | Bacteria | 10181 |
| 462 | Ga0496117_0011681 | 3300048920 | Bacteria | 7839 |
| 463 | Ga0496118_0000186 | 3300048921 | Bacteria | 108940 |
| 464 | Ga0496118_0044037 | 3300048921 | Bacteria | 3499 |
| 465 | Ga0496118_0149063 | 3300048921 | Bacteria | 1467 |
| 466 | Ga0496118_0169669 | 3300048921 | Bacteria | 1335 |
| 467 | Ga0496118_0292132 | 3300048921 | Bacteria | 900 |
| 468 | Ga0496119_0000121 | 3300048922 | Bacteria | 109164 |
| 469 | Ga0496119_0005200 | 3300048922 | Bacteria | 12574 |
| 470 | Ga0496120_0002006 | 3300048923 | Bacteria | 22142 |
| 471 | Ga0496120_0017810 | 3300048923 | Bacteria | 4592 |
| 472 | Ga0496121_0001102 | 3300048924 | Bacteria | 47573 |
| 473 | Ga0496121_0001167 | 3300048924 | Bacteria | 46089 |
| 474 | Ga0496121_0005678 | 3300048924 | Bacteria | 15872 |
| 475 | Ga0496121_0016348 | 3300048924 | Bacteria | 7667 |
| 476 | Ga0496121_0130569 | 3300048924 | Bacteria | 1881 |
| 477 | Ga0496122_0001958 | 3300048925 | Bacteria | 30842 |
| 478 | Ga0496122_0007455 | 3300048925 | Bacteria | 12146 |
| 479 | Ga0496122_0009975 | 3300048925 | Bacteria | 9888 |
| 480 | Ga0496122_0016402 | 3300048925 | Bacteria | 7008 |
| 481 | Ga0496122_0019308 | 3300048925 | Bacteria | 6233 |
| 482 | Ga0496122_0118831 | 3300048925 | Bacteria | 1711 |
| 483 | Ga0496123_0001507 | 3300048926 | Bacteria | 32271 |
| 484 | Ga0496123_0001522 | 3300048926 | Bacteria | 32045 |
| 485 | Ga0496123_0024635 | 3300048926 | Bacteria | 4567 |
| 486 | Ga0496123_0055708 | 3300048926 | Bacteria | 2591 |
| 487 | Ga0496124_0000127 | 3300048927 | Bacteria | 158376 |
| 488 | Ga0496124_0000324 | 3300048927 | Bacteria | 88327 |
| 489 | Ga0496124_0005269 | 3300048927 | Bacteria | 14634 |
| 490 | Ga0496124_0005490 | 3300048927 | Bacteria | 14232 |
| 491 | Ga0496124_0015055 | 3300048927 | Bacteria | 7438 |
| 492 | Ga0496124_0016818 | 3300048927 | Bacteria | 6933 |
| 493 | Ga0496124_0037494 | 3300048927 | Bacteria | 4215 |
| 494 | Ga0496124_0157577 | 3300048927 | Bacteria | 1774 |
| 495 | Ga0496125_0001272 | 3300048928 | Bacteria | 37495 |
| 496 | Ga0496125_0011326 | 3300048928 | Bacteria | 8932 |
| 497 | Ga0496125_0020549 | 3300048928 | Bacteria | 6195 |
| 498 | Ga0496125_0043555 | 3300048928 | Bacteria | 3806 |
| 499 | Ga0496125_0080593 | 3300048928 | Bacteria | 2490 |
| 500 | Ga0496125_0144020 | 3300048928 | Bacteria | 1651 |
| 501 | Ga0496125_0215726 | 3300048928 | Bacteria | 1241 |
| 502 | Ga0496126_0000045 | 3300048929 | Bacteria | 331225 |
| 503 | Ga0496126_0000058 | 3300048929 | Bacteria | 272530 |
| 504 | Ga0496126_0001180 | 3300048929 | Bacteria | 42930 |
| 505 | Ga0496126_0003207 | 3300048929 | Bacteria | 20981 |
| 506 | Ga0496126_0013335 | 3300048929 | Bacteria | 8368 |
| 507 | Ga0496126_0173928 | 3300048929 | Bacteria | 1833 |
| 508 | Ga0496126_0297256 | 3300048929 | Bacteria | 1333 |
| 509 | Ga0496126_0319861 | 3300048929 | Bacteria | 1276 |
| 510 | Ga0496126_0380018 | 3300048929 | Bacteria | 1150 |
| 511 | Ga0495678_001781 | 3300049459 | Bacteria | 15921 |
| 512 | Ga0495682_0000947 | 3300049460 | Bacteria | 17562 |
| 513 | Ga0501290_000098 | 3300049513 | Bacteria | 12826 |
| 514 | Ga0501292_000006 | 3300049515 | Bacteria | 90286 |
| 515 | Ga0501294_000382 | 3300049517 | Bacteria | 5395 |
| 516 | Ga0501302_001651 | 3300049525 | Bacteria | 1236 |
| 517 | Ga0501314_000143 | 3300049530 | Bacteria | 3555 |
| 518 | Ga0501031_0100514 | 3300049568 | Bacteria | 1887 |
| 519 | Ga0501032_0010074 | 3300049569 | Bacteria | 6823 |
| 520 | Ga0501032_0145147 | 3300049569 | Bacteria | 1562 |
| 521 | Ga0501033_0001353 | 3300049570 | Bacteria | 21844 |
| 522 | Ga0501033_0003694 | 3300049570 | Bacteria | 12445 |
| 523 | Ga0501033_0172491 | 3300049570 | Bacteria | 1553 |
| 524 | Ga0501034_0002426 | 3300049571 | Bacteria | 22542 |
| 525 | Ga0501034_0002846 | 3300049571 | Bacteria | 20161 |
| 526 | Ga0501034_0005350 | 3300049571 | Bacteria | 14056 |
| 527 | Ga0501034_0031029 | 3300049571 | Bacteria | 5431 |
| 528 | Ga0501036_0006504 | 3300049572 | Bacteria | 9495 |
| 529 | Ga0501037_0008952 | 3300049573 | Bacteria | 7335 |
| 530 | Ga0501037_0222651 | 3300049573 | Bacteria | 1327 |
| 531 | Ga0501038_0010873 | 3300049574 | Bacteria | 8313 |
| 532 | Ga0501039_0020608 | 3300049575 | Bacteria | 5053 |
| 533 | Ga0501039_0058072 | 3300049575 | Bacteria | 2996 |
| 534 | Ga0501043_0006030 | 3300049579 | Bacteria | 9737 |
| 535 | Ga0501046_0091470 | 3300049580 | Bacteria | 2340 |
| 536 | Ga0501047_0000220 | 3300049581 | Bacteria | 68612 |
| 537 | Ga0501047_0183002 | 3300049581 | Bacteria | 1961 |
| 538 | Ga0501048_0461374 | 3300049582 | Bacteria | 910 |
| 539 | Ga0501202_003721 | 3300049652 | Bacteria | 2628 |
| 540 | Ga0501206_000800 | 3300049653 | Bacteria | 3850 |
| 541 | Ga0501222_001077 | 3300049662 | Bacteria | 3871 |
| 542 | Ga0501223_000006 | 3300049663 | Bacteria | 133378 |
| 543 | Ga0501223_000023 | 3300049663 | Bacteria | 64396 |
| 544 | Ga0501223_005080 | 3300049663 | Bacteria | 2782 |
| 545 | Ga0501224_000001 | 3300049664 | Bacteria | 308131 |
| 546 | Ga0501227_003797 | 3300049665 | Bacteria | 3266 |
| 547 | Ga0501233_000014 | 3300049668 | Bacteria | 27843 |
| 548 | Ga0501235_001084 | 3300049669 | Bacteria | 5687 |
| 549 | Ga0501246_000076 | 3300049676 | Bacteria | 5467 |
| 550 | Ga0501261_000041 | 3300049690 | Bacteria | 25813 |
| 551 | Ga0501221_025040 | 3300049704 | Bacteria | 1202 |
| 552 | Ga0501221_025690 | 3300049704 | Bacteria | 1192 |
| 553 | Ga0501225_0000005 | 3300049705 | Bacteria | 133194 |
| 554 | Ga0501225_0000477 | 3300049705 | Bacteria | 12480 |
| 555 | Ga0501225_0001290 | 3300049705 | Bacteria | 7767 |
| 556 | Ga0501225_0010780 | 3300049705 | Bacteria | 2582 |
| 557 | Ga0501225_0059975 | 3300049705 | Bacteria | 1069 |
| 558 | Ga0501234_000791 | 3300049707 | Bacteria | 4946 |
| 559 | Ga0501245_012906 | 3300049708 | Bacteria | 1230 |
| 560 | Ga0501279_000006 | 3300049775 | Bacteria | 152264 |
| 561 | Ga0501280_000017 | 3300049776 | Bacteria | 54657 |
| 562 | Ga0501281_00003 | 3300049777 | Bacteria | 40318 |
| 563 | Ga0501282_002037 | 3300049778 | Bacteria | 2224 |
| 564 | Ga0501283_001213 | 3300049779 | Bacteria | 3403 |
| 565 | Ga0501035_0000815 | 3300049822 | Bacteria | 33266 |
| 566 | Ga0501044_0003728 | 3300049823 | Bacteria | 17117 |
| 567 | Ga0501044_0010440 | 3300049823 | Bacteria | 10080 |
| 568 | Ga0501226_000050 | 3300049853 | Bacteria | 51521 |
| 569 | nmdc:mga03n38_285869_c1 | 3300050490 | Bacteria | 882 |
| 570 | nmdc:mga05p37_381154_c1 | 3300050507 | Bacteria | 1652 |
| 571 | nmdc:mga09592_187731_c1 | 3300050508 | Bacteria | 1789 |
| 572 | nmdc:mga08y16_89194_c1 | 3300050511 | Bacteria | 3214 |
| 573 | nmdc:mga08x19_23046_c1 | 3300050514 | Bacteria | 3861 |
| 574 | Ga0500595_029382 | 3300053119 | Bacteria | 1865 |
| 575 | Ga0500618_003298 | 3300053125 | Bacteria | 5600 |
| 576 | Ga0500658_0006472 | 3300053134 | Bacteria | 4345 |
| 577 | Ga0500564_044426 | 3300053138 | Bacteria | 2041 |
| 578 | Ga0500568_0002823 | 3300053139 | Bacteria | 10032 |
| 579 | Ga0500573_0000027 | 3300053140 | Bacteria | 143529 |
| 580 | 2511334187 | 2511231017 | Bacteria | 6503007 |
| 581 | 2515494364 | 2515154088 | Bacteria | 5526283 |
| 582 | 2515757451 | 2515154137 | Bacteria | 5711575 |
| 583 | 2516088930 | 2515154203 | Bacteria | 5458536 |
| 584 | 2643727930 | 2643221541 | Bacteria | 5498788 |
| 585 | 2643832291 | 2643221563 | Bacteria | 4726935 |
| 586 | 2644043120 | 2643221606 | Bacteria | 5588032 |
| 587 | 2644053914 | 2643221608 | Bacteria | 4724829 |
| 588 | 2644395449 | 2643221671 | Bacteria | 5496681 |
| 589 | 2739306785 | 2738543024 | Bacteria | 5603683 |
| 590 | 2753265790 | 2751185782 | Bacteria | 11227053 |
| 591 | 2882806939 | 2882806704 | Bacteria | 3007728 |
| 592 | 2895885796 | 2895880812 | Bacteria | 11255272 |
| 593 | 8002286006 | 8002285264 | Bacteria | 6717907 |
| 594 | 8057104829 | 8057101203 | Bacteria | 5034064 |
| 595 | Ga0495638_0003369 | |||
| 596 | SwRhRL2b_contig_2149026 | |||
| 597 | SwRhRL2b_contig_2334788 | |||
| 598 | JGI24752J21851_1005971 | |||
| 599 | JGI24740J21852_10009422 | |||
| 600 | JGI24737J22298_10008340 | |||
| 601 | JGI24735J21928_10008586 | |||
| 602 | JGI24748J21848_1002846 | |||
| 603 | JGI24749J21850_1000150 | |||
| 604 | JGI24034J26672_10000934 | |||
| 605 | JGI24034J26672_10002693 | |||
| 606 | JGI24034J26672_10006054 | |||
| 607 | JGI24751J29686_10000002 | |||
| 608 | JGI24751J29686_10021053 | |||
| 609 | Ga0055536_1000120 | |||
| 610 | Ga0065714_10005046 | |||
| 611 | Ga0065704_10000342 | |||
| 612 | Ga0065704_10002516 | |||
| 613 | Ga0065704_10070166 | |||
| 614 | Ga0065704_10072848 | |||
| 615 | Ga0065707_10081815 | |||
| 616 | Ga0065707_10082422 | |||
| 617 | Ga0065707_10095831 | |||
| 618 | Ga0070658_10000304 | |||
| 619 | Ga0070658_10008332 | |||
| 620 | Ga0070683_100262035 | |||
| 621 | Ga0070670_100000012 | |||
| 622 | Ga0070670_100000026 | |||
| 623 | Ga0070670_100005694 | |||
| 624 | Ga0070670_100028959 | |||
| 625 | Ga0070670_100086870 | |||
| 626 | Ga0070677_10054674 | |||
| 627 | Ga0070666_10017345 | |||
| 628 | Ga0070680_100279011 | |||
| 629 | Ga0070661_100009928 | |||
| 630 | Ga0070668_100000642 | |||
| 631 | Ga0070668_100001679 | |||
| 632 | Ga0070668_100021926 | |||
| 633 | Ga0070668_100033923 | |||
| 634 | Ga0070668_100164416 | |||
| 635 | Ga0070669_100000064 | |||
| 636 | Ga0070669_100000077 | |||
| 637 | Ga0070669_100000199 | |||
| 638 | Ga0070669_100001050 | |||
| 639 | Ga0070669_100002158 | |||
| 640 | Ga0070669_100006689 | |||
| 641 | Ga0070669_100013893 | |||
| 642 | Ga0070671_100000077 | |||
| 643 | Ga0070671_100000863 | |||
| 644 | Ga0070671_100001302 | |||
| 645 | Ga0070671_100003136 | |||
| 646 | Ga0070671_100023407 | |||
| 647 | Ga0070688_100277321 | |||
| 648 | Ga0070659_100023370 | |||
| 649 | Ga0070667_100000002 | |||
| 650 | Ga0070667_100000828 | |||
| 651 | Ga0070667_100001698 | |||
| 652 | Ga0070667_100002772 | |||
| 653 | Ga0070667_100015584 | |||
| 654 | Ga0070667_100036976 | |||
| 655 | Ga0070709_10199934 | |||
| 656 | Ga0070713_100003202 | |||
| 657 | Ga0070713_100085797 | |||
| 658 | Ga0070710_10008731 | |||
| 659 | Ga0070710_10052968 | |||
| 660 | Ga0070711_100006415 | |||
| 661 | Ga0070705_100124955 | |||
| 662 | Ga0070663_100007527 | |||
| 663 | Ga0070678_100059574 | |||
| 664 | Ga0070662_100044811 | |||
| 665 | Ga0068867_100040064 | |||
| 666 | Ga0070685_10000009 | |||
| 667 | Ga0070685_10008897 | |||
| 668 | Ga0070684_100137999 | |||
| 669 | Ga0070672_100071928 | |||
| 670 | Ga0070665_100000163 | |||
| 671 | Ga0070665_100013238 | |||
| 672 | Ga0070665_100026151 | |||
| 673 | Ga0070665_100107348 | |||
| 674 | Ga0070665_100153609 | |||
| 675 | Ga0070665_100200590 | |||
| 676 | Ga0068855_100003651 | |||
| 677 | Ga0068855_100020494 | |||
| 678 | Ga0068855_100111522 | |||
| 679 | Ga0068857_100584268 | |||
| 680 | Ga0068854_100000322 | |||
| 681 | Ga0068854_100434966 | |||
| 682 | Ga0068852_100000357 | |||
| 683 | Ga0068852_100005824 | |||
| 684 | Ga0068859_100022203 | |||
| 685 | Ga0068859_100121149 | |||
| 686 | Ga0068859_100145896 | |||
| 687 | Ga0068859_100164400 | |||
| 688 | Ga0068864_100000002 | |||
| 689 | Ga0068864_100000010 | |||
| 690 | Ga0068864_100365999 | |||
| 691 | Ga0068861_100006004 | |||
| 692 | Ga0068861_100015123 | |||
| 693 | Ga0068861_100274352 | |||
| 694 | Ga0068851_10027096 | |||
| 695 | Ga0068863_100054520 | |||
| 696 | Ga0068863_100197837 | |||
| 697 | Ga0068863_100272119 | |||
| 698 | Ga0068858_100052357 | |||
| 699 | Ga0068858_100070810 | |||
| 700 | Ga0068858_100118826 | |||
| 701 | Ga0068860_100000450 | |||
| 702 | Ga0068860_100000474 | |||
| 703 | Ga0068860_100001423 | |||
| 704 | Ga0068860_100021734 | |||
| 705 | Ga0068860_100086783 | |||
| 706 | Ga0068860_100232945 | |||
| 707 | Ga0068862_100000016 | |||
| 708 | Ga0068862_100000105 | |||
| 709 | Ga0068862_100011447 | |||
| 710 | Ga0068862_100061327 | |||
| 711 | Ga0068862_100080104 | |||
| 712 | Ga0070717_10165463 | |||
| 713 | Ga0070717_10244363 | |||
| 714 | Ga0075432_10006547 | |||
| 715 | Ga0075432_10035849 | |||
| 716 | Ga0070715_10000618 | |||
| 717 | Ga0070716_100005358 | |||
| 718 | Ga0070712_100002095 | |||
| 719 | Ga0097621_100016928 | |||
| 720 | Ga0075436_100087011 | |||
| 721 | Ga0097620_100022203 | |||
| 722 | Ga0097620_100121150 | |||
| 723 | Ga0097620_100145893 | |||
| 724 | Ga0097620_100164402 | |||
| 725 | Ga0105251_10001177 | |||
| 726 | Ga0105251_10025901 | |||
| 727 | Ga0105250_10000186 | |||
| 728 | Ga0105250_10004727 | |||
| 729 | Ga0105240_10008858 | |||
| 730 | Ga0105245_10013559 | |||
| 731 | Ga0105247_10051785 | |||
| 732 | Ga0114129_10075734 | |||
| 733 | Ga0114129_10467360 | |||
| 734 | Ga0114129_10712933 | |||
| 735 | Ga0105242_10036936 | |||
| 736 | Ga0105248_10003755 | |||
| 737 | Ga0105248_10007376 | |||
| 738 | Ga0105248_10029610 | |||
| 739 | Ga0105248_10051605 | |||
| 740 | Ga0105248_10079599 | |||
| 741 | Ga0105248_10132984 | |||
| 742 | Ga0105248_10418436 | |||
| 743 | Ga0105237_10224366 | |||
| 744 | Ga0105238_10004267 | |||
| 745 | Ga0105249_10000004 | |||
| 746 | Ga0105249_10030205 | |||
| 747 | Ga0105249_10047668 | |||
| 748 | Ga0105249_10095271 | |||
| 749 | Ga0105148_100366 | |||
| 750 | Ga0157373_10118934 | |||
| 751 | Ga0157369_10068106 | |||
| 752 | Ga0157378_10098766 | |||
| 753 | Ga0163162_10043682 | |||
| 754 | Ga0163162_10196113 | |||
| 755 | Ga0157372_10032844 | |||
| 756 | Ga0157375_10060892 | |||
| 757 | Ga0163163_10000081 | |||
| 758 | Ga0163163_10131859 | |||
| 759 | Ga0163163_10320707 | |||
| 760 | Ga0157380_10000025 | |||
| 761 | Ga0157380_10001518 | |||
| 762 | Ga0157380_10006959 | |||
| 763 | Ga0157380_10180702 | |||
| 764 | Ga0157379_10000207 | |||
| 765 | Ga0157379_10012452 | |||
| 766 | Ga0157379_10224363 | |||
| 767 | Ga0163161_10001576 | |||
| 768 | Ga0163161_10016614 | |||
| 769 | Ga0163161_10079152 | |||
| 770 | Ga0163161_10330035 | |||
| 771 | Ga0209676_1000081 | |||
| 772 | Ga0209050_1000232 | |||
| 773 | Ga0209050_1001468 | |||
| 774 | Ga0207697_10087619 | |||
| 775 | Ga0207696_1000455 | |||
| 776 | Ga0207696_1001933 | |||
| 777 | Ga0207713_1000436 | |||
| 778 | Ga0207713_1010386 | |||
| 779 | Ga0207713_1037853 | |||
| 780 | Ga0207692_10024356 | |||
| 781 | Ga0207680_10005804 | |||
| 782 | Ga0207680_10098349 | |||
| 783 | Ga0207680_10108045 | |||
| 784 | Ga0207680_10299123 | |||
| 785 | Ga0207647_10012068 | |||
| 786 | Ga0207647_10013300 | |||
| 787 | Ga0207685_10034338 | |||
| 788 | Ga0207699_10127061 | |||
| 789 | Ga0207645_10001237 | |||
| 790 | Ga0207643_10269161 | |||
| 791 | Ga0207705_10000007 | |||
| 792 | Ga0207654_10004912 | |||
| 793 | Ga0207695_10004035 | |||
| 794 | Ga0207671_10021901 | |||
| 795 | Ga0207671_10088527 | |||
| 796 | Ga0207693_10000379 | |||
| 797 | Ga0207660_10102410 | |||
| 798 | Ga0207657_10006357 | |||
| 799 | Ga0207646_10151843 | |||
| 800 | Ga0207646_10607910 | |||
| 801 | Ga0207681_10000013 | |||
| 802 | Ga0207681_10000081 | |||
| 803 | Ga0207681_10000255 | |||
| 804 | Ga0207681_10001754 | |||
| 805 | Ga0207681_10007751 | |||
| 806 | Ga0207681_10023665 | |||
| 807 | Ga0207681_10045258 | |||
| 808 | Ga0207681_10174143 | |||
| 809 | Ga0207694_10009301 | |||
| 810 | Ga0207694_10019117 | |||
| 811 | Ga0207650_10000002 | |||
| 812 | Ga0207650_10000008 | |||
| 813 | Ga0207650_10030450 | |||
| 814 | Ga0207664_10047178 | |||
| 815 | Ga0207644_10000004 | |||
| 816 | Ga0207644_10000020 | |||
| 817 | Ga0207644_10001897 | |||
| 818 | Ga0207644_10005491 | |||
| 819 | Ga0207644_10016838 | |||
| 820 | Ga0207644_10254375 | |||
| 821 | Ga0207706_10008905 | |||
| 822 | Ga0207706_10060741 | |||
| 823 | Ga0207686_10059971 | |||
| 824 | Ga0207670_10214601 | |||
| 825 | Ga0207704_10018191 | |||
| 826 | Ga0207665_10002705 | |||
| 827 | Ga0207691_10001275 | |||
| 828 | Ga0207711_10001343 | |||
| 829 | Ga0207711_10001838 | |||
| 830 | Ga0207711_10001851 | |||
| 831 | Ga0207711_10031863 | |||
| 832 | Ga0207711_10096446 | |||
| 833 | Ga0207711_10246433 | |||
| 834 | Ga0207667_10004045 | |||
| 835 | Ga0207667_10008291 | |||
| 836 | Ga0207667_10018025 | |||
| 837 | Ga0207712_10000008 | |||
| 838 | Ga0207712_10067845 | |||
| 839 | Ga0207712_10077736 | |||
| 840 | Ga0207712_10148305 | |||
| 841 | Ga0207712_10256033 | |||
| 842 | Ga0207668_10003751 | |||
| 843 | Ga0207668_10004561 | |||
| 844 | Ga0207668_10005445 | |||
| 845 | Ga0207668_10060017 | |||
| 846 | Ga0207668_10310800 | |||
| 847 | Ga0207640_10000279 | |||
| 848 | Ga0207640_10016415 | |||
| 849 | Ga0207640_10292998 | |||
| 850 | Ga0207658_10000001 | |||
| 851 | Ga0207658_10001301 | |||
| 852 | Ga0207658_10003517 | |||
| 853 | Ga0207658_10007936 | |||
| 854 | Ga0207658_10015482 | |||
| 855 | Ga0207658_10066958 | |||
| 856 | Ga0207703_10010844 | |||
| 857 | Ga0207703_10012379 | |||
| 858 | Ga0207703_10083095 | |||
| 859 | Ga0207678_10016055 | |||
| 860 | Ga0207641_10005772 | |||
| 861 | Ga0207641_10043161 | |||
| 862 | Ga0207641_10050239 | |||
| 863 | Ga0207641_10295210 | |||
| 864 | Ga0207648_10006902 | |||
| 865 | Ga0207676_10000001 | |||
| 866 | Ga0207676_10000012 | |||
| 867 | Ga0207674_10004418 | |||
| 868 | Ga0207674_10152143 | |||
| 869 | Ga0207675_100000057 | |||
| 870 | Ga0207675_100007183 | |||
| 871 | Ga0207675_100014762 | |||
| 872 | Ga0207683_10000798 | |||
| 873 | Ga0207683_10763074 | |||
| 874 | Ga0207698_10000919 | |||
| 875 | Ga0207698_10003339 | |||
| 876 | Ga0207698_10213872 | |||
| 877 | Ga0209971_1001080 | |||
| 878 | Ga0209966_1022150 | |||
| 879 | Ga0209998_10009053 | |||
| 880 | Ga0209974_10009783 | |||
| 881 | Ga0209974_10029862 | |||
| 882 | Ga0207428_10003679 | |||
| 883 | Ga0207428_10076296 | |||
| 884 | Ga0207428_10171339 | |||
| 885 | Ga0268266_10000205 | |||
| 886 | Ga0268266_10000945 | |||
| 887 | Ga0268266_10008275 | |||
| 888 | Ga0268266_10011566 | |||
| 889 | Ga0268266_10122578 | |||
| 890 | Ga0268266_10125830 | |||
| 891 | Ga0268266_10130268 | |||
| 892 | Ga0268266_10155668 | |||
| 893 | Ga0268266_10257209 | |||
| 894 | Ga0268265_10000006 | |||
| 895 | Ga0268265_10000216 | |||
| 896 | Ga0268265_10004038 | |||
| 897 | Ga0268265_10013639 | |||
| 898 | Ga0268265_10014446 | |||
| 899 | Ga0268265_10022817 | |||
| 900 | Ga0268264_10000004 | |||
| 901 | Ga0268264_10001169 | |||
| 902 | Ga0268264_10004485 | |||
| 903 | Ga0268264_10022075 | |||
| 904 | Ga0268264_10035438 | |||
| 905 | Ga0268264_10043053 | |||
| 906 | Ga0307517_10190725 | |||
| 907 | Ga0307515_10000192 | |||
| 908 | Ga0307515_10078846 | |||
| 909 | Ga0307512_10015238 | |||
| 910 | Ga0265331_10007423 | |||
| 911 | Ga0265327_10000229 | |||
| 912 | Ga0307509_10022794 | |||
| 913 | Ga0307516_10046421 | |||
| 914 | Ga0307405_10000504 | |||
| 915 | Ga0307406_10316255 | |||
| 916 | Ga0307412_10040364 | |||
| 917 | Ga0307414_10006131 | |||
| 918 | Ga0307414_10566588 | |||
| 919 | Ga0373934_0083460 | |||
| 920 | Ga0373935_0057225 | |||
| 921 | Ga0373933_0062920 | |||
| 922 | Ga0373933_0068470 | |||
| 923 | Ga0373937_0033412 | |||
| 924 | Ga0373937_0078930 | |||
| 925 | Ga0439438_001613 | |||
| 926 | Ga0439466_0007737 | |||
| 927 | Ga0450902_000064 | |||
| 928 | Ga0450903_000363 | |||
| 929 | Ga0451576_0236858 | |||
| 930 | Ga0466967_0009262 | |||
| 931 | Ga0495627_005890 | |||
| 932 | Ga0495590_0008769 | |||
| 933 | Ga0495638_0001649 | |||
| 934 | Ga0495638_0023345 | |||
| 935 | Ga0495638_0039020 | |||
| 936 | Ga0495651_0031298 | |||
| 937 | Ga0495653_0328959 | |||
| 938 | Ga0495650_0001059 | |||
| 939 | Ga0495650_0012749 | |||
| 940 | Ga0495580_0000466 | |||
| 941 | Ga0495605_0007541 | |||
| 942 | Ga0495605_0034178 | |||
| 943 | Ga0495584_0068326 | |||
| 944 | Ga0495585_0035350 | |||
| 945 | Ga0495596_0000103 | |||
| 946 | Ga0495607_0003627 | |||
| 947 | Ga0495606_0006542 | |||
| 948 | Ga0495608_0119934 | |||
| 949 | Ga0495610_0006384 | |||
| 950 | Ga0495610_0009726 | |||
| 951 | Ga0495610_0031804 | |||
| 952 | Ga0495616_0015454 | |||
| 953 | Ga0495616_0109498 | |||
| 954 | Ga0495620_0006696 | |||
| 955 | Ga0495632_0002493 | |||
| 956 | Ga0495632_0011723 | |||
| 957 | Ga0495632_0106674 | |||
| 958 | Ga0495637_0000467 | |||
| 959 | Ga0495637_0026547 | |||
| 960 | Ga0495637_0047797 | |||
| 961 | Ga0495643_0002438 | |||
| 962 | Ga0495643_0021097 | |||
| 963 | Ga0495643_0029858 | |||
| 964 | Ga0495644_0002086 | |||
| 965 | Ga0495644_0021105 | |||
| 966 | Ga0495648_0026436 | |||
| 967 | Ga0495648_0045723 | |||
| 968 | Ga0495654_0002758 | |||
| 969 | Ga0495654_0064396 | |||
| 970 | Ga0495597_0002575 | |||
| 971 | Ga0495597_0072603 | |||
| 972 | Ga0495668_0000610 | |||
| 973 | Ga0495625_0018910 | |||
| 974 | Ga0495661_0013071 | |||
| 975 | Ga0495661_0045175 | |||
| 976 | Ga0495599_0000339 | |||
| 977 | Ga0495623_0006086 | |||
| 978 | Ga0495623_0032584 | |||
| 979 | Ga0495623_0075626 | |||
| 980 | Ga0495670_0162524 | |||
| 981 | Ga0495671_0022237 | |||
| 982 | Ga0495671_0119081 | |||
| 983 | Ga0495649_0017371 | |||
| 984 | Ga0495589_0006215 | |||
| 985 | Ga0495660_0016542 | |||
| 986 | Ga0495660_0078837 | |||
| 987 | Ga0495660_0129005 | |||
| 988 | Ga0495604_0017565 | |||
| 989 | Ga0495604_0032772 | |||
| 990 | Ga0495604_0035994 | |||
| 991 | Ga0495672_0008145 | |||
| 992 | Ga0495672_0130979 | |||
| 993 | Ga0495683_0004060 | |||
| 994 | Ga0495683_0026253 | |||
| 995 | Ga0495673_0044582 | |||
| 996 | Ga0495681_0019780 | |||
| 997 | Ga0495681_0027952 | |||
| 998 | Ga0495686_0081504 | |||
| 999 | Ga0495602_0044914 | |||
| 1000 | Ga0495626_0000803 | |||
| 1001 | Ga0496100_0063446 | |||
| 1002 | Ga0496100_0091619 | |||
| 1003 | Ga0496100_0234821 | |||
| 1004 | Ga0496101_0004403 | |||
| 1005 | Ga0496101_0006175 | |||
| 1006 | Ga0496102_0000149 | |||
| 1007 | Ga0496102_0000178 | |||
| 1008 | Ga0496102_0017774 | |||
| 1009 | Ga0496102_0238128 | |||
| 1010 | Ga0496103_0000049 | |||
| 1011 | Ga0496103_0000119 | |||
| 1012 | Ga0496103_0009374 | |||
| 1013 | Ga0496103_0020412 | |||
| 1014 | Ga0496103_0053753 | |||
| 1015 | Ga0496103_0121596 | |||
| 1016 | Ga0496104_0000165 | |||
| 1017 | Ga0496104_0005808 | |||
| 1018 | Ga0496104_0103714 | |||
| 1019 | Ga0496105_0000193 | |||
| 1020 | Ga0496105_0000384 | |||
| 1021 | Ga0496105_0196696 | |||
| 1022 | Ga0496106_0005649 | |||
| 1023 | Ga0496106_0291584 | |||
| 1024 | Ga0496107_0005680 | |||
| 1025 | Ga0496107_0025742 | |||
| 1026 | Ga0496108_0007112 | |||
| 1027 | Ga0496108_0023884 | |||
| 1028 | Ga0496108_0237754 | |||
| 1029 | Ga0496109_0128962 | |||
| 1030 | Ga0496109_0508989 | |||
| 1031 | Ga0496109_0584802 | |||
| 1032 | Ga0496110_0003920 | |||
| 1033 | Ga0496110_0005735 | |||
| 1034 | Ga0496110_0006512 | |||
| 1035 | Ga0496110_0117251 | |||
| 1036 | Ga0496111_0088124 | |||
| 1037 | Ga0496112_0018100 | |||
| 1038 | Ga0496112_0092432 | |||
| 1039 | Ga0496112_0203638 | |||
| 1040 | Ga0496112_0524401 | |||
| 1041 | Ga0496112_0620366 | |||
| 1042 | Ga0496113_0002690 | |||
| 1043 | Ga0496113_0008095 | |||
| 1044 | Ga0496113_0030410 | |||
| 1045 | Ga0496113_0038501 | |||
| 1046 | Ga0496114_0002414 | |||
| 1047 | Ga0496114_0022512 | |||
| 1048 | Ga0496115_0000253 | |||
| 1049 | Ga0496115_0164396 | |||
| 1050 | Ga0496115_0354721 | |||
| 1051 | Ga0496116_0000078 | |||
| 1052 | Ga0496116_0088573 | |||
| 1053 | Ga0496117_0000123 | |||
| 1054 | Ga0496117_0000318 | |||
| 1055 | Ga0496117_0007958 | |||
| 1056 | Ga0496117_0011681 | |||
| 1057 | Ga0496118_0000186 | |||
| 1058 | Ga0496118_0044037 | |||
| 1059 | Ga0496118_0149063 | |||
| 1060 | Ga0496118_0169669 | |||
| 1061 | Ga0496118_0292132 | |||
| 1062 | Ga0496119_0000121 | |||
| 1063 | Ga0496119_0005200 | |||
| 1064 | Ga0496120_0002006 | |||
| 1065 | Ga0496120_0017810 | |||
| 1066 | Ga0496121_0001102 | |||
| 1067 | Ga0496121_0001167 | |||
| 1068 | Ga0496121_0005678 | |||
| 1069 | Ga0496121_0016348 | |||
| 1070 | Ga0496121_0130569 | |||
| 1071 | Ga0496122_0001958 | |||
| 1072 | Ga0496122_0007455 | |||
| 1073 | Ga0496122_0009975 | |||
| 1074 | Ga0496122_0016402 | |||
| 1075 | Ga0496122_0019308 | |||
| 1076 | Ga0496122_0118831 | |||
| 1077 | Ga0496123_0001507 | |||
| 1078 | Ga0496123_0001522 | |||
| 1079 | Ga0496123_0024635 | |||
| 1080 | Ga0496123_0055708 | |||
| 1081 | Ga0496124_0000127 | |||
| 1082 | Ga0496124_0000324 | |||
| 1083 | Ga0496124_0005269 | |||
| 1084 | Ga0496124_0005490 | |||
| 1085 | Ga0496124_0015055 | |||
| 1086 | Ga0496124_0016818 | |||
| 1087 | Ga0496124_0037494 | |||
| 1088 | Ga0496124_0157577 | |||
| 1089 | Ga0496125_0001272 | |||
| 1090 | Ga0496125_0011326 | |||
| 1091 | Ga0496125_0020549 | |||
| 1092 | Ga0496125_0043555 | |||
| 1093 | Ga0496125_0080593 | |||
| 1094 | Ga0496125_0144020 | |||
| 1095 | Ga0496125_0215726 | |||
| 1096 | Ga0496126_0000045 | |||
| 1097 | Ga0496126_0000058 | |||
| 1098 | Ga0496126_0001180 | |||
| 1099 | Ga0496126_0003207 | |||
| 1100 | Ga0496126_0013335 | |||
| 1101 | Ga0496126_0173928 | |||
| 1102 | Ga0496126_0297256 | |||
| 1103 | Ga0496126_0319861 | |||
| 1104 | Ga0496126_0380018 | |||
| 1105 | Ga0495678_001781 | |||
| 1106 | Ga0495682_0000947 | |||
| 1107 | Ga0501290_000098 | |||
| 1108 | Ga0501292_000006 | |||
| 1109 | Ga0501294_000382 | |||
| 1110 | Ga0501302_001651 | |||
| 1111 | Ga0501314_000143 | |||
| 1112 | Ga0501031_0100514 | |||
| 1113 | Ga0501032_0010074 | |||
| 1114 | Ga0501032_0145147 | |||
| 1115 | Ga0501033_0001353 | |||
| 1116 | Ga0501033_0003694 | |||
| 1117 | Ga0501033_0172491 | |||
| 1118 | Ga0501034_0002426 | |||
| 1119 | Ga0501034_0002846 | |||
| 1120 | Ga0501034_0005350 | |||
| 1121 | Ga0501034_0031029 | |||
| 1122 | Ga0501036_0006504 | |||
| 1123 | Ga0501037_0008952 | |||
| 1124 | Ga0501037_0222651 | |||
| 1125 | Ga0501038_0010873 | |||
| 1126 | Ga0501039_0020608 | |||
| 1127 | Ga0501039_0058072 | |||
| 1128 | Ga0501043_0006030 | |||
| 1129 | Ga0501046_0091470 | |||
| 1130 | Ga0501047_0000220 | |||
| 1131 | Ga0501047_0183002 | |||
| 1132 | Ga0501048_0461374 | |||
| 1133 | Ga0501202_003721 | |||
| 1134 | Ga0501206_000800 | |||
| 1135 | Ga0501222_001077 | |||
| 1136 | Ga0501223_000006 | |||
| 1137 | Ga0501223_000023 | |||
| 1138 | Ga0501223_005080 | |||
| 1139 | Ga0501224_000001 | |||
| 1140 | Ga0501227_003797 | |||
| 1141 | Ga0501233_000014 | |||
| 1142 | Ga0501235_001084 | |||
| 1143 | Ga0501246_000076 | |||
| 1144 | Ga0501261_000041 | |||
| 1145 | Ga0501221_025040 | |||
| 1146 | Ga0501221_025690 | |||
| 1147 | Ga0501225_0000005 | |||
| 1148 | Ga0501225_0000477 | |||
| 1149 | Ga0501225_0001290 | |||
| 1150 | Ga0501225_0010780 | |||
| 1151 | Ga0501225_0059975 | |||
| 1152 | Ga0501234_000791 | |||
| 1153 | Ga0501245_012906 | |||
| 1154 | Ga0501279_000006 | |||
| 1155 | Ga0501280_000017 | |||
| 1156 | Ga0501281_00003 | |||
| 1157 | Ga0501282_002037 | |||
| 1158 | Ga0501283_001213 | |||
| 1159 | Ga0501035_0000815 | |||
| 1160 | Ga0501044_0003728 | |||
| 1161 | Ga0501044_0010440 | |||
| 1162 | Ga0501226_000050 | |||
| 1163 | nmdc:mga03n38_285869_c1 | |||
| 1164 | nmdc:mga05p37_381154_c1 | |||
| 1165 | nmdc:mga09592_187731_c1 | |||
| 1166 | nmdc:mga08y16_89194_c1 | |||
| 1167 | nmdc:mga08x19_23046_c1 | |||
| 1168 | Ga0500595_029382 | |||
| 1169 | Ga0500618_003298 | |||
| 1170 | Ga0500658_0006472 | |||
| 1171 | Ga0500564_044426 | |||
| 1172 | Ga0500568_0002823 | |||
| 1173 | Ga0500573_0000027 | |||
| 1174 | 2511334187 | |||
| 1175 | 2515494364 | |||
| 1176 | 2515757451 | |||
| 1177 | 2516088930 | |||
| 1178 | 2643727930 | |||
| 1179 | 2643832291 | |||
| 1180 | 2644043120 | |||
| 1181 | 2644053914 | |||
| 1182 | 2644395449 | |||
| 1183 | 2739306785 | |||
| 1184 | 2753265790 | |||
| 1185 | 2882806939 | |||
| 1186 | 2895885796 | |||
| 1187 | 8002286006 | |||
| 1188 | 8057104829 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nbv-assembly1.cif.gz_A | crystal structure of fabg from cupriavidus taiwanensis | 0.9706 | 15 | 256 |
| 1uls-assembly1.cif.gz_C | crystal structure of tt0140 from thermus thermophilus hb8 | 0.9694 | 15 | 256 |
| 7tzp-assembly3.cif.gz_G | crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh | 0.9673 | 14 | 256 |
| 4ni5-assembly1.cif.gz_A | crystal structure of a short chain dehydrogenase from brucella suis | 0.9667 | 15 | 256 |
| 3o38-assembly1.cif.gz_B | crystal structure of a short chain dehydrogenase from mycobacterium smegmatis | 0.966 | 6 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGR9_1_247_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9694 | 13 | 256 | 3.40.50.720 |
| af_I6YCF0_1_258_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9678 | 6 | 256 | 3.40.50.720 |
| 1ulsC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9673 | 15 | 256 | 3.40.50.720 |
| 4ni5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9667 | 15 | 256 | 3.40.50.720 |
| 4cqmK00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9624 | 18 | 256 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E7HHB1-F1-model_v4 | deleted | 0.9868 | 4 | 261 |
|
| AF-A0A5C7Q9A7-F1-model_v4 | SDR family oxidoreductase | 0.9826 | 1 | 230 |
GO:0016616
GO:0030497 |
| AF-A0A4R4WYM3-F1-model_v4 | SDR family oxidoreductase | 0.9798 | 6 | 261 |
GO:0016616
GO:0030497 |
| AF-A0A4Q3D3P7-F1-model_v4 | SDR family oxidoreductase | 0.9776 | 54 | 261 |
GO:0016616
GO:0030497 |
| AF-A0A7K0M5I6-F1-model_v4 | SDR family oxidoreductase | 0.9766 | 28 | 261 |
GO:0016616
GO:0030497 |