F467363

General Info

Members Datasets Scaffolds Average Seq Length
594 292 1188 258

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0003369|Ga0495638_0003369_5243_6127
Length 294
Sequence LQHPAAAIPHFDDAPATPSPYKCSVLISSEVDAVKQAPPYVPGHQLLAGKSVLITAAAGAGIGYSAARRSAEEGCRALMISDVHARRLEEAVERLKAETGLQAIYGQVCNVTIEDEVQALVAAAEEALGGVDVLINNAGLGGQKRVMDMSDEEWLRVLDVTLTGTFRMTRAMLPHMQRRGAGAIVNNASVLGWRAQKEQAHYAAAKAGVMAFTRCSALEAAEFGVRINAVSPSIALHDFLKKASSEELLASLAGREAFGRAAEVWEVANVMMFLASDYASYMVGEVLSVSSQQA

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
153 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
154 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
155 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
229 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
230 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
231 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
232 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
246 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
247 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
248 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
249 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
250 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
253 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
254 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
255 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
258 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
259 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
260 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
261 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
262 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
263 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
273 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
278 2511231017 Pseudomonas sp. GM55 Isolate Nodule
279 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
280 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
281 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
282 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
283 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
284 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
285 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
286 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
287 2738543024 Aminobacter sp. AP02 Isolate Unclassified
288 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
289 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
290 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
291 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
292 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0.17
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0.34
Rhizoplane 8.42
Rhizosphere 78.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0003369 3300046460 Bacteria 12604
2 SwRhRL2b_contig_2149026 2162886007 Bacteria 5324
3 SwRhRL2b_contig_2334788 2162886007 Bacteria 75171
4 JGI24752J21851_1005971 3300001976 Bacteria 1591
5 JGI24740J21852_10009422 3300001979 Bacteria 3824
6 JGI24737J22298_10008340 3300001990 Bacteria 3473
7 JGI24735J21928_10008586 3300002067 Bacteria 3299
8 JGI24748J21848_1002846 3300002074 Bacteria 1970
9 JGI24749J21850_1000150 3300002076 Bacteria 11138
10 JGI24034J26672_10000934 3300002239 Bacteria 3796
11 JGI24034J26672_10002693 3300002239 Bacteria 2448
12 JGI24034J26672_10006054 3300002239 Bacteria 1743
13 JGI24751J29686_10000002 3300002459 Bacteria 160619
14 JGI24751J29686_10021053 3300002459 Bacteria 1352
15 Ga0055536_1000120 3300003781 Bacteria 68066
16 Ga0065714_10005046 3300005288 Bacteria 5440
17 Ga0065704_10000342 3300005289 Bacteria 36460
18 Ga0065704_10002516 3300005289 Bacteria 5892
19 Ga0065704_10070166 3300005289 Bacteria 176609
20 Ga0065704_10072848 3300005289 Bacteria 7929
21 Ga0065707_10081815 3300005295 Bacteria 36952
22 Ga0065707_10082422 3300005295 Bacteria 15385
23 Ga0065707_10095831 3300005295 Bacteria 3333
24 Ga0070658_10000304 3300005327 Bacteria 42569
25 Ga0070658_10008332 3300005327 Bacteria 8338
26 Ga0070683_100262035 3300005329 Bacteria 1644
27 Ga0070670_100000012 3300005331 Bacteria 256314
28 Ga0070670_100000026 3300005331 Bacteria 187946
29 Ga0070670_100005694 3300005331 Bacteria 10524
30 Ga0070670_100028959 3300005331 Bacteria 4767
31 Ga0070670_100086870 3300005331 Bacteria 2687
32 Ga0070677_10054674 3300005333 Bacteria 1627
33 Ga0070666_10017345 3300005335 Bacteria 4615
34 Ga0070680_100279011 3300005336 Bacteria 1416
35 Ga0070661_100009928 3300005344 Bacteria 6605
36 Ga0070668_100000642 3300005347 Bacteria 23581
37 Ga0070668_100001679 3300005347 Bacteria 16043
38 Ga0070668_100021926 3300005347 Bacteria 4825
39 Ga0070668_100033923 3300005347 Bacteria 3889
40 Ga0070668_100164416 3300005347 Bacteria 1803
41 Ga0070669_100000064 3300005353 Bacteria 107033
42 Ga0070669_100000077 3300005353 Bacteria 95577
43 Ga0070669_100000199 3300005353 Bacteria 52239
44 Ga0070669_100001050 3300005353 Bacteria 20195
45 Ga0070669_100002158 3300005353 Bacteria 14232
46 Ga0070669_100006689 3300005353 Bacteria 8298
47 Ga0070669_100013893 3300005353 Bacteria 5726
48 Ga0070671_100000077 3300005355 Bacteria 62532
49 Ga0070671_100000863 3300005355 Bacteria 22137
50 Ga0070671_100001302 3300005355 Bacteria 18731
51 Ga0070671_100003136 3300005355 Bacteria 12877
52 Ga0070671_100023407 3300005355 Bacteria 5055
53 Ga0070688_100277321 3300005365 Bacteria 1203
54 Ga0070659_100023370 3300005366 Bacteria 4729
55 Ga0070667_100000002 3300005367 Bacteria 504831
56 Ga0070667_100000828 3300005367 Bacteria 28754
57 Ga0070667_100001698 3300005367 Bacteria 19689
58 Ga0070667_100002772 3300005367 Bacteria 15143
59 Ga0070667_100015584 3300005367 Bacteria 6284
60 Ga0070667_100036976 3300005367 Bacteria 4093
61 Ga0070709_10199934 3300005434 Bacteria 1415
62 Ga0070713_100003202 3300005436 Bacteria 10776
63 Ga0070713_100085797 3300005436 Bacteria 2697
64 Ga0070710_10008731 3300005437 Bacteria 4942
65 Ga0070710_10052968 3300005437 Bacteria 2284
66 Ga0070711_100006415 3300005439 Bacteria 7094
67 Ga0070705_100124955 3300005440 Bacteria 1668
68 Ga0070663_100007527 3300005455 Bacteria 6633
69 Ga0070678_100059574 3300005456 Bacteria 2807
70 Ga0070662_100044811 3300005457 Bacteria 3170
71 Ga0068867_100040064 3300005459 Bacteria 3417
72 Ga0070685_10000009 3300005466 Bacteria 166260
73 Ga0070685_10008897 3300005466 Bacteria 5177
74 Ga0070684_100137999 3300005535 Bacteria 2203
75 Ga0070672_100071928 3300005543 Bacteria 2752
76 Ga0070665_100000163 3300005548 Bacteria 121320
77 Ga0070665_100013238 3300005548 Bacteria 8309
78 Ga0070665_100026151 3300005548 Bacteria 5876
79 Ga0070665_100107348 3300005548 Bacteria 2794
80 Ga0070665_100153609 3300005548 Bacteria 2304
81 Ga0070665_100200590 3300005548 Bacteria 1995
82 Ga0068855_100003651 3300005563 Bacteria 18824
83 Ga0068855_100020494 3300005563 Bacteria 7928
84 Ga0068855_100111522 3300005563 Bacteria 3140
85 Ga0068857_100584268 3300005577 Bacteria 1055
86 Ga0068854_100000322 3300005578 Bacteria 31553
87 Ga0068854_100434966 3300005578 Bacteria 1092
88 Ga0068852_100000357 3300005616 Bacteria 30774
89 Ga0068852_100005824 3300005616 Bacteria 8850
90 Ga0068859_100022203 3300005617 Bacteria 6363
91 Ga0068859_100121149 3300005617 Bacteria 2682
92 Ga0068859_100145896 3300005617 Bacteria 2441
93 Ga0068859_100164400 3300005617 Bacteria 2299
94 Ga0068864_100000002 3300005618 Bacteria 658857
95 Ga0068864_100000010 3300005618 Bacteria 358723
96 Ga0068864_100365999 3300005618 Bacteria 1363
97 Ga0068861_100006004 3300005719 Bacteria 8255
98 Ga0068861_100015123 3300005719 Bacteria 5431
99 Ga0068861_100274352 3300005719 Bacteria 1449
100 Ga0068851_10027096 3300005834 Bacteria 2822
101 Ga0068863_100054520 3300005841 Bacteria 3788
102 Ga0068863_100197837 3300005841 Bacteria 1932
103 Ga0068863_100272119 3300005841 Bacteria 1640
104 Ga0068858_100052357 3300005842 Bacteria 3777
105 Ga0068858_100070810 3300005842 Bacteria 3233
106 Ga0068858_100118826 3300005842 Bacteria 2471
107 Ga0068860_100000450 3300005843 Bacteria 52006
108 Ga0068860_100000474 3300005843 Bacteria 49979
109 Ga0068860_100001423 3300005843 Bacteria 25915
110 Ga0068860_100021734 3300005843 Bacteria 6209
111 Ga0068860_100086783 3300005843 Bacteria 2978
112 Ga0068860_100232945 3300005843 Bacteria 1790
113 Ga0068862_100000016 3300005844 Bacteria 250031
114 Ga0068862_100000105 3300005844 Bacteria 99930
115 Ga0068862_100011447 3300005844 Bacteria 7322
116 Ga0068862_100061327 3300005844 Bacteria 3232
117 Ga0068862_100080104 3300005844 Bacteria 2831
118 Ga0070717_10165463 3300006028 Bacteria 1921
119 Ga0070717_10244363 3300006028 Bacteria 1584
120 Ga0075432_10006547 3300006058 Bacteria 3965
121 Ga0075432_10035849 3300006058 Bacteria 1723
122 Ga0070715_10000618 3300006163 Bacteria 9385
123 Ga0070716_100005358 3300006173 Bacteria 6206
124 Ga0070712_100002095 3300006175 Bacteria 12257
125 Ga0097621_100016928 3300006237 Bacteria 5526
126 Ga0075436_100087011 3300006914 Bacteria 2170
127 Ga0097620_100022203 3300006931 Bacteria 6363
128 Ga0097620_100121150 3300006931 Bacteria 2682
129 Ga0097620_100145893 3300006931 Bacteria 2441
130 Ga0097620_100164402 3300006931 Bacteria 2299
131 Ga0105251_10001177 3300009011 Bacteria 22695
132 Ga0105251_10025901 3300009011 Bacteria 2992
133 Ga0105250_10000186 3300009092 Bacteria 53643
134 Ga0105250_10004727 3300009092 Bacteria 6217
135 Ga0105240_10008858 3300009093 Bacteria 14330
136 Ga0105245_10013559 3300009098 Bacteria 7100
137 Ga0105247_10051785 3300009101 Bacteria 2530
138 Ga0114129_10075734 3300009147 Bacteria 4685
139 Ga0114129_10467360 3300009147 Bacteria 1652
140 Ga0114129_10712933 3300009147 Bacteria 1288
141 Ga0105242_10036936 3300009176 Bacteria 3922
142 Ga0105248_10003755 3300009177 Bacteria 16832
143 Ga0105248_10007376 3300009177 Bacteria 12073
144 Ga0105248_10029610 3300009177 Bacteria 6108
145 Ga0105248_10051605 3300009177 Bacteria 4615
146 Ga0105248_10079599 3300009177 Bacteria 3683
147 Ga0105248_10132984 3300009177 Bacteria 2807
148 Ga0105248_10418436 3300009177 Bacteria 1509
149 Ga0105237_10224366 3300009545 Bacteria 1879
150 Ga0105238_10004267 3300009551 Bacteria 14204
151 Ga0105249_10000004 3300009553 Bacteria 368014
152 Ga0105249_10030205 3300009553 Bacteria 4897
153 Ga0105249_10047668 3300009553 Bacteria 3905
154 Ga0105249_10095271 3300009553 Bacteria 2791
155 Ga0105148_100366 3300009978 Bacteria 5050
156 Ga0157373_10118934 3300013100 Bacteria 1857
157 Ga0157369_10068106 3300013105 Bacteria 3824
158 Ga0157378_10098766 3300013297 Bacteria 2663
159 Ga0163162_10043682 3300013306 Bacteria 4487
160 Ga0163162_10196113 3300013306 Bacteria 2148
161 Ga0157372_10032844 3300013307 Bacteria 5693
162 Ga0157375_10060892 3300013308 Bacteria 3746
163 Ga0163163_10000081 3300014325 Bacteria 104678
164 Ga0163163_10131859 3300014325 Bacteria 2539
165 Ga0163163_10320707 3300014325 Bacteria 1603
166 Ga0157380_10000025 3300014326 Bacteria 107388
167 Ga0157380_10001518 3300014326 Bacteria 15240
168 Ga0157380_10006959 3300014326 Bacteria 8003
169 Ga0157380_10180702 3300014326 Bacteria 1853
170 Ga0157379_10000207 3300014968 Bacteria 45489
171 Ga0157379_10012452 3300014968 Bacteria 7428
172 Ga0157379_10224363 3300014968 Bacteria 1703
173 Ga0163161_10001576 3300017792 Bacteria 16816
174 Ga0163161_10016614 3300017792 Bacteria 5140
175 Ga0163161_10079152 3300017792 Bacteria 2416
176 Ga0163161_10330035 3300017792 Bacteria 1208
177 Ga0209676_1000081 3300025292 Bacteria 285297
178 Ga0209050_1000232 3300025298 Bacteria 121822
179 Ga0209050_1001468 3300025298 Bacteria 25215
180 Ga0207697_10087619 3300025315 Bacteria 1317
181 Ga0207696_1000455 3300025711 Bacteria 35742
182 Ga0207696_1001933 3300025711 Bacteria 10530
183 Ga0207713_1000436 3300025735 Bacteria 43987
184 Ga0207713_1010386 3300025735 Bacteria 5153
185 Ga0207713_1037853 3300025735 Bacteria 2052
186 Ga0207692_10024356 3300025898 Bacteria 2813
187 Ga0207680_10005804 3300025903 Bacteria 5926
188 Ga0207680_10098349 3300025903 Bacteria 1875
189 Ga0207680_10108045 3300025903 Bacteria 1799
190 Ga0207680_10299123 3300025903 Bacteria 1121
191 Ga0207647_10012068 3300025904 Bacteria 6030
192 Ga0207647_10013300 3300025904 Bacteria 5710
193 Ga0207685_10034338 3300025905 Bacteria 1842
194 Ga0207699_10127061 3300025906 Bacteria 1657
195 Ga0207645_10001237 3300025907 Bacteria 21011
196 Ga0207643_10269161 3300025908 Bacteria 1054
197 Ga0207705_10000007 3300025909 Bacteria 597387
198 Ga0207654_10004912 3300025911 Bacteria 6770
199 Ga0207695_10004035 3300025913 Bacteria 20196
200 Ga0207671_10021901 3300025914 Bacteria 4842
201 Ga0207671_10088527 3300025914 Bacteria 2329
202 Ga0207693_10000379 3300025915 Bacteria 40846
203 Ga0207660_10102410 3300025917 Bacteria 2140
204 Ga0207657_10006357 3300025919 Bacteria 12272
205 Ga0207646_10151843 3300025922 Bacteria 2089
206 Ga0207646_10607910 3300025922 Bacteria 981
207 Ga0207681_10000013 3300025923 Bacteria 357411
208 Ga0207681_10000081 3300025923 Bacteria 85588
209 Ga0207681_10000255 3300025923 Bacteria 40599
210 Ga0207681_10001754 3300025923 Bacteria 13928
211 Ga0207681_10007751 3300025923 Bacteria 6578
212 Ga0207681_10023665 3300025923 Bacteria 3932
213 Ga0207681_10045258 3300025923 Bacteria 2954
214 Ga0207681_10174143 3300025923 Bacteria 1633
215 Ga0207694_10009301 3300025924 Bacteria 7416
216 Ga0207694_10019117 3300025924 Bacteria 5179
217 Ga0207650_10000002 3300025925 Bacteria 1439222
218 Ga0207650_10000008 3300025925 Bacteria 498534
219 Ga0207650_10030450 3300025925 Bacteria 3888
220 Ga0207664_10047178 3300025929 Bacteria 3383
221 Ga0207644_10000004 3300025931 Bacteria 566613
222 Ga0207644_10000020 3300025931 Bacteria 165455
223 Ga0207644_10001897 3300025931 Bacteria 13580
224 Ga0207644_10005491 3300025931 Bacteria 8256
225 Ga0207644_10016838 3300025931 Bacteria 4924
226 Ga0207644_10254375 3300025931 Bacteria 1402
227 Ga0207706_10008905 3300025933 Bacteria 9238
228 Ga0207706_10060741 3300025933 Bacteria 3329
229 Ga0207686_10059971 3300025934 Bacteria 2406
230 Ga0207670_10214601 3300025936 Bacteria 1469
231 Ga0207704_10018191 3300025938 Bacteria 3664
232 Ga0207665_10002705 3300025939 Bacteria 11892
233 Ga0207691_10001275 3300025940 Bacteria 25192
234 Ga0207711_10001343 3300025941 Bacteria 23216
235 Ga0207711_10001838 3300025941 Bacteria 19346
236 Ga0207711_10001851 3300025941 Bacteria 19297
237 Ga0207711_10031863 3300025941 Bacteria 4454
238 Ga0207711_10096446 3300025941 Bacteria 2610
239 Ga0207711_10246433 3300025941 Bacteria 1639
240 Ga0207667_10004045 3300025949 Bacteria 18017
241 Ga0207667_10008291 3300025949 Bacteria 12361
242 Ga0207667_10018025 3300025949 Bacteria 7929
243 Ga0207712_10000008 3300025961 Bacteria 527957
244 Ga0207712_10067845 3300025961 Bacteria 2554
245 Ga0207712_10077736 3300025961 Bacteria 2406
246 Ga0207712_10148305 3300025961 Bacteria 1809
247 Ga0207712_10256033 3300025961 Bacteria 1417
248 Ga0207668_10003751 3300025972 Bacteria 8946
249 Ga0207668_10004561 3300025972 Bacteria 8148
250 Ga0207668_10005445 3300025972 Bacteria 7495
251 Ga0207668_10060017 3300025972 Bacteria 2668
252 Ga0207668_10310800 3300025972 Bacteria 1304
253 Ga0207640_10000279 3300025981 Bacteria 34340
254 Ga0207640_10016415 3300025981 Bacteria 4307
255 Ga0207640_10292998 3300025981 Bacteria 1284
256 Ga0207658_10000001 3300025986 Bacteria 1439333
257 Ga0207658_10001301 3300025986 Bacteria 19696
258 Ga0207658_10003517 3300025986 Bacteria 11057
259 Ga0207658_10007936 3300025986 Bacteria 7230
260 Ga0207658_10015482 3300025986 Bacteria 5231
261 Ga0207658_10066958 3300025986 Bacteria 2704
262 Ga0207703_10010844 3300026035 Bacteria 7107
263 Ga0207703_10012379 3300026035 Bacteria 6648
264 Ga0207703_10083095 3300026035 Bacteria 2675
265 Ga0207678_10016055 3300026067 Bacteria 6576
266 Ga0207641_10005772 3300026088 Bacteria 10509
267 Ga0207641_10043161 3300026088 Bacteria 3785
268 Ga0207641_10050239 3300026088 Bacteria 3527
269 Ga0207641_10295210 3300026088 Bacteria 1529
270 Ga0207648_10006902 3300026089 Bacteria 11248
271 Ga0207676_10000001 3300026095 Bacteria 1439222
272 Ga0207676_10000012 3300026095 Bacteria 353971
273 Ga0207674_10004418 3300026116 Bacteria 16920
274 Ga0207674_10152143 3300026116 Bacteria 2270
275 Ga0207675_100000057 3300026118 Bacteria 81804
276 Ga0207675_100007183 3300026118 Bacteria 10523
277 Ga0207675_100014762 3300026118 Bacteria 7286
278 Ga0207683_10000798 3300026121 Bacteria 28764
279 Ga0207683_10763074 3300026121 Bacteria 897
280 Ga0207698_10000919 3300026142 Bacteria 17125
281 Ga0207698_10003339 3300026142 Bacteria 9657
282 Ga0207698_10213872 3300026142 Bacteria 1736
283 Ga0209971_1001080 3300027682 Bacteria 6932
284 Ga0209966_1022150 3300027695 Bacteria 1241
285 Ga0209998_10009053 3300027717 Bacteria 2062
286 Ga0209974_10009783 3300027876 Bacteria 3250
287 Ga0209974_10029862 3300027876 Bacteria 1807
288 Ga0207428_10003679 3300027907 Bacteria 14756
289 Ga0207428_10076296 3300027907 Bacteria 2625
290 Ga0207428_10171339 3300027907 Bacteria 1644
291 Ga0268266_10000205 3300028379 Bacteria 103915
292 Ga0268266_10000945 3300028379 Bacteria 36992
293 Ga0268266_10008275 3300028379 Bacteria 9268
294 Ga0268266_10011566 3300028379 Bacteria 7660
295 Ga0268266_10122578 3300028379 Bacteria 2315
296 Ga0268266_10125830 3300028379 Bacteria 2287
297 Ga0268266_10130268 3300028379 Bacteria 2249
298 Ga0268266_10155668 3300028379 Bacteria 2064
299 Ga0268266_10257209 3300028379 Bacteria 1617
300 Ga0268265_10000006 3300028380 Bacteria 466482
301 Ga0268265_10000216 3300028380 Bacteria 66604
302 Ga0268265_10004038 3300028380 Bacteria 10333
303 Ga0268265_10013639 3300028380 Bacteria 5527
304 Ga0268265_10014446 3300028380 Bacteria 5380
305 Ga0268265_10022817 3300028380 Bacteria 4403
306 Ga0268264_10000004 3300028381 Bacteria 1116842
307 Ga0268264_10001169 3300028381 Bacteria 25510
308 Ga0268264_10004485 3300028381 Bacteria 11912
309 Ga0268264_10022075 3300028381 Bacteria 5195
310 Ga0268264_10035438 3300028381 Bacteria 4108
311 Ga0268264_10043053 3300028381 Bacteria 3740
312 Ga0307517_10190725 3300028786 Bacteria 1302
313 Ga0307515_10000192 3300028794 Bacteria 149030
314 Ga0307515_10078846 3300028794 Bacteria 4324
315 Ga0307512_10015238 3300030522 Bacteria 7135
316 Ga0265331_10007423 3300031250 Bacteria 6344
317 Ga0265327_10000229 3300031251 Bacteria 113907
318 Ga0307509_10022794 3300031507 Bacteria 7047
319 Ga0307516_10046421 3300031730 Bacteria 4286
320 Ga0307405_10000504 3300031731 Bacteria 14716
321 Ga0307406_10316255 3300031901 Bacteria 1206
322 Ga0307412_10040364 3300031911 Bacteria 3019
323 Ga0307414_10006131 3300032004 Bacteria 6678
324 Ga0307414_10566588 3300032004 Bacteria 1014
325 Ga0373934_0083460 3300035086 Bacteria 1284
326 Ga0373935_0057225 3300035692 Bacteria 2487
327 Ga0373933_0062920 3300035724 Bacteria 2242
328 Ga0373933_0068470 3300035724 Bacteria 2156
329 Ga0373937_0033412 3300036401 Bacteria 4671
330 Ga0373937_0078930 3300036401 Bacteria 3042
331 Ga0439438_001613 3300041405 Bacteria 9898
332 Ga0439466_0007737 3300041411 Bacteria 4059
333 Ga0450902_000064 3300042137 Bacteria 10289
334 Ga0450903_000363 3300042138 Bacteria 9996
335 Ga0451576_0236858 3300045051 Bacteria 1906
336 Ga0466967_0009262 3300045976 Bacteria 7295
337 Ga0495627_005890 3300046453 Bacteria 4870
338 Ga0495590_0008769 3300046457 Bacteria 3846
339 Ga0495638_0001649 3300046460 Bacteria 19767
340 Ga0495638_0023345 3300046460 Bacteria 4045
341 Ga0495638_0039020 3300046460 Bacteria 3016
342 Ga0495651_0031298 3300046462 Bacteria 4149
343 Ga0495653_0328959 3300046463 Bacteria 988
344 Ga0495650_0001059 3300046471 Bacteria 30518
345 Ga0495650_0012749 3300046471 Bacteria 4501
346 Ga0495580_0000466 3300046472 Bacteria 33634
347 Ga0495605_0007541 3300046474 Bacteria 6168
348 Ga0495605_0034178 3300046474 Bacteria 2575
349 Ga0495584_0068326 3300046491 Bacteria 1785
350 Ga0495585_0035350 3300046492 Bacteria 2824
351 Ga0495596_0000103 3300046500 Bacteria 60746
352 Ga0495607_0003627 3300046501 Bacteria 11724
353 Ga0495606_0006542 3300046507 Bacteria 10716
354 Ga0495608_0119934 3300046511 Bacteria 1687
355 Ga0495610_0006384 3300046512 Bacteria 8132
356 Ga0495610_0009726 3300046512 Bacteria 6046
357 Ga0495610_0031804 3300046512 Bacteria 2749
358 Ga0495616_0015454 3300046513 Bacteria 4246
359 Ga0495616_0109498 3300046513 Bacteria 1284
360 Ga0495620_0006696 3300046515 Bacteria 6311
361 Ga0495632_0002493 3300046519 Bacteria 13971
362 Ga0495632_0011723 3300046519 Bacteria 5103
363 Ga0495632_0106674 3300046519 Bacteria 1317
364 Ga0495637_0000467 3300046520 Bacteria 29562
365 Ga0495637_0026547 3300046520 Bacteria 2597
366 Ga0495637_0047797 3300046520 Bacteria 1805
367 Ga0495643_0002438 3300046522 Bacteria 14759
368 Ga0495643_0021097 3300046522 Bacteria 3743
369 Ga0495643_0029858 3300046522 Bacteria 3048
370 Ga0495644_0002086 3300046523 Bacteria 8051
371 Ga0495644_0021105 3300046523 Bacteria 2484
372 Ga0495648_0026436 3300046524 Bacteria 3907
373 Ga0495648_0045723 3300046524 Bacteria 2720
374 Ga0495654_0002758 3300046530 Bacteria 11067
375 Ga0495654_0064396 3300046530 Bacteria 1752
376 Ga0495597_0002575 3300046542 Bacteria 11330
377 Ga0495597_0072603 3300046542 Bacteria 1480
378 Ga0495668_0000610 3300046616 Bacteria 43140
379 Ga0495625_0018910 3300046660 Bacteria 5362
380 Ga0495661_0013071 3300046665 Bacteria 5585
381 Ga0495661_0045175 3300046665 Bacteria 2695
382 Ga0495599_0000339 3300046678 Bacteria 27900
383 Ga0495623_0006086 3300046679 Bacteria 7849
384 Ga0495623_0032584 3300046679 Bacteria 3349
385 Ga0495623_0075626 3300046679 Bacteria 2091
386 Ga0495670_0162524 3300046691 Bacteria 1173
387 Ga0495671_0022237 3300046692 Bacteria 3323
388 Ga0495671_0119081 3300046692 Bacteria 1288
389 Ga0495649_0017371 3300046694 Bacteria 4059
390 Ga0495589_0006215 3300046794 Bacteria 6307
391 Ga0495660_0016542 3300046810 Bacteria 4252
392 Ga0495660_0078837 3300046810 Bacteria 1730
393 Ga0495660_0129005 3300046810 Bacteria 1270
394 Ga0495604_0017565 3300047317 Bacteria 5728
395 Ga0495604_0032772 3300047317 Bacteria 4116
396 Ga0495604_0035994 3300047317 Bacteria 3905
397 Ga0495672_0008145 3300047320 Bacteria 7782
398 Ga0495672_0130979 3300047320 Bacteria 1319
399 Ga0495683_0004060 3300047323 Bacteria 8390
400 Ga0495683_0026253 3300047323 Bacteria 2980
401 Ga0495673_0044582 3300047469 Bacteria 1977
402 Ga0495681_0019780 3300047470 Bacteria 3666
403 Ga0495681_0027952 3300047470 Bacteria 2910
404 Ga0495686_0081504 3300047472 Bacteria 1976
405 Ga0495602_0044914 3300048088 Bacteria 4003
406 Ga0495626_0000803 3300048091 Bacteria 28383
407 Ga0496100_0063446 3300048903 Bacteria 2441
408 Ga0496100_0091619 3300048903 Bacteria 2075
409 Ga0496100_0234821 3300048903 Bacteria 1351
410 Ga0496101_0004403 3300048904 Bacteria 8854
411 Ga0496101_0006175 3300048904 Bacteria 7700
412 Ga0496102_0000149 3300048905 Bacteria 95638
413 Ga0496102_0000178 3300048905 Bacteria 86174
414 Ga0496102_0017774 3300048905 Bacteria 6234
415 Ga0496102_0238128 3300048905 Bacteria 1716
416 Ga0496103_0000049 3300048906 Bacteria 154466
417 Ga0496103_0000119 3300048906 Bacteria 86194
418 Ga0496103_0009374 3300048906 Bacteria 5798
419 Ga0496103_0020412 3300048906 Bacteria 3979
420 Ga0496103_0053753 3300048906 Bacteria 2496
421 Ga0496103_0121596 3300048906 Bacteria 1663
422 Ga0496104_0000165 3300048907 Bacteria 58816
423 Ga0496104_0005808 3300048907 Bacteria 10806
424 Ga0496104_0103714 3300048907 Bacteria 2724
425 Ga0496105_0000193 3300048908 Bacteria 40676
426 Ga0496105_0000384 3300048908 Bacteria 29011
427 Ga0496105_0196696 3300048908 Bacteria 1647
428 Ga0496106_0005649 3300048909 Bacteria 9255
429 Ga0496106_0291584 3300048909 Bacteria 1308
430 Ga0496107_0005680 3300048910 Bacteria 8533
431 Ga0496107_0025742 3300048910 Bacteria 4167
432 Ga0496108_0007112 3300048911 Bacteria 9066
433 Ga0496108_0023884 3300048911 Bacteria 5032
434 Ga0496108_0237754 3300048911 Bacteria 1584
435 Ga0496109_0128962 3300048912 Bacteria 2360
436 Ga0496109_0508989 3300048912 Bacteria 1136
437 Ga0496109_0584802 3300048912 Bacteria 1052
438 Ga0496110_0003920 3300048913 Bacteria 11449
439 Ga0496110_0005735 3300048913 Bacteria 9754
440 Ga0496110_0006512 3300048913 Bacteria 9264
441 Ga0496110_0117251 3300048913 Bacteria 2397
442 Ga0496111_0088124 3300048914 Bacteria 2272
443 Ga0496112_0018100 3300048915 Bacteria 6629
444 Ga0496112_0092432 3300048915 Bacteria 2995
445 Ga0496112_0203638 3300048915 Bacteria 1937
446 Ga0496112_0524401 3300048915 Bacteria 1119
447 Ga0496112_0620366 3300048915 Bacteria 1012
448 Ga0496113_0002690 3300048916 Bacteria 10426
449 Ga0496113_0008095 3300048916 Bacteria 6825
450 Ga0496113_0030410 3300048916 Bacteria 3909
451 Ga0496113_0038501 3300048916 Bacteria 3516
452 Ga0496114_0002414 3300048917 Bacteria 14245
453 Ga0496114_0022512 3300048917 Bacteria 5136
454 Ga0496115_0000253 3300048918 Bacteria 47511
455 Ga0496115_0164396 3300048918 Bacteria 1835
456 Ga0496115_0354721 3300048918 Bacteria 1196
457 Ga0496116_0000078 3300048919 Bacteria 227712
458 Ga0496116_0088573 3300048919 Bacteria 1891
459 Ga0496117_0000123 3300048920 Bacteria 169805
460 Ga0496117_0000318 3300048920 Bacteria 84351
461 Ga0496117_0007958 3300048920 Bacteria 10181
462 Ga0496117_0011681 3300048920 Bacteria 7839
463 Ga0496118_0000186 3300048921 Bacteria 108940
464 Ga0496118_0044037 3300048921 Bacteria 3499
465 Ga0496118_0149063 3300048921 Bacteria 1467
466 Ga0496118_0169669 3300048921 Bacteria 1335
467 Ga0496118_0292132 3300048921 Bacteria 900
468 Ga0496119_0000121 3300048922 Bacteria 109164
469 Ga0496119_0005200 3300048922 Bacteria 12574
470 Ga0496120_0002006 3300048923 Bacteria 22142
471 Ga0496120_0017810 3300048923 Bacteria 4592
472 Ga0496121_0001102 3300048924 Bacteria 47573
473 Ga0496121_0001167 3300048924 Bacteria 46089
474 Ga0496121_0005678 3300048924 Bacteria 15872
475 Ga0496121_0016348 3300048924 Bacteria 7667
476 Ga0496121_0130569 3300048924 Bacteria 1881
477 Ga0496122_0001958 3300048925 Bacteria 30842
478 Ga0496122_0007455 3300048925 Bacteria 12146
479 Ga0496122_0009975 3300048925 Bacteria 9888
480 Ga0496122_0016402 3300048925 Bacteria 7008
481 Ga0496122_0019308 3300048925 Bacteria 6233
482 Ga0496122_0118831 3300048925 Bacteria 1711
483 Ga0496123_0001507 3300048926 Bacteria 32271
484 Ga0496123_0001522 3300048926 Bacteria 32045
485 Ga0496123_0024635 3300048926 Bacteria 4567
486 Ga0496123_0055708 3300048926 Bacteria 2591
487 Ga0496124_0000127 3300048927 Bacteria 158376
488 Ga0496124_0000324 3300048927 Bacteria 88327
489 Ga0496124_0005269 3300048927 Bacteria 14634
490 Ga0496124_0005490 3300048927 Bacteria 14232
491 Ga0496124_0015055 3300048927 Bacteria 7438
492 Ga0496124_0016818 3300048927 Bacteria 6933
493 Ga0496124_0037494 3300048927 Bacteria 4215
494 Ga0496124_0157577 3300048927 Bacteria 1774
495 Ga0496125_0001272 3300048928 Bacteria 37495
496 Ga0496125_0011326 3300048928 Bacteria 8932
497 Ga0496125_0020549 3300048928 Bacteria 6195
498 Ga0496125_0043555 3300048928 Bacteria 3806
499 Ga0496125_0080593 3300048928 Bacteria 2490
500 Ga0496125_0144020 3300048928 Bacteria 1651
501 Ga0496125_0215726 3300048928 Bacteria 1241
502 Ga0496126_0000045 3300048929 Bacteria 331225
503 Ga0496126_0000058 3300048929 Bacteria 272530
504 Ga0496126_0001180 3300048929 Bacteria 42930
505 Ga0496126_0003207 3300048929 Bacteria 20981
506 Ga0496126_0013335 3300048929 Bacteria 8368
507 Ga0496126_0173928 3300048929 Bacteria 1833
508 Ga0496126_0297256 3300048929 Bacteria 1333
509 Ga0496126_0319861 3300048929 Bacteria 1276
510 Ga0496126_0380018 3300048929 Bacteria 1150
511 Ga0495678_001781 3300049459 Bacteria 15921
512 Ga0495682_0000947 3300049460 Bacteria 17562
513 Ga0501290_000098 3300049513 Bacteria 12826
514 Ga0501292_000006 3300049515 Bacteria 90286
515 Ga0501294_000382 3300049517 Bacteria 5395
516 Ga0501302_001651 3300049525 Bacteria 1236
517 Ga0501314_000143 3300049530 Bacteria 3555
518 Ga0501031_0100514 3300049568 Bacteria 1887
519 Ga0501032_0010074 3300049569 Bacteria 6823
520 Ga0501032_0145147 3300049569 Bacteria 1562
521 Ga0501033_0001353 3300049570 Bacteria 21844
522 Ga0501033_0003694 3300049570 Bacteria 12445
523 Ga0501033_0172491 3300049570 Bacteria 1553
524 Ga0501034_0002426 3300049571 Bacteria 22542
525 Ga0501034_0002846 3300049571 Bacteria 20161
526 Ga0501034_0005350 3300049571 Bacteria 14056
527 Ga0501034_0031029 3300049571 Bacteria 5431
528 Ga0501036_0006504 3300049572 Bacteria 9495
529 Ga0501037_0008952 3300049573 Bacteria 7335
530 Ga0501037_0222651 3300049573 Bacteria 1327
531 Ga0501038_0010873 3300049574 Bacteria 8313
532 Ga0501039_0020608 3300049575 Bacteria 5053
533 Ga0501039_0058072 3300049575 Bacteria 2996
534 Ga0501043_0006030 3300049579 Bacteria 9737
535 Ga0501046_0091470 3300049580 Bacteria 2340
536 Ga0501047_0000220 3300049581 Bacteria 68612
537 Ga0501047_0183002 3300049581 Bacteria 1961
538 Ga0501048_0461374 3300049582 Bacteria 910
539 Ga0501202_003721 3300049652 Bacteria 2628
540 Ga0501206_000800 3300049653 Bacteria 3850
541 Ga0501222_001077 3300049662 Bacteria 3871
542 Ga0501223_000006 3300049663 Bacteria 133378
543 Ga0501223_000023 3300049663 Bacteria 64396
544 Ga0501223_005080 3300049663 Bacteria 2782
545 Ga0501224_000001 3300049664 Bacteria 308131
546 Ga0501227_003797 3300049665 Bacteria 3266
547 Ga0501233_000014 3300049668 Bacteria 27843
548 Ga0501235_001084 3300049669 Bacteria 5687
549 Ga0501246_000076 3300049676 Bacteria 5467
550 Ga0501261_000041 3300049690 Bacteria 25813
551 Ga0501221_025040 3300049704 Bacteria 1202
552 Ga0501221_025690 3300049704 Bacteria 1192
553 Ga0501225_0000005 3300049705 Bacteria 133194
554 Ga0501225_0000477 3300049705 Bacteria 12480
555 Ga0501225_0001290 3300049705 Bacteria 7767
556 Ga0501225_0010780 3300049705 Bacteria 2582
557 Ga0501225_0059975 3300049705 Bacteria 1069
558 Ga0501234_000791 3300049707 Bacteria 4946
559 Ga0501245_012906 3300049708 Bacteria 1230
560 Ga0501279_000006 3300049775 Bacteria 152264
561 Ga0501280_000017 3300049776 Bacteria 54657
562 Ga0501281_00003 3300049777 Bacteria 40318
563 Ga0501282_002037 3300049778 Bacteria 2224
564 Ga0501283_001213 3300049779 Bacteria 3403
565 Ga0501035_0000815 3300049822 Bacteria 33266
566 Ga0501044_0003728 3300049823 Bacteria 17117
567 Ga0501044_0010440 3300049823 Bacteria 10080
568 Ga0501226_000050 3300049853 Bacteria 51521
569 nmdc:mga03n38_285869_c1 3300050490 Bacteria 882
570 nmdc:mga05p37_381154_c1 3300050507 Bacteria 1652
571 nmdc:mga09592_187731_c1 3300050508 Bacteria 1789
572 nmdc:mga08y16_89194_c1 3300050511 Bacteria 3214
573 nmdc:mga08x19_23046_c1 3300050514 Bacteria 3861
574 Ga0500595_029382 3300053119 Bacteria 1865
575 Ga0500618_003298 3300053125 Bacteria 5600
576 Ga0500658_0006472 3300053134 Bacteria 4345
577 Ga0500564_044426 3300053138 Bacteria 2041
578 Ga0500568_0002823 3300053139 Bacteria 10032
579 Ga0500573_0000027 3300053140 Bacteria 143529
580 2511334187 2511231017 Bacteria 6503007
581 2515494364 2515154088 Bacteria 5526283
582 2515757451 2515154137 Bacteria 5711575
583 2516088930 2515154203 Bacteria 5458536
584 2643727930 2643221541 Bacteria 5498788
585 2643832291 2643221563 Bacteria 4726935
586 2644043120 2643221606 Bacteria 5588032
587 2644053914 2643221608 Bacteria 4724829
588 2644395449 2643221671 Bacteria 5496681
589 2739306785 2738543024 Bacteria 5603683
590 2753265790 2751185782 Bacteria 11227053
591 2882806939 2882806704 Bacteria 3007728
592 2895885796 2895880812 Bacteria 11255272
593 8002286006 8002285264 Bacteria 6717907
594 8057104829 8057101203 Bacteria 5034064
595 Ga0495638_0003369
596 SwRhRL2b_contig_2149026
597 SwRhRL2b_contig_2334788
598 JGI24752J21851_1005971
599 JGI24740J21852_10009422
600 JGI24737J22298_10008340
601 JGI24735J21928_10008586
602 JGI24748J21848_1002846
603 JGI24749J21850_1000150
604 JGI24034J26672_10000934
605 JGI24034J26672_10002693
606 JGI24034J26672_10006054
607 JGI24751J29686_10000002
608 JGI24751J29686_10021053
609 Ga0055536_1000120
610 Ga0065714_10005046
611 Ga0065704_10000342
612 Ga0065704_10002516
613 Ga0065704_10070166
614 Ga0065704_10072848
615 Ga0065707_10081815
616 Ga0065707_10082422
617 Ga0065707_10095831
618 Ga0070658_10000304
619 Ga0070658_10008332
620 Ga0070683_100262035
621 Ga0070670_100000012
622 Ga0070670_100000026
623 Ga0070670_100005694
624 Ga0070670_100028959
625 Ga0070670_100086870
626 Ga0070677_10054674
627 Ga0070666_10017345
628 Ga0070680_100279011
629 Ga0070661_100009928
630 Ga0070668_100000642
631 Ga0070668_100001679
632 Ga0070668_100021926
633 Ga0070668_100033923
634 Ga0070668_100164416
635 Ga0070669_100000064
636 Ga0070669_100000077
637 Ga0070669_100000199
638 Ga0070669_100001050
639 Ga0070669_100002158
640 Ga0070669_100006689
641 Ga0070669_100013893
642 Ga0070671_100000077
643 Ga0070671_100000863
644 Ga0070671_100001302
645 Ga0070671_100003136
646 Ga0070671_100023407
647 Ga0070688_100277321
648 Ga0070659_100023370
649 Ga0070667_100000002
650 Ga0070667_100000828
651 Ga0070667_100001698
652 Ga0070667_100002772
653 Ga0070667_100015584
654 Ga0070667_100036976
655 Ga0070709_10199934
656 Ga0070713_100003202
657 Ga0070713_100085797
658 Ga0070710_10008731
659 Ga0070710_10052968
660 Ga0070711_100006415
661 Ga0070705_100124955
662 Ga0070663_100007527
663 Ga0070678_100059574
664 Ga0070662_100044811
665 Ga0068867_100040064
666 Ga0070685_10000009
667 Ga0070685_10008897
668 Ga0070684_100137999
669 Ga0070672_100071928
670 Ga0070665_100000163
671 Ga0070665_100013238
672 Ga0070665_100026151
673 Ga0070665_100107348
674 Ga0070665_100153609
675 Ga0070665_100200590
676 Ga0068855_100003651
677 Ga0068855_100020494
678 Ga0068855_100111522
679 Ga0068857_100584268
680 Ga0068854_100000322
681 Ga0068854_100434966
682 Ga0068852_100000357
683 Ga0068852_100005824
684 Ga0068859_100022203
685 Ga0068859_100121149
686 Ga0068859_100145896
687 Ga0068859_100164400
688 Ga0068864_100000002
689 Ga0068864_100000010
690 Ga0068864_100365999
691 Ga0068861_100006004
692 Ga0068861_100015123
693 Ga0068861_100274352
694 Ga0068851_10027096
695 Ga0068863_100054520
696 Ga0068863_100197837
697 Ga0068863_100272119
698 Ga0068858_100052357
699 Ga0068858_100070810
700 Ga0068858_100118826
701 Ga0068860_100000450
702 Ga0068860_100000474
703 Ga0068860_100001423
704 Ga0068860_100021734
705 Ga0068860_100086783
706 Ga0068860_100232945
707 Ga0068862_100000016
708 Ga0068862_100000105
709 Ga0068862_100011447
710 Ga0068862_100061327
711 Ga0068862_100080104
712 Ga0070717_10165463
713 Ga0070717_10244363
714 Ga0075432_10006547
715 Ga0075432_10035849
716 Ga0070715_10000618
717 Ga0070716_100005358
718 Ga0070712_100002095
719 Ga0097621_100016928
720 Ga0075436_100087011
721 Ga0097620_100022203
722 Ga0097620_100121150
723 Ga0097620_100145893
724 Ga0097620_100164402
725 Ga0105251_10001177
726 Ga0105251_10025901
727 Ga0105250_10000186
728 Ga0105250_10004727
729 Ga0105240_10008858
730 Ga0105245_10013559
731 Ga0105247_10051785
732 Ga0114129_10075734
733 Ga0114129_10467360
734 Ga0114129_10712933
735 Ga0105242_10036936
736 Ga0105248_10003755
737 Ga0105248_10007376
738 Ga0105248_10029610
739 Ga0105248_10051605
740 Ga0105248_10079599
741 Ga0105248_10132984
742 Ga0105248_10418436
743 Ga0105237_10224366
744 Ga0105238_10004267
745 Ga0105249_10000004
746 Ga0105249_10030205
747 Ga0105249_10047668
748 Ga0105249_10095271
749 Ga0105148_100366
750 Ga0157373_10118934
751 Ga0157369_10068106
752 Ga0157378_10098766
753 Ga0163162_10043682
754 Ga0163162_10196113
755 Ga0157372_10032844
756 Ga0157375_10060892
757 Ga0163163_10000081
758 Ga0163163_10131859
759 Ga0163163_10320707
760 Ga0157380_10000025
761 Ga0157380_10001518
762 Ga0157380_10006959
763 Ga0157380_10180702
764 Ga0157379_10000207
765 Ga0157379_10012452
766 Ga0157379_10224363
767 Ga0163161_10001576
768 Ga0163161_10016614
769 Ga0163161_10079152
770 Ga0163161_10330035
771 Ga0209676_1000081
772 Ga0209050_1000232
773 Ga0209050_1001468
774 Ga0207697_10087619
775 Ga0207696_1000455
776 Ga0207696_1001933
777 Ga0207713_1000436
778 Ga0207713_1010386
779 Ga0207713_1037853
780 Ga0207692_10024356
781 Ga0207680_10005804
782 Ga0207680_10098349
783 Ga0207680_10108045
784 Ga0207680_10299123
785 Ga0207647_10012068
786 Ga0207647_10013300
787 Ga0207685_10034338
788 Ga0207699_10127061
789 Ga0207645_10001237
790 Ga0207643_10269161
791 Ga0207705_10000007
792 Ga0207654_10004912
793 Ga0207695_10004035
794 Ga0207671_10021901
795 Ga0207671_10088527
796 Ga0207693_10000379
797 Ga0207660_10102410
798 Ga0207657_10006357
799 Ga0207646_10151843
800 Ga0207646_10607910
801 Ga0207681_10000013
802 Ga0207681_10000081
803 Ga0207681_10000255
804 Ga0207681_10001754
805 Ga0207681_10007751
806 Ga0207681_10023665
807 Ga0207681_10045258
808 Ga0207681_10174143
809 Ga0207694_10009301
810 Ga0207694_10019117
811 Ga0207650_10000002
812 Ga0207650_10000008
813 Ga0207650_10030450
814 Ga0207664_10047178
815 Ga0207644_10000004
816 Ga0207644_10000020
817 Ga0207644_10001897
818 Ga0207644_10005491
819 Ga0207644_10016838
820 Ga0207644_10254375
821 Ga0207706_10008905
822 Ga0207706_10060741
823 Ga0207686_10059971
824 Ga0207670_10214601
825 Ga0207704_10018191
826 Ga0207665_10002705
827 Ga0207691_10001275
828 Ga0207711_10001343
829 Ga0207711_10001838
830 Ga0207711_10001851
831 Ga0207711_10031863
832 Ga0207711_10096446
833 Ga0207711_10246433
834 Ga0207667_10004045
835 Ga0207667_10008291
836 Ga0207667_10018025
837 Ga0207712_10000008
838 Ga0207712_10067845
839 Ga0207712_10077736
840 Ga0207712_10148305
841 Ga0207712_10256033
842 Ga0207668_10003751
843 Ga0207668_10004561
844 Ga0207668_10005445
845 Ga0207668_10060017
846 Ga0207668_10310800
847 Ga0207640_10000279
848 Ga0207640_10016415
849 Ga0207640_10292998
850 Ga0207658_10000001
851 Ga0207658_10001301
852 Ga0207658_10003517
853 Ga0207658_10007936
854 Ga0207658_10015482
855 Ga0207658_10066958
856 Ga0207703_10010844
857 Ga0207703_10012379
858 Ga0207703_10083095
859 Ga0207678_10016055
860 Ga0207641_10005772
861 Ga0207641_10043161
862 Ga0207641_10050239
863 Ga0207641_10295210
864 Ga0207648_10006902
865 Ga0207676_10000001
866 Ga0207676_10000012
867 Ga0207674_10004418
868 Ga0207674_10152143
869 Ga0207675_100000057
870 Ga0207675_100007183
871 Ga0207675_100014762
872 Ga0207683_10000798
873 Ga0207683_10763074
874 Ga0207698_10000919
875 Ga0207698_10003339
876 Ga0207698_10213872
877 Ga0209971_1001080
878 Ga0209966_1022150
879 Ga0209998_10009053
880 Ga0209974_10009783
881 Ga0209974_10029862
882 Ga0207428_10003679
883 Ga0207428_10076296
884 Ga0207428_10171339
885 Ga0268266_10000205
886 Ga0268266_10000945
887 Ga0268266_10008275
888 Ga0268266_10011566
889 Ga0268266_10122578
890 Ga0268266_10125830
891 Ga0268266_10130268
892 Ga0268266_10155668
893 Ga0268266_10257209
894 Ga0268265_10000006
895 Ga0268265_10000216
896 Ga0268265_10004038
897 Ga0268265_10013639
898 Ga0268265_10014446
899 Ga0268265_10022817
900 Ga0268264_10000004
901 Ga0268264_10001169
902 Ga0268264_10004485
903 Ga0268264_10022075
904 Ga0268264_10035438
905 Ga0268264_10043053
906 Ga0307517_10190725
907 Ga0307515_10000192
908 Ga0307515_10078846
909 Ga0307512_10015238
910 Ga0265331_10007423
911 Ga0265327_10000229
912 Ga0307509_10022794
913 Ga0307516_10046421
914 Ga0307405_10000504
915 Ga0307406_10316255
916 Ga0307412_10040364
917 Ga0307414_10006131
918 Ga0307414_10566588
919 Ga0373934_0083460
920 Ga0373935_0057225
921 Ga0373933_0062920
922 Ga0373933_0068470
923 Ga0373937_0033412
924 Ga0373937_0078930
925 Ga0439438_001613
926 Ga0439466_0007737
927 Ga0450902_000064
928 Ga0450903_000363
929 Ga0451576_0236858
930 Ga0466967_0009262
931 Ga0495627_005890
932 Ga0495590_0008769
933 Ga0495638_0001649
934 Ga0495638_0023345
935 Ga0495638_0039020
936 Ga0495651_0031298
937 Ga0495653_0328959
938 Ga0495650_0001059
939 Ga0495650_0012749
940 Ga0495580_0000466
941 Ga0495605_0007541
942 Ga0495605_0034178
943 Ga0495584_0068326
944 Ga0495585_0035350
945 Ga0495596_0000103
946 Ga0495607_0003627
947 Ga0495606_0006542
948 Ga0495608_0119934
949 Ga0495610_0006384
950 Ga0495610_0009726
951 Ga0495610_0031804
952 Ga0495616_0015454
953 Ga0495616_0109498
954 Ga0495620_0006696
955 Ga0495632_0002493
956 Ga0495632_0011723
957 Ga0495632_0106674
958 Ga0495637_0000467
959 Ga0495637_0026547
960 Ga0495637_0047797
961 Ga0495643_0002438
962 Ga0495643_0021097
963 Ga0495643_0029858
964 Ga0495644_0002086
965 Ga0495644_0021105
966 Ga0495648_0026436
967 Ga0495648_0045723
968 Ga0495654_0002758
969 Ga0495654_0064396
970 Ga0495597_0002575
971 Ga0495597_0072603
972 Ga0495668_0000610
973 Ga0495625_0018910
974 Ga0495661_0013071
975 Ga0495661_0045175
976 Ga0495599_0000339
977 Ga0495623_0006086
978 Ga0495623_0032584
979 Ga0495623_0075626
980 Ga0495670_0162524
981 Ga0495671_0022237
982 Ga0495671_0119081
983 Ga0495649_0017371
984 Ga0495589_0006215
985 Ga0495660_0016542
986 Ga0495660_0078837
987 Ga0495660_0129005
988 Ga0495604_0017565
989 Ga0495604_0032772
990 Ga0495604_0035994
991 Ga0495672_0008145
992 Ga0495672_0130979
993 Ga0495683_0004060
994 Ga0495683_0026253
995 Ga0495673_0044582
996 Ga0495681_0019780
997 Ga0495681_0027952
998 Ga0495686_0081504
999 Ga0495602_0044914
1000 Ga0495626_0000803
1001 Ga0496100_0063446
1002 Ga0496100_0091619
1003 Ga0496100_0234821
1004 Ga0496101_0004403
1005 Ga0496101_0006175
1006 Ga0496102_0000149
1007 Ga0496102_0000178
1008 Ga0496102_0017774
1009 Ga0496102_0238128
1010 Ga0496103_0000049
1011 Ga0496103_0000119
1012 Ga0496103_0009374
1013 Ga0496103_0020412
1014 Ga0496103_0053753
1015 Ga0496103_0121596
1016 Ga0496104_0000165
1017 Ga0496104_0005808
1018 Ga0496104_0103714
1019 Ga0496105_0000193
1020 Ga0496105_0000384
1021 Ga0496105_0196696
1022 Ga0496106_0005649
1023 Ga0496106_0291584
1024 Ga0496107_0005680
1025 Ga0496107_0025742
1026 Ga0496108_0007112
1027 Ga0496108_0023884
1028 Ga0496108_0237754
1029 Ga0496109_0128962
1030 Ga0496109_0508989
1031 Ga0496109_0584802
1032 Ga0496110_0003920
1033 Ga0496110_0005735
1034 Ga0496110_0006512
1035 Ga0496110_0117251
1036 Ga0496111_0088124
1037 Ga0496112_0018100
1038 Ga0496112_0092432
1039 Ga0496112_0203638
1040 Ga0496112_0524401
1041 Ga0496112_0620366
1042 Ga0496113_0002690
1043 Ga0496113_0008095
1044 Ga0496113_0030410
1045 Ga0496113_0038501
1046 Ga0496114_0002414
1047 Ga0496114_0022512
1048 Ga0496115_0000253
1049 Ga0496115_0164396
1050 Ga0496115_0354721
1051 Ga0496116_0000078
1052 Ga0496116_0088573
1053 Ga0496117_0000123
1054 Ga0496117_0000318
1055 Ga0496117_0007958
1056 Ga0496117_0011681
1057 Ga0496118_0000186
1058 Ga0496118_0044037
1059 Ga0496118_0149063
1060 Ga0496118_0169669
1061 Ga0496118_0292132
1062 Ga0496119_0000121
1063 Ga0496119_0005200
1064 Ga0496120_0002006
1065 Ga0496120_0017810
1066 Ga0496121_0001102
1067 Ga0496121_0001167
1068 Ga0496121_0005678
1069 Ga0496121_0016348
1070 Ga0496121_0130569
1071 Ga0496122_0001958
1072 Ga0496122_0007455
1073 Ga0496122_0009975
1074 Ga0496122_0016402
1075 Ga0496122_0019308
1076 Ga0496122_0118831
1077 Ga0496123_0001507
1078 Ga0496123_0001522
1079 Ga0496123_0024635
1080 Ga0496123_0055708
1081 Ga0496124_0000127
1082 Ga0496124_0000324
1083 Ga0496124_0005269
1084 Ga0496124_0005490
1085 Ga0496124_0015055
1086 Ga0496124_0016818
1087 Ga0496124_0037494
1088 Ga0496124_0157577
1089 Ga0496125_0001272
1090 Ga0496125_0011326
1091 Ga0496125_0020549
1092 Ga0496125_0043555
1093 Ga0496125_0080593
1094 Ga0496125_0144020
1095 Ga0496125_0215726
1096 Ga0496126_0000045
1097 Ga0496126_0000058
1098 Ga0496126_0001180
1099 Ga0496126_0003207
1100 Ga0496126_0013335
1101 Ga0496126_0173928
1102 Ga0496126_0297256
1103 Ga0496126_0319861
1104 Ga0496126_0380018
1105 Ga0495678_001781
1106 Ga0495682_0000947
1107 Ga0501290_000098
1108 Ga0501292_000006
1109 Ga0501294_000382
1110 Ga0501302_001651
1111 Ga0501314_000143
1112 Ga0501031_0100514
1113 Ga0501032_0010074
1114 Ga0501032_0145147
1115 Ga0501033_0001353
1116 Ga0501033_0003694
1117 Ga0501033_0172491
1118 Ga0501034_0002426
1119 Ga0501034_0002846
1120 Ga0501034_0005350
1121 Ga0501034_0031029
1122 Ga0501036_0006504
1123 Ga0501037_0008952
1124 Ga0501037_0222651
1125 Ga0501038_0010873
1126 Ga0501039_0020608
1127 Ga0501039_0058072
1128 Ga0501043_0006030
1129 Ga0501046_0091470
1130 Ga0501047_0000220
1131 Ga0501047_0183002
1132 Ga0501048_0461374
1133 Ga0501202_003721
1134 Ga0501206_000800
1135 Ga0501222_001077
1136 Ga0501223_000006
1137 Ga0501223_000023
1138 Ga0501223_005080
1139 Ga0501224_000001
1140 Ga0501227_003797
1141 Ga0501233_000014
1142 Ga0501235_001084
1143 Ga0501246_000076
1144 Ga0501261_000041
1145 Ga0501221_025040
1146 Ga0501221_025690
1147 Ga0501225_0000005
1148 Ga0501225_0000477
1149 Ga0501225_0001290
1150 Ga0501225_0010780
1151 Ga0501225_0059975
1152 Ga0501234_000791
1153 Ga0501245_012906
1154 Ga0501279_000006
1155 Ga0501280_000017
1156 Ga0501281_00003
1157 Ga0501282_002037
1158 Ga0501283_001213
1159 Ga0501035_0000815
1160 Ga0501044_0003728
1161 Ga0501044_0010440
1162 Ga0501226_000050
1163 nmdc:mga03n38_285869_c1
1164 nmdc:mga05p37_381154_c1
1165 nmdc:mga09592_187731_c1
1166 nmdc:mga08y16_89194_c1
1167 nmdc:mga08x19_23046_c1
1168 Ga0500595_029382
1169 Ga0500618_003298
1170 Ga0500658_0006472
1171 Ga0500564_044426
1172 Ga0500568_0002823
1173 Ga0500573_0000027
1174 2511334187
1175 2515494364
1176 2515757451
1177 2516088930
1178 2643727930
1179 2643832291
1180 2644043120
1181 2644053914
1182 2644395449
1183 2739306785
1184 2753265790
1185 2882806939
1186 2895885796
1187 8002286006
1188 8057104829

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

56

291

0.96

PF00106

adh_short

short chain dehydrogenase

50

248

0.94

PF08659

KR

KR domain

50

246

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9706 15 256
1uls-assembly1.cif.gz_C crystal structure of tt0140 from thermus thermophilus hb8 0.9694 15 256
7tzp-assembly3.cif.gz_G crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh 0.9673 14 256
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9667 15 256
3o38-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from mycobacterium smegmatis 0.966 6 261
ID Description Score Start End Superfamily
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9694 13 256 3.40.50.720
af_I6YCF0_1_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9678 6 256 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9673 15 256 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9667 15 256 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9624 18 256 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5E7HHB1-F1-model_v4 deleted 0.9868 4 261
AF-A0A5C7Q9A7-F1-model_v4 SDR family oxidoreductase 0.9826 1 230 GO:0016616
GO:0030497
AF-A0A4R4WYM3-F1-model_v4 SDR family oxidoreductase 0.9798 6 261 GO:0016616
GO:0030497
AF-A0A4Q3D3P7-F1-model_v4 SDR family oxidoreductase 0.9776 54 261 GO:0016616
GO:0030497
AF-A0A7K0M5I6-F1-model_v4 SDR family oxidoreductase 0.9766 28 261 GO:0016616
GO:0030497

Map