F467374

General Info

Members Datasets Scaffolds Average Seq Length
594 253 589 512

Family's Representative Sequence

Representative Sequence 3300046810|Ga0495660_0046405|Ga0495660_0046405_573_2222
Length 549
Sequence MGGTTTLRLLTLILSKSTIAGKIMEFVKGLLEQQPLMALFLTIAIGYLAGEINIKGFSLGVGAVLFIALAVGWFAPKSAPAPMVGTLGLAIFLYAVGIQYGKQFFAGLSSSKGLKANIMALTGVLLSGAVSMLFLNLVSSGHALGLFAGAGTSTATLQAAIATLGNNDPAVGYSVAYPFGVAVPILILYITFMVMKPKVEQRSNRMELLEIALRNPECIGKRLGEVMSTLPPGVQIVALRHEHHNVPASPDIICGADDVVLAVGPDKDALDRLRMDLGEVAPGRIAKDRSDLDYTRLFASRPAVVGRPLGDLELPGGAGSLVIHVRRGDADMVPTPDLLLEFGDRVGLIANRNDFAAMRAYFGDSIKATAEFSYISIGLGMALGFLIGVISVTMPGLGKVSFGLAGVLIAALILGKLRHTGPVNWTIPLSANLVMRNLGLTLFLAQVGMSSGPKFAATVADTGFLMLGLATVTVLTLVLPVLLIGLFVFRMPFDEVAGIVSGATGNPAILAYSNKLAPTDQPDVGYAMIFPGMTIVKILFVNIIPGFLT

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
3 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
4 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
5 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0.67
Rhizoplane 4.21
Rhizosphere 94.28
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1000508 3300002076 Bacteria 5728
2 JGI25156J39149_1000371 3300002705 Bacteria 28931
3 rootH2_10033949 3300003320 Bacteria 4024
4 rootH1_10261471 3300003323 Bacteria 2533
5 Ga0065715_10153671 3300005293 Bacteria 1700
6 Ga0065707_10125147 3300005295 Bacteria 2029
7 Ga0070683_100019096 3300005329 Bacteria 6082
8 Ga0070670_100000730 3300005331 Bacteria 25562
9 Ga0070670_100004325 3300005331 Bacteria 11887
10 Ga0070670_100010331 3300005331 Bacteria 7967
11 Ga0070670_100045457 3300005331 Bacteria 3775
12 Ga0070677_10042225 3300005333 Bacteria 1804
13 Ga0068869_100006879 3300005334 Bacteria 7233
14 Ga0068869_100158305 3300005334 Bacteria 1761
15 Ga0070666_10030003 3300005335 Bacteria 3580
16 Ga0068868_100037133 3300005338 Bacteria 3775
17 Ga0070660_100032773 3300005339 Bacteria 3912
18 Ga0070689_100058146 3300005340 Bacteria 3003
19 Ga0070689_100130292 3300005340 Bacteria 2017
20 Ga0070661_100008055 3300005344 Bacteria 7275
21 Ga0070661_100061060 3300005344 Bacteria 2766
22 Ga0070668_100000374 3300005347 Bacteria 29621
23 Ga0070668_100000747 3300005347 Bacteria 22308
24 Ga0070668_100019442 3300005347 Bacteria 5112
25 Ga0070668_100032315 3300005347 Bacteria 3983
26 Ga0070675_100012772 3300005354 Bacteria 6588
27 Ga0070671_100059064 3300005355 Bacteria 3192
28 Ga0070674_100067853 3300005356 Unclassified 2510
29 Ga0070673_100084718 3300005364 Bacteria 2579
30 Ga0070673_100142607 3300005364 Bacteria 2022
31 Ga0070667_100011871 3300005367 Bacteria 7204
32 Ga0070667_100019267 3300005367 Bacteria 5660
33 Ga0070709_10016097 3300005434 Unclassified 4262
34 Ga0070710_10017982 3300005437 Bacteria 3629
35 Ga0070701_10020669 3300005438 Bacteria 3128
36 Ga0070711_100020787 3300005439 Bacteria 4235
37 Ga0070663_100019616 3300005455 Bacteria 4462
38 Ga0070662_100030755 3300005457 Bacteria 3761
39 Ga0070662_100043063 3300005457 Bacteria 3228
40 Ga0070685_10002592 3300005466 Bacteria 9258
41 Ga0070685_10036123 3300005466 Bacteria 2792
42 Ga0070706_100079553 3300005467 Unclassified 3034
43 Ga0070698_100013609 3300005471 Bacteria 8612
44 Ga0070699_100002930 3300005518 Bacteria 15171
45 Ga0070684_100022942 3300005535 Bacteria 5212
46 Ga0070672_100005249 3300005543 Bacteria 8569
47 Ga0070672_100006205 3300005543 Bacteria 8006
48 Ga0070672_100017996 3300005543 Bacteria 5098
49 Ga0070672_100038069 3300005543 Bacteria 3673
50 Ga0070672_100048358 3300005543 Bacteria 3305
51 Ga0070665_100012610 3300005548 Bacteria 8509
52 Ga0070665_100029055 3300005548 Bacteria 5566
53 Ga0070665_100103005 3300005548 Bacteria 2858
54 Ga0070664_100021814 3300005564 Bacteria 5279
55 Ga0070664_100049941 3300005564 Bacteria 3538
56 Ga0070702_100009492 3300005615 Bacteria 4764
57 Ga0070702_100033918 3300005615 Bacteria 2810
58 Ga0068852_100054476 3300005616 Bacteria 3448
59 Ga0068859_100001008 3300005617 Bacteria 28834
60 Ga0068859_100069073 3300005617 Bacteria 3567
61 Ga0068859_100100776 3300005617 Bacteria 2944
62 Ga0068864_100000384 3300005618 Bacteria 38548
63 Ga0068861_100012766 3300005719 Bacteria 5863
64 Ga0068861_100042093 3300005719 Bacteria 3423
65 Ga0068861_100100487 3300005719 Bacteria 2299
66 Ga0068851_10028366 3300005834 Unclassified 2765
67 Ga0068851_10046116 3300005834 Bacteria 2204
68 Ga0068870_10024981 3300005840 Bacteria 2962
69 Ga0068863_100012505 3300005841 Bacteria 8192
70 Ga0068863_100024876 3300005841 Bacteria 5711
71 Ga0068858_100000234 3300005842 Bacteria 60077
72 Ga0068858_100012170 3300005842 Bacteria 8111
73 Ga0068860_100129139 3300005843 Bacteria 2424
74 Ga0068862_100008612 3300005844 Bacteria 8440
75 Ga0081455_10086795 3300005937 Bacteria 2548
76 Ga0081540_1000492 3300005983 Bacteria 38821
77 Ga0081539_10025390 3300005985 Bacteria 3817
78 Ga0070717_10095602 3300006028 Bacteria 2515
79 Ga0075365_10037756 3300006038 Bacteria 3137
80 Ga0070716_100000066 3300006173 Bacteria 40601
81 Ga0070712_100018033 3300006175 Bacteria 4579
82 Ga0097621_100021189 3300006237 Bacteria 5022
83 Ga0097621_100084597 3300006237 Bacteria 2645
84 Ga0075428_100014767 3300006844 Bacteria 8677
85 Ga0075428_100076077 3300006844 Bacteria 3665
86 Ga0075430_100026010 3300006846 Bacteria 4980
87 Ga0075430_100080046 3300006846 Bacteria 2737
88 Ga0075431_100057422 3300006847 Bacteria 4014
89 Ga0075431_100163772 3300006847 Bacteria 2286
90 Ga0075433_10003532 3300006852 Bacteria 12068
91 Ga0075434_100002217 3300006871 Bacteria 16951
92 Ga0075429_100052312 3300006880 Bacteria 3553
93 Ga0068865_100068075 3300006881 Bacteria 2516
94 Ga0075436_100021961 3300006914 Bacteria 4382
95 Ga0097620_100001008 3300006931 Bacteria 28834
96 Ga0097620_100069074 3300006931 Bacteria 3567
97 Ga0097620_100100777 3300006931 Bacteria 2944
98 Ga0105244_10058193 3300009036 Bacteria 1951
99 Ga0111539_10000032 3300009094 Bacteria 159626
100 Ga0111539_10012498 3300009094 Bacteria 10640
101 Ga0111539_10013357 3300009094 Bacteria 10262
102 Ga0111539_10025743 3300009094 Bacteria 7207
103 Ga0111539_10121175 3300009094 Bacteria 3065
104 Ga0111539_10137321 3300009094 Unclassified 2863
105 Ga0111539_10183612 3300009094 Bacteria 2443
106 Ga0111539_10193605 3300009094 Unclassified 2372
107 Ga0111539_10233948 3300009094 Bacteria 2139
108 Ga0105241_10179271 3300009174 Bacteria 1756
109 Ga0105248_10031974 3300009177 Bacteria 5880
110 Ga0105248_10060452 3300009177 Bacteria 4254
111 Ga0105248_10095536 3300009177 Bacteria 3346
112 Ga0157374_10015127 3300013296 Bacteria 6766
113 Ga0157374_10024375 3300013296 Bacteria 5424
114 Ga0157374_10109896 3300013296 Bacteria 2651
115 Ga0163162_10006426 3300013306 Bacteria 11381
116 Ga0163162_10024218 3300013306 Bacteria 5990
117 Ga0163162_10123225 3300013306 Bacteria 2697
118 Ga0163162_10142162 3300013306 Bacteria 2514
119 Ga0163162_10297585 3300013306 Unclassified 1745
120 Ga0157375_10000873 3300013308 Bacteria 26216
121 Ga0157375_10140124 3300013308 Bacteria 2545
122 Ga0163163_10002813 3300014325 Bacteria 14717
123 Ga0163163_10016331 3300014325 Bacteria 6892
124 Ga0163163_10169842 3300014325 Unclassified 2227
125 Ga0157380_10030646 3300014326 Bacteria 4122
126 Ga0157380_10108883 3300014326 Bacteria 2323
127 Ga0157377_10004055 3300014745 Bacteria 6683
128 Ga0157379_10005372 3300014968 Bacteria 11006
129 Ga0157379_10048164 3300014968 Bacteria 3804
130 Ga0157376_10037171 3300014969 Bacteria 3949
131 Ga0182006_1018164 3300015261 Bacteria 2976
132 Ga0163161_10019773 3300017792 Bacteria 4724
133 Ga0207697_10000566 3300025315 Bacteria 20995
134 Ga0207697_10004731 3300025315 Bacteria 6450
135 Ga0207697_10005006 3300025315 Bacteria 6233
136 Ga0207656_10025763 3300025321 Bacteria 2391
137 Ga0207682_10000358 3300025893 Bacteria 20946
138 Ga0207682_10004587 3300025893 Bacteria 5755
139 Ga0207692_10014209 3300025898 Bacteria 3473
140 Ga0207688_10002701 3300025901 Bacteria 9607
141 Ga0207688_10003318 3300025901 Bacteria 8796
142 Ga0207688_10056438 3300025901 Bacteria 2206
143 Ga0207688_10064800 3300025901 Bacteria 2064
144 Ga0207680_10046954 3300025903 Bacteria 2556
145 Ga0207699_10002497 3300025906 Bacteria 8687
146 Ga0207645_10003754 3300025907 Bacteria 11415
147 Ga0207643_10001453 3300025908 Bacteria 13599
148 Ga0207643_10075610 3300025908 Bacteria 1944
149 Ga0207693_10028366 3300025915 Bacteria 4423
150 Ga0207662_10011254 3300025918 Bacteria 4954
151 Ga0207662_10059566 3300025918 Bacteria 2289
152 Ga0207649_10068152 3300025920 Unclassified 2261
153 Ga0207681_10003062 3300025923 Bacteria 10510
154 Ga0207650_10004369 3300025925 Bacteria 9655
155 Ga0207650_10020780 3300025925 Bacteria 4635
156 Ga0207650_10034873 3300025925 Bacteria 3651
157 Ga0207650_10040766 3300025925 Bacteria 3400
158 Ga0207659_10001378 3300025926 Bacteria 14507
159 Ga0207659_10007620 3300025926 Bacteria 6676
160 Ga0207659_10021656 3300025926 Bacteria 4271
161 Ga0207659_10040552 3300025926 Bacteria 3256
162 Ga0207644_10001780 3300025931 Bacteria 13940
163 Ga0207644_10005044 3300025931 Bacteria 8616
164 Ga0207644_10026532 3300025931 Bacteria 3992
165 Ga0207644_10057400 3300025931 Bacteria 2810
166 Ga0207706_10012005 3300025933 Bacteria 7892
167 Ga0207706_10042474 3300025933 Bacteria 4030
168 Ga0207706_10046161 3300025933 Bacteria 3857
169 Ga0207706_10120180 3300025933 Bacteria 2310
170 Ga0207709_10084267 3300025935 Bacteria 2057
171 Ga0207709_10144380 3300025935 Bacteria 1640
172 Ga0207670_10010504 3300025936 Bacteria 5339
173 Ga0207670_10046561 3300025936 Bacteria 2882
174 Ga0207704_10020280 3300025938 Bacteria 3512
175 Ga0207665_10000036 3300025939 Bacteria 87649
176 Ga0207691_10001544 3300025940 Bacteria 22885
177 Ga0207691_10012188 3300025940 Bacteria 8242
178 Ga0207691_10014808 3300025940 Bacteria 7431
179 Ga0207691_10037417 3300025940 Bacteria 4494
180 Ga0207691_10042383 3300025940 Bacteria 4196
181 Ga0207691_10057279 3300025940 Bacteria 3547
182 Ga0207691_10070150 3300025940 Bacteria 3165
183 Ga0207711_10085497 3300025941 Bacteria 2764
184 Ga0207689_10000264 3300025942 Bacteria 47214
185 Ga0207679_10160800 3300025945 Bacteria 1839
186 Ga0207651_10008542 3300025960 Bacteria 5538
187 Ga0207668_10009055 3300025972 Bacteria 5949
188 Ga0207668_10021442 3300025972 Bacteria 4120
189 Ga0207668_10033878 3300025972 Bacteria 3386
190 Ga0207658_10003196 3300025986 Bacteria 11658
191 Ga0207658_10020714 3300025986 Bacteria 4555
192 Ga0207658_10171103 3300025986 Unclassified 1789
193 Ga0207677_10002717 3300026023 Bacteria 9327
194 Ga0207677_10033772 3300026023 Bacteria 3304
195 Ga0207703_10001027 3300026035 Bacteria 26776
196 Ga0207703_10040203 3300026035 Bacteria 3741
197 Ga0207703_10108281 3300026035 Bacteria 2367
198 Ga0207703_10235108 3300026035 Bacteria 1645
199 Ga0207708_10128709 3300026075 Bacteria 1978
200 Ga0207702_10183208 3300026078 Bacteria 1930
201 Ga0207641_10000754 3300026088 Bacteria 34852
202 Ga0207641_10076557 3300026088 Bacteria 2892
203 Ga0207648_10016726 3300026089 Bacteria 6692
204 Ga0207648_10018499 3300026089 Bacteria 6306
205 Ga0207648_10047278 3300026089 Bacteria 3773
206 Ga0207676_10000181 3300026095 Bacteria 55624
207 Ga0207676_10027569 3300026095 Bacteria 4232
208 Ga0207676_10105443 3300026095 Bacteria 2347
209 Ga0207676_10106276 3300026095 Unclassified 2338
210 Ga0207676_10136227 3300026095 Bacteria 2095
211 Ga0207674_10006634 3300026116 Bacteria 13598
212 Ga0207675_100007774 3300026118 Bacteria 10114
213 Ga0207675_100049917 3300026118 Bacteria 3904
214 Ga0207675_100064661 3300026118 Bacteria 3419
215 Ga0207675_100138958 3300026118 Bacteria 2307
216 Ga0207675_100171844 3300026118 Bacteria 2072
217 Ga0207683_10004381 3300026121 Bacteria 12197
218 Ga0207683_10005185 3300026121 Bacteria 11189
219 Ga0207683_10043070 3300026121 Bacteria 3943
220 Ga0207683_10075410 3300026121 Bacteria 2985
221 Ga0207683_10131747 3300026121 Bacteria 2249
222 Ga0207698_10016361 3300026142 Bacteria 4996
223 Ga0207698_10052161 3300026142 Unclassified 3132
224 Ga0207698_10122889 3300026142 Bacteria 2201
225 Ga0207428_10004586 3300027907 Bacteria 13095
226 Ga0268266_10002212 3300028379 Bacteria 21255
227 Ga0268266_10002367 3300028379 Bacteria 20374
228 Ga0268266_10014295 3300028379 Bacteria 6826
229 Ga0268266_10018190 3300028379 Bacteria 5993
230 Ga0268266_10039474 3300028379 Bacteria 4022
231 Ga0268266_10103544 3300028379 Bacteria 2512
232 Ga0268266_10221093 3300028379 Bacteria 1741
233 Ga0268265_10184454 3300028380 Bacteria 1796
234 Ga0265327_10013875 3300031251 Bacteria 5318
235 Ga0307408_100002086 3300031548 Bacteria 14394
236 Ga0307412_10047205 3300031911 Bacteria 2827
237 Ga0307416_100211339 3300032002 Bacteria 1851
238 Ga0373927_0004792 3300035695 Bacteria 9416
239 Ga0373937_0032625 3300036401 Bacteria 4724
240 Ga0495617_000026 3300046452 Bacteria 157675
241 Ga0495617_000571 3300046452 Bacteria 18932
242 Ga0495627_000043 3300046453 Bacteria 185855
243 Ga0495592_0102617 3300046454 Bacteria 2036
244 Ga0495603_0008841 3300046455 Bacteria 6088
245 Ga0495603_0015864 3300046455 Bacteria 4553
246 Ga0495590_0000291 3300046457 Bacteria 26853
247 Ga0495590_0001299 3300046457 Bacteria 10858
248 Ga0495590_0003028 3300046457 Bacteria 6888
249 Ga0495591_000216 3300046458 Bacteria 58075
250 Ga0495591_026479 3300046458 Bacteria 1801
251 Ga0495629_0000669 3300046459 Bacteria 27735
252 Ga0495629_0002027 3300046459 Bacteria 15754
253 Ga0495629_0084773 3300046459 Bacteria 2211
254 Ga0495638_0061284 3300046460 Bacteria 2325
255 Ga0495641_0008733 3300046461 Bacteria 6121
256 Ga0495651_0070444 3300046462 Bacteria 2661
257 Ga0495653_0002367 3300046463 Bacteria 14981
258 Ga0495653_0006078 3300046463 Bacteria 9891
259 Ga0495653_0040502 3300046463 Bacteria 3641
260 Ga0495653_0047901 3300046463 Bacteria 3303
261 Ga0495650_0001000 3300046471 Bacteria 32010
262 Ga0495650_0001961 3300046471 Bacteria 18172
263 Ga0495580_0000475 3300046472 Bacteria 33394
264 Ga0495580_0003840 3300046472 Bacteria 12707
265 Ga0495580_0102446 3300046472 Bacteria 1990
266 Ga0495582_0000269 3300046473 Bacteria 29068
267 Ga0495582_0000753 3300046473 Bacteria 17859
268 Ga0495582_0007203 3300046473 Bacteria 6170
269 Ga0495582_0038725 3300046473 Bacteria 2624
270 Ga0495605_0000454 3300046474 Bacteria 36758
271 Ga0495605_0004384 3300046474 Bacteria 8306
272 Ga0495605_0016914 3300046474 Bacteria 3939
273 Ga0495605_0021763 3300046474 Bacteria 3391
274 Ga0495605_0026205 3300046474 Bacteria 3031
275 Ga0495605_0057967 3300046474 Bacteria 1862
276 Ga0495664_0000345 3300046477 Bacteria 22518
277 Ga0495584_0000244 3300046491 Bacteria 39436
278 Ga0495584_0001001 3300046491 Bacteria 17705
279 Ga0495584_0001247 3300046491 Bacteria 15537
280 Ga0495584_0002878 3300046491 Bacteria 9609
281 Ga0495584_0007887 3300046491 Bacteria 5537
282 Ga0495584_0010021 3300046491 Bacteria 4866
283 Ga0495584_0030125 3300046491 Bacteria 2749
284 Ga0495584_0051433 3300046491 Bacteria 2074
285 Ga0495585_0000055 3300046492 Bacteria 113899
286 Ga0495585_0000260 3300046492 Bacteria 54082
287 Ga0495585_0000502 3300046492 Bacteria 37062
288 Ga0495585_0000970 3300046492 Bacteria 24102
289 Ga0495585_0002060 3300046492 Bacteria 14797
290 Ga0495585_0008727 3300046492 Bacteria 6128
291 Ga0495585_0026500 3300046492 Bacteria 3311
292 Ga0495594_0014350 3300046499 Bacteria 4149
293 Ga0495594_0016255 3300046499 Bacteria 3918
294 Ga0495594_0028538 3300046499 Bacteria 3011
295 Ga0495596_0000099 3300046500 Bacteria 61455
296 Ga0495596_0001013 3300046500 Bacteria 16716
297 Ga0495596_0001079 3300046500 Bacteria 16165
298 Ga0495596_0003145 3300046500 Bacteria 8502
299 Ga0495596_0004937 3300046500 Bacteria 6396
300 Ga0495596_0010779 3300046500 Bacteria 3967
301 Ga0495596_0026025 3300046500 Bacteria 2360
302 Ga0495607_0019168 3300046501 Bacteria 4350
303 Ga0495607_0020183 3300046501 Bacteria 4217
304 Ga0495607_0038939 3300046501 Bacteria 2843
305 Ga0495607_0057156 3300046501 Bacteria 2237
306 Ga0495607_0088452 3300046501 Bacteria 1684
307 Ga0495583_0000064 3300046506 Bacteria 192380
308 Ga0495583_0000999 3300046506 Bacteria 32381
309 Ga0495583_0001300 3300046506 Bacteria 25999
310 Ga0495583_0001425 3300046506 Bacteria 24349
311 Ga0495583_0008408 3300046506 Bacteria 6312
312 Ga0495583_0046629 3300046506 Bacteria 1998
313 Ga0495606_0005149 3300046507 Bacteria 12674
314 Ga0495606_0006453 3300046507 Bacteria 10817
315 Ga0495606_0049988 3300046507 Bacteria 2738
316 Ga0495606_0058246 3300046507 Bacteria 2484
317 Ga0495610_0000706 3300046512 Bacteria 31923
318 Ga0495610_0037016 3300046512 Bacteria 2488
319 Ga0495616_0000537 3300046513 Bacteria 28608
320 Ga0495616_0001224 3300046513 Bacteria 18060
321 Ga0495616_0001703 3300046513 Bacteria 15003
322 Ga0495616_0001991 3300046513 Bacteria 13737
323 Ga0495616_0006213 3300046513 Bacteria 7261
324 Ga0495616_0006254 3300046513 Bacteria 7233
325 Ga0495616_0013649 3300046513 Bacteria 4575
326 Ga0495616_0034508 3300046513 Bacteria 2627
327 Ga0495616_0041933 3300046513 Bacteria 2332
328 Ga0495618_0025165 3300046514 Bacteria 3693
329 Ga0495618_0114998 3300046514 Bacteria 1722
330 Ga0495620_0001927 3300046515 Bacteria 12159
331 Ga0495628_0005758 3300046516 Bacteria 10857
332 Ga0495628_0116093 3300046516 Bacteria 2056
333 Ga0495630_0007745 3300046517 Bacteria 7687
334 Ga0495630_0020028 3300046517 Bacteria 4926
335 Ga0495630_0093349 3300046517 Bacteria 2274
336 Ga0495631_0001182 3300046518 Bacteria 16125
337 Ga0495631_0002817 3300046518 Bacteria 9653
338 Ga0495631_0002837 3300046518 Bacteria 9625
339 Ga0495631_0003034 3300046518 Bacteria 9282
340 Ga0495631_0005795 3300046518 Bacteria 6443
341 Ga0495631_0006052 3300046518 Bacteria 6285
342 Ga0495631_0013111 3300046518 Bacteria 4030
343 Ga0495631_0019928 3300046518 Bacteria 3139
344 Ga0495631_0020339 3300046518 Bacteria 3102
345 Ga0495632_0000072 3300046519 Bacteria 104826
346 Ga0495632_0000282 3300046519 Bacteria 49929
347 Ga0495632_0001880 3300046519 Bacteria 16833
348 Ga0495632_0010964 3300046519 Bacteria 5318
349 Ga0495637_0000013 3300046520 Bacteria 244837
350 Ga0495643_0000214 3300046522 Bacteria 88979
351 Ga0495643_0006429 3300046522 Bacteria 7750
352 Ga0495643_0012660 3300046522 Bacteria 5080
353 Ga0495643_0033957 3300046522 Bacteria 2817
354 Ga0495643_0052082 3300046522 Bacteria 2199
355 Ga0495644_0005362 3300046523 Bacteria 5007
356 Ga0495644_0007477 3300046523 Bacteria 4209
357 Ga0495644_0011080 3300046523 Bacteria 3475
358 Ga0495644_0017463 3300046523 Bacteria 2743
359 Ga0495644_0018554 3300046523 Bacteria 2658
360 Ga0495644_0031439 3300046523 Bacteria 2005
361 Ga0495648_0000079 3300046524 Bacteria 126099
362 Ga0495648_0003155 3300046524 Bacteria 14667
363 Ga0495648_0009819 3300046524 Bacteria 7360
364 Ga0495648_0015221 3300046524 Bacteria 5598
365 Ga0495648_0028041 3300046524 Bacteria 3756
366 Ga0495663_0010643 3300046525 Bacteria 2559
367 Ga0495666_0000216 3300046526 Bacteria 24551
368 Ga0495642_0000350 3300046528 Bacteria 25058
369 Ga0495642_0000737 3300046528 Bacteria 16247
370 Ga0495642_0003413 3300046528 Bacteria 6263
371 Ga0495642_0006944 3300046528 Bacteria 4344
372 Ga0495642_0010105 3300046528 Bacteria 3614
373 Ga0495642_0036183 3300046528 Bacteria 1994
374 Ga0495652_0009681 3300046529 Bacteria 8743
375 Ga0495652_0109584 3300046529 Bacteria 2222
376 Ga0495654_0012887 3300046530 Bacteria 4482
377 Ga0495665_0014496 3300046531 Bacteria 4253
378 Ga0495665_0022638 3300046531 Bacteria 3376
379 Ga0495640_0084150 3300046533 Bacteria 2110
380 Ga0495586_0001994 3300046535 Bacteria 11085
381 Ga0495587_0016915 3300046536 Bacteria 4536
382 Ga0495587_0035768 3300046536 Bacteria 2990
383 Ga0495598_0024234 3300046537 Bacteria 1643
384 Ga0495609_0000872 3300046538 Bacteria 22122
385 Ga0495609_0007047 3300046538 Bacteria 5660
386 Ga0495609_0008363 3300046538 Bacteria 5069
387 Ga0495621_0001763 3300046539 Bacteria 5674
388 Ga0495597_0000104 3300046542 Bacteria 75532
389 Ga0495597_0001550 3300046542 Bacteria 16266
390 Ga0495597_0006714 3300046542 Bacteria 5923
391 Ga0495645_0001746 3300046543 Bacteria 14773
392 Ga0495645_0015317 3300046543 Bacteria 5451
393 Ga0495645_0026428 3300046543 Bacteria 4213
394 Ga0495645_0064863 3300046543 Bacteria 2642
395 Ga0495633_0000927 3300046558 Bacteria 24800
396 Ga0495633_0001629 3300046558 Bacteria 16934
397 Ga0495633_0003058 3300046558 Bacteria 11383
398 Ga0495656_0000474 3300046615 Bacteria 13044
399 Ga0495656_0001023 3300046615 Bacteria 9055
400 Ga0495656_0050596 3300046615 Bacteria 1775
401 Ga0495668_0000131 3300046616 Bacteria 112755
402 Ga0495668_0007816 3300046616 Bacteria 6774
403 Ga0495668_0011802 3300046616 Bacteria 5209
404 Ga0495668_0023530 3300046616 Bacteria 3511
405 Ga0495668_0025766 3300046616 Bacteria 3339
406 Ga0495668_0038034 3300046616 Bacteria 2690
407 Ga0495668_0081558 3300046616 Bacteria 1774
408 Ga0495634_0002105 3300046642 Bacteria 16810
409 Ga0495634_0006888 3300046642 Bacteria 8593
410 Ga0495634_0038819 3300046642 Bacteria 3245
411 Ga0495611_0001643 3300046648 Bacteria 10844
412 Ga0495611_0002087 3300046648 Bacteria 9389
413 Ga0495611_0004224 3300046648 Bacteria 6252
414 Ga0495611_0015699 3300046648 Bacteria 3236
415 Ga0495611_0016374 3300046648 Bacteria 3169
416 Ga0495625_0010549 3300046660 Bacteria 7631
417 Ga0495625_0022398 3300046660 Bacteria 4844
418 Ga0495625_0083696 3300046660 Bacteria 2217
419 Ga0495635_0001886 3300046663 Bacteria 14227
420 Ga0495635_0004534 3300046663 Bacteria 9624
421 Ga0495661_0000756 3300046665 Bacteria 31283
422 Ga0495661_0003046 3300046665 Bacteria 12619
423 Ga0495661_0006970 3300046665 Bacteria 7902
424 Ga0495661_0007641 3300046665 Bacteria 7534
425 Ga0495661_0010872 3300046665 Bacteria 6189
426 Ga0495661_0024351 3300046665 Bacteria 3919
427 Ga0495661_0031932 3300046665 Bacteria 3333
428 Ga0495661_0040174 3300046665 Bacteria 2903
429 Ga0495661_0053464 3300046665 Bacteria 2428
430 Ga0495588_0005489 3300046674 Bacteria 5648
431 Ga0495588_0005770 3300046674 Bacteria 5532
432 Ga0495599_0001246 3300046678 Bacteria 14450
433 Ga0495599_0044474 3300046678 Bacteria 2785
434 Ga0495599_0113343 3300046678 Bacteria 1688
435 Ga0495646_0000807 3300046680 Bacteria 17525
436 Ga0495669_0000066 3300046684 Bacteria 69245
437 Ga0495669_0001842 3300046684 Bacteria 8685
438 Ga0495669_0003991 3300046684 Bacteria 6073
439 Ga0495669_0005284 3300046684 Bacteria 5378
440 Ga0495669_0008842 3300046684 Bacteria 4244
441 Ga0495669_0023383 3300046684 Bacteria 2690
442 Ga0495613_0001412 3300046689 Bacteria 18305
443 Ga0495613_0011187 3300046689 Bacteria 6665
444 Ga0495613_0020977 3300046689 Bacteria 4870
445 Ga0495613_0034042 3300046689 Bacteria 3784
446 Ga0495624_0045264 3300046690 Bacteria 2802
447 Ga0495670_0000298 3300046691 Bacteria 23404
448 Ga0495670_0000682 3300046691 Bacteria 16132
449 Ga0495670_0005032 3300046691 Bacteria 6502
450 Ga0495670_0015018 3300046691 Bacteria 3810
451 Ga0495670_0015825 3300046691 Bacteria 3706
452 Ga0495670_0021321 3300046691 Bacteria 3195
453 Ga0495671_0000454 3300046692 Bacteria 32199
454 Ga0495671_0006394 3300046692 Bacteria 6808
455 Ga0495671_0025924 3300046692 Bacteria 3043
456 Ga0495649_0000072 3300046694 Bacteria 86748
457 Ga0495649_0003857 3300046694 Bacteria 9931
458 Ga0495589_0000125 3300046794 Bacteria 71429
459 Ga0495589_0002031 3300046794 Bacteria 11454
460 Ga0495589_0011496 3300046794 Bacteria 4596
461 Ga0495589_0014198 3300046794 Bacteria 4105
462 Ga0495589_0028401 3300046794 Bacteria 2823
463 Ga0495600_0012996 3300046809 Bacteria 5221
464 Ga0495600_0055682 3300046809 Bacteria 2583
465 Ga0495660_0001565 3300046810 Bacteria 15370
466 Ga0495660_0003320 3300046810 Bacteria 9980
467 Ga0495660_0006341 3300046810 Bacteria 7010
468 Ga0495660_0013007 3300046810 Bacteria 4823
469 Ga0495660_0046405 3300046810 Bacteria 2382
470 Ga0495581_0000314 3300047315 Bacteria 23827
471 Ga0495581_0045026 3300047315 Bacteria 2551
472 Ga0495604_0005170 3300047317 Bacteria 10334
473 Ga0495604_0005914 3300047317 Bacteria 9706
474 Ga0495604_0016268 3300047317 Bacteria 5944
475 Ga0495604_0111373 3300047317 Bacteria 1995
476 Ga0495672_0000067 3300047320 Bacteria 190335
477 Ga0495672_0001701 3300047320 Bacteria 21332
478 Ga0495672_0002760 3300047320 Bacteria 15719
479 Ga0495676_0000015 3300047321 Bacteria 199492
480 Ga0495676_0000765 3300047321 Bacteria 26796
481 Ga0495676_0048428 3300047321 Bacteria 3427
482 Ga0495680_0004580 3300047322 Bacteria 13185
483 Ga0495680_0009705 3300047322 Bacteria 8639
484 Ga0495680_0012481 3300047322 Bacteria 7475
485 Ga0495680_0086731 3300047322 Bacteria 2355
486 Ga0495683_0000064 3300047323 Bacteria 112558
487 Ga0495683_0000524 3300047323 Bacteria 29227
488 Ga0495683_0003041 3300047323 Bacteria 9858
489 Ga0495683_0017975 3300047323 Bacteria 3659
490 Ga0495683_0050862 3300047323 Bacteria 2073
491 Ga0495687_000747 3300047443 Bacteria 35240
492 Ga0495687_001117 3300047443 Bacteria 26087
493 Ga0495675_0011639 3300047444 Bacteria 5524
494 Ga0495675_0013011 3300047444 Bacteria 5246
495 Ga0495675_0023164 3300047444 Bacteria 3958
496 Ga0495675_0029194 3300047444 Bacteria 3516
497 Ga0495675_0046859 3300047444 Bacteria 2751
498 Ga0495677_0000174 3300047445 Bacteria 30810
499 Ga0495677_0000368 3300047445 Bacteria 19415
500 Ga0495677_0002070 3300047445 Bacteria 7988
501 Ga0495677_0003901 3300047445 Bacteria 5768
502 Ga0495677_0004843 3300047445 Bacteria 5133
503 Ga0495677_0005893 3300047445 Bacteria 4642
504 Ga0495677_0008937 3300047445 Bacteria 3705
505 Ga0495677_0038184 3300047445 Bacteria 1755
506 Ga0495679_000682 3300047446 Bacteria 22270
507 Ga0495685_013466 3300047447 Bacteria 2777
508 Ga0495685_030591 3300047447 Bacteria 1851
509 Ga0495681_0000496 3300047470 Bacteria 30154
510 Ga0495681_0001742 3300047470 Bacteria 16087
511 Ga0495681_0001760 3300047470 Bacteria 15958
512 Ga0495681_0001973 3300047470 Bacteria 14989
513 Ga0495681_0004339 3300047470 Bacteria 9698
514 Ga0495681_0005050 3300047470 Bacteria 8898
515 Ga0495686_0000720 3300047472 Bacteria 44320
516 Ga0495686_0062196 3300047472 Bacteria 2316
517 Ga0495593_0000218 3300047673 Bacteria 30432
518 Ga0495593_0005534 3300047673 Bacteria 7459
519 Ga0495602_0011756 3300048088 Bacteria 9040
520 Ga0495602_0013710 3300048088 Bacteria 8267
521 Ga0495614_0007823 3300048089 Bacteria 4752
522 Ga0495614_0013696 3300048089 Bacteria 3557
523 Ga0495614_0014527 3300048089 Bacteria 3444
524 Ga0495615_0002092 3300048090 Bacteria 3127
525 Ga0495615_0008345 3300048090 Bacteria 1999
526 Ga0495626_0001955 3300048091 Bacteria 15315
527 Ga0495626_0002317 3300048091 Bacteria 13462
528 Ga0495626_0008550 3300048091 Bacteria 5600
529 Ga0495626_0015623 3300048091 Bacteria 3880
530 Ga0495626_0033282 3300048091 Bacteria 2472
531 Ga0496101_0005349 3300048904 Bacteria 8182
532 Ga0496101_0030212 3300048904 Bacteria 3797
533 Ga0496102_0000156 3300048905 Bacteria 92538
534 Ga0496102_0000406 3300048905 Bacteria 50075
535 Ga0496104_0074955 3300048907 Bacteria 3221
536 Ga0496105_0006971 3300048908 Bacteria 8707
537 Ga0496105_0030007 3300048908 Bacteria 4454
538 Ga0496105_0048359 3300048908 Bacteria 3511
539 Ga0496105_0155464 3300048908 Unclassified 1878
540 Ga0496106_0006601 3300048909 Bacteria 8590
541 Ga0496106_0006757 3300048909 Bacteria 8495
542 Ga0496107_0009276 3300048910 Bacteria 6822
543 Ga0496108_0077378 3300048911 Bacteria 2813
544 Ga0496109_0033799 3300048912 Unclassified 4602
545 Ga0496109_0211681 3300048912 Bacteria 1823
546 Ga0496110_0000022 3300048913 Bacteria 76181
547 Ga0496110_0024119 3300048913 Bacteria 5183
548 Ga0496110_0045828 3300048913 Bacteria 3823
549 Ga0496110_0156894 3300048913 Bacteria 2062
550 Ga0496111_0012903 3300048914 Bacteria 5668
551 Ga0496114_0020777 3300048917 Bacteria 5330
552 Ga0496114_0117627 3300048917 Bacteria 2283
553 Ga0496115_0011906 3300048918 Bacteria 6532
554 Ga0496115_0052748 3300048918 Bacteria 3263
555 Ga0496124_0057609 3300048927 Bacteria 3273
556 Ga0495678_000145 3300049459 Bacteria 86070
557 Ga0495678_000509 3300049459 Bacteria 37971
558 Ga0495678_000933 3300049459 Bacteria 25490
559 Ga0495678_002426 3300049459 Bacteria 12670
560 Ga0495678_005283 3300049459 Bacteria 7171
561 Ga0495682_0000305 3300049460 Bacteria 37379
562 Ga0495682_0036288 3300049460 Bacteria 1815
563 Ga0501033_0107297 3300049570 Bacteria 2034
564 Ga0501034_0000266 3300049571 Bacteria 94491
565 Ga0501039_0073072 3300049575 Bacteria 2665
566 Ga0501040_0036508 3300049576 Bacteria 3336
567 Ga0501046_0099502 3300049580 Bacteria 2232
568 Ga0501048_0018680 3300049582 Bacteria 5097
569 Ga0501072_0171971 3300049588 Bacteria 1729
570 Ga0501074_0058085 3300049590 Bacteria 2787
571 Ga0501075_0007685 3300049591 Bacteria 7483
572 Ga0501076_0023227 3300049592 Bacteria 4778
573 Ga0501076_0043850 3300049592 Unclassified 3527
574 Ga0501077_0019724 3300049593 Bacteria 4266
575 Ga0501079_0052420 3300049741 Bacteria 3148
576 Ga0501045_0006268 3300049824 Bacteria 8228
577 nmdc:mga09592_109932_c1 3300050508 Bacteria 2364
578 nmdc:mga09592_39691_c1 3300050508 Bacteria 3954
579 nmdc:mga09592_8039_c1 3300050508 Bacteria 7173
580 nmdc:mga0qj67_17971_c1 3300050509 Bacteria 5384
581 nmdc:mga06r32_43798_c1 3300050510 Bacteria 4259
582 nmdc:mga08y16_145332_c1 3300050511 Bacteria 2465
583 nmdc:mga08y16_230_c1 3300050511 Bacteria 50237
584 nmdc:mga08y16_41596_c1 3300050511 Bacteria 4814
585 nmdc:mga08y16_51094_c1 3300050511 Bacteria 4325
586 nmdc:mga0rr50_41834_c1 3300050513 Bacteria 3342
587 nmdc:mga0a205_2369_c1 3300050515 Bacteria 16612
588 Ga0495601_0003422 3300053077 Bacteria 9095
589 Ga0495619_0004411 3300053085 Bacteria 8980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0043850 Ga0501076_0043850_38_1207 344
2 3300046660 Ga0495625_0022398 Ga0495625_0022398_17_1315 412
3 3300005548 Ga0070665_100029055 Ga0070665_1000290553 418
4 3300028379 Ga0268266_10002212 Ga0268266_1000221217 418
5 3300049588 Ga0501072_0171971 Ga0501072_0171971_302_1711 424
6 3300006852 Ga0075433_10003532 Ga0075433_100035329 434
7 3300006871 Ga0075434_100002217 Ga0075434_1000022175 434
8 3300009094 Ga0111539_10012498 Ga0111539_1001249810 434
9 3300050511 nmdc:mga08y16_51094_c1 nmdc:mga08y16_51094_c1_1698_3296 434
10 3300050513 nmdc:mga0rr50_41834_c1 nmdc:mga0rr50_41834_c1_904_2502 434
11 3300050515 nmdc:mga0a205_2369_c1 nmdc:mga0a205_2369_c1_5741_7339 434
12 3300009094 Ga0111539_10137321 Ga0111539_101373212 439
13 3300050511 nmdc:mga08y16_41596_c1 nmdc:mga08y16_41596_c1_649_2217 439
14 3300006844 Ga0075428_100076077 Ga0075428_1000760772 442
15 3300006846 Ga0075430_100080046 Ga0075430_1000800462 442
16 3300006847 Ga0075431_100057422 Ga0075431_1000574223 442
17 3300050508 nmdc:mga09592_39691_c1 nmdc:mga09592_39691_c1_559_2154 442
18 3300050509 nmdc:mga0qj67_17971_c1 nmdc:mga0qj67_17971_c1_2975_4570 442
19 3300050510 nmdc:mga06r32_43798_c1 nmdc:mga06r32_43798_c1_354_1949 442
20 3300049580 Ga0501046_0099502 Ga0501046_0099502_17_1588 444
21 3300046474 Ga0495605_0026205 Ga0495605_0026205_23_1429 448
22 3300013308 Ga0157375_10140124 Ga0157375_101401243 449
23 3300049570 Ga0501033_0107297 Ga0501033_0107297_331_1920 450
24 3300049575 Ga0501039_0073072 Ga0501039_0073072_1052_2641 450
25 3300049576 Ga0501040_0036508 Ga0501040_0036508_1040_2629 450
26 3300049582 Ga0501048_0018680 Ga0501048_0018680_1510_3099 450
27 3300049590 Ga0501074_0058085 Ga0501074_0058085_582_2171 450
28 3300049591 Ga0501075_0007685 Ga0501075_0007685_5569_7158 450
29 3300049592 Ga0501076_0023227 Ga0501076_0023227_1086_2675 450
30 3300049593 Ga0501077_0019724 Ga0501077_0019724_1248_2837 450
31 3300049741 Ga0501079_0052420 Ga0501079_0052420_1151_2740 450
32 3300049824 Ga0501045_0006268 Ga0501045_0006268_1139_2728 450
33 3300049571 Ga0501034_0000266 Ga0501034_0000266_65463_67055 453
34 3300046459 Ga0495629_0084773 Ga0495629_0084773_539_2140 470
35 3300006846 Ga0075430_100026010 Ga0075430_1000260102 472
36 3300006880 Ga0075429_100052312 Ga0075429_1000523122 472
37 3300050508 nmdc:mga09592_8039_c1 nmdc:mga09592_8039_c1_1047_2630 472
38 3300025945 Ga0207679_10160800 Ga0207679_101608002 476
39 3300005347 Ga0070668_100019442 Ga0070668_1000194421 479
40 3300005354 Ga0070675_100012772 Ga0070675_1000127722 479
41 3300006028 Ga0070717_10095602 Ga0070717_100956022 479
42 3300006914 Ga0075436_100021961 Ga0075436_1000219613 479
43 3300025926 Ga0207659_10021656 Ga0207659_100216563 479
44 3300025972 Ga0207668_10033878 Ga0207668_100338782 479
45 3300046525 Ga0495663_0010643 Ga0495663_0010643_21_1610 479
46 3300046539 Ga0495621_0001763 Ga0495621_0001763_4036_5625 479
47 3300046615 Ga0495656_0001023 Ga0495656_0001023_1770_3359 479
48 3300048090 Ga0495615_0002092 Ga0495615_0002092_1008_2597 479
49 3300048913 Ga0496110_0156894 Ga0496110_0156894_318_1907 479
50 3300005331 Ga0070670_100000730 Ga0070670_1000007306 480
51 3300005340 Ga0070689_100130292 Ga0070689_1001302921 480
52 3300005543 Ga0070672_100005249 Ga0070672_1000052495 480
53 3300014325 Ga0163163_10169842 Ga0163163_101698422 480
54 3300025940 Ga0207691_10012188 Ga0207691_100121883 480
55 3300046537 Ga0495598_0024234 Ga0495598_0024234_23_1612 480
56 3300048911 Ga0496108_0077378 Ga0496108_0077378_521_2110 480
57 3300048914 Ga0496111_0012903 Ga0496111_0012903_3055_4644 480
58 3300009036 Ga0105244_10058193 Ga0105244_100581932 482
59 3300017792 Ga0163161_10019773 Ga0163161_100197733 482
60 3300025935 Ga0207709_10084267 Ga0207709_100842671 482
61 3300025940 Ga0207691_10042383 Ga0207691_100423833 482
62 3300025986 Ga0207658_10020714 Ga0207658_100207142 482
63 3300026142 Ga0207698_10122889 Ga0207698_101228892 482
64 3300031251 Ga0265327_10013875 Ga0265327_100138754 482
65 3300048907 Ga0496104_0074955 Ga0496104_0074955_384_1973 482
66 3300048909 Ga0496106_0006601 Ga0496106_0006601_3404_4993 482
67 3300025898 Ga0207692_10014209 Ga0207692_100142092 483
68 3300046474 Ga0495605_0057967 Ga0495605_0057967_93_1670 483
69 3300046491 Ga0495584_0051433 Ga0495584_0051433_357_1934 483
70 3300046500 Ga0495596_0026025 Ga0495596_0026025_106_1683 483
71 3300046507 Ga0495606_0058246 Ga0495606_0058246_13_1590 483
72 3300046513 Ga0495616_0034508 Ga0495616_0034508_372_1949 483
73 3300046518 Ga0495631_0019928 Ga0495631_0019928_1061_2638 483
74 3300046519 Ga0495632_0010964 Ga0495632_0010964_3659_5236 483
75 3300046522 Ga0495643_0052082 Ga0495643_0052082_143_1720 483
76 3300046528 Ga0495642_0036183 Ga0495642_0036183_205_1782 483
77 3300046616 Ga0495668_0025766 Ga0495668_0025766_1615_3192 483
78 3300046665 Ga0495661_0040174 Ga0495661_0040174_130_1707 483
79 3300046794 Ga0495589_0028401 Ga0495589_0028401_1138_2715 483
80 3300047445 Ga0495677_0008937 Ga0495677_0008937_2012_3589 483
81 3300047447 Ga0495685_013466 Ga0495685_013466_1027_2604 483
82 3300048091 Ga0495626_0033282 Ga0495626_0033282_66_1643 483
83 3300046462 Ga0495651_0070444 Ga0495651_0070444_979_2571 484
84 3300046516 Ga0495628_0116093 Ga0495628_0116093_194_1786 484
85 3300046642 Ga0495634_0038819 Ga0495634_0038819_74_1666 484
86 3300009094 Ga0111539_10183612 Ga0111539_101836122 485
87 3300046543 Ga0495645_0064863 Ga0495645_0064863_712_2304 485
88 3300046665 Ga0495661_0006970 Ga0495661_0006970_2053_3633 485
89 3300046678 Ga0495599_0113343 Ga0495599_0113343_43_1632 485
90 3300046691 Ga0495670_0021321 Ga0495670_0021321_1305_2885 485
91 3300046809 Ga0495600_0055682 Ga0495600_0055682_192_1781 485
92 3300005335 Ga0070666_10030003 Ga0070666_100300032 488
93 3300005548 Ga0070665_100012610 Ga0070665_1000126105 488
94 3300005841 Ga0068863_100024876 Ga0068863_1000248763 488
95 3300009177 Ga0105248_10060452 Ga0105248_100604522 488
96 3300025903 Ga0207680_10046954 Ga0207680_100469542 488
97 3300026095 Ga0207676_10027569 Ga0207676_100275693 488
98 3300026121 Ga0207683_10131747 Ga0207683_101317472 488
99 3300028379 Ga0268266_10018190 Ga0268266_100181903 488
100 3300050511 nmdc:mga08y16_145332_c1 nmdc:mga08y16_145332_c1_284_1870 489
101 iso_pu_bacteria 2842324504 2842328464 490
102 iso_pu_bacteria 2842348783 2842352780 490
103 iso_pu_bacteria 2842454564 2842459682 490
104 3300026121 Ga0207683_10075410 Ga0207683_100754102 491
105 3300025941 Ga0207711_10085497 Ga0207711_100854972 492
106 3300009177 Ga0105248_10031974 Ga0105248_100319742 493
107 3300013306 Ga0163162_10006426 Ga0163162_100064269 493
108 3300025321 Ga0207656_10025763 Ga0207656_100257632 493
109 3300046678 Ga0495599_0044474 Ga0495599_0044474_1226_2770 494
110 3300005518 Ga0070699_100002930 Ga0070699_1000029301 495
111 3300005983 Ga0081540_1000492 Ga0081540_10004923 495
112 3300046455 Ga0495603_0015864 Ga0495603_0015864_1520_3067 496
113 3300046458 Ga0495591_026479 Ga0495591_026479_81_1628 496
114 3300046459 Ga0495629_0000669 Ga0495629_0000669_25225_26772 496
115 3300046463 Ga0495653_0040502 Ga0495653_0040502_1184_2731 496
116 3300046471 Ga0495650_0001961 Ga0495650_0001961_6103_7650 496
117 3300046472 Ga0495580_0003840 Ga0495580_0003840_375_1922 496
118 3300046473 Ga0495582_0038725 Ga0495582_0038725_117_1664 496
119 3300046501 Ga0495607_0088452 Ga0495607_0088452_63_1610 496
120 3300046506 Ga0495583_0046629 Ga0495583_0046629_195_1742 496
121 3300046528 Ga0495642_0010105 Ga0495642_0010105_1833_3380 496
122 3300046531 Ga0495665_0014496 Ga0495665_0014496_312_1859 496
123 3300046543 Ga0495645_0001746 Ga0495645_0001746_11023_12570 496
124 3300046684 Ga0495669_0008842 Ga0495669_0008842_1134_2681 496
125 3300046689 Ga0495613_0020977 Ga0495613_0020977_980_2527 496
126 3300047315 Ga0495581_0045026 Ga0495581_0045026_274_1821 496
127 3300047444 Ga0495675_0011639 Ga0495675_0011639_3036_4583 496
128 3300048904 Ga0496101_0030212 Ga0496101_0030212_44_1591 496
129 3300048908 Ga0496105_0030007 Ga0496105_0030007_2731_4278 496
130 3300048917 Ga0496114_0020777 Ga0496114_0020777_1098_2645 496
131 3300005434 Ga0070709_10016097 Ga0070709_100160972 497
132 3300005437 Ga0070710_10017982 Ga0070710_100179823 497
133 3300005466 Ga0070685_10036123 Ga0070685_100361232 498
134 3300009094 Ga0111539_10025743 Ga0111539_100257434 498
135 3300025933 Ga0207706_10120180 Ga0207706_101201802 498
136 3300005364 Ga0070673_100142607 Ga0070673_1001426072 499
137 3300025926 Ga0207659_10007620 Ga0207659_100076202 499
138 3300025960 Ga0207651_10008542 Ga0207651_100085424 499
139 3300046492 Ga0495585_0000055 Ga0495585_0000055_30865_32445 500
140 3300005338 Ga0068868_100037133 Ga0068868_1000371333 501
141 3300005340 Ga0070689_100058146 Ga0070689_1000581462 501
142 3300005616 Ga0068852_100054476 Ga0068852_1000544762 501
143 3300005617 Ga0068859_100001008 Ga0068859_10000100810 501
144 3300005618 Ga0068864_100000384 Ga0068864_10000038413 501
145 3300005841 Ga0068863_100012505 Ga0068863_1000125052 501
146 3300005842 Ga0068858_100000234 Ga0068858_10000023416 501
147 3300006931 Ga0097620_100001008 Ga0097620_10000100810 501
148 3300013296 Ga0157374_10015127 Ga0157374_100151275 501
149 3300014325 Ga0163163_10002813 Ga0163163_1000281315 501
150 3300014968 Ga0157379_10005372 Ga0157379_100053723 501
151 3300025925 Ga0207650_10040766 Ga0207650_100407662 501
152 3300025926 Ga0207659_10001378 Ga0207659_100013784 501
153 3300025931 Ga0207644_10001780 Ga0207644_1000178011 501
154 3300025936 Ga0207670_10010504 Ga0207670_100105044 501
155 3300025986 Ga0207658_10003196 Ga0207658_100031969 501
156 3300026023 Ga0207677_10002717 Ga0207677_100027176 501
157 3300026035 Ga0207703_10001027 Ga0207703_100010275 501
158 3300026088 Ga0207641_10000754 Ga0207641_1000075417 501
159 3300026089 Ga0207648_10047278 Ga0207648_100472782 501
160 3300026095 Ga0207676_10000181 Ga0207676_1000018133 501
161 3300026142 Ga0207698_10016361 Ga0207698_100163613 501
162 3300028379 Ga0268266_10039474 Ga0268266_100394742 501
163 3300046524 Ga0495648_0028041 Ga0495648_0028041_590_2155 501
164 3300046691 Ga0495670_0015018 Ga0495670_0015018_1631_3196 501
165 3300046794 Ga0495589_0011496 Ga0495589_0011496_3012_4583 501
166 3300047447 Ga0495685_030591 Ga0495685_030591_31_1596 501
167 3300048912 Ga0496109_0211681 Ga0496109_0211681_179_1768 501
168 3300046514 Ga0495618_0025165 Ga0495618_0025165_772_2358 502
169 3300046517 Ga0495630_0020028 Ga0495630_0020028_1535_3121 502
170 3300005333 Ga0070677_10042225 Ga0070677_100422252 503
171 3300006038 Ga0075365_10037756 Ga0075365_100377562 503
172 3300025893 Ga0207682_10004587 Ga0207682_100045876 503
173 3300026121 Ga0207683_10005185 Ga0207683_100051852 503
174 3300046507 Ga0495606_0005149 Ga0495606_0005149_3660_5246 503
175 3300046694 Ga0495649_0003857 Ga0495649_0003857_4328_5914 503
176 3300046794 Ga0495589_0014198 Ga0495589_0014198_262_1848 503
177 3300047323 Ga0495683_0003041 Ga0495683_0003041_3525_5111 503
178 3300005295 Ga0065707_10125147 Ga0065707_101251472 504
179 3300005331 Ga0070670_100004325 Ga0070670_1000043255 504
180 3300005543 Ga0070672_100017996 Ga0070672_1000179962 504
181 3300005564 Ga0070664_100049941 Ga0070664_1000499412 504
182 3300006847 Ga0075431_100163772 Ga0075431_1001637722 504
183 3300025933 Ga0207706_10046161 Ga0207706_100461612 504
184 3300025940 Ga0207691_10070150 Ga0207691_100701503 504
185 3300026118 Ga0207675_100171844 Ga0207675_1001718442 504
186 3300026121 Ga0207683_10043070 Ga0207683_100430702 504
187 3300046459 Ga0495629_0002027 Ga0495629_0002027_11213_12793 504
188 3300046461 Ga0495641_0008733 Ga0495641_0008733_1018_2598 504
189 3300046463 Ga0495653_0002367 Ga0495653_0002367_6984_8564 504
190 3300046472 Ga0495580_0000475 Ga0495580_0000475_14205_15785 504
191 3300046473 Ga0495582_0000269 Ga0495582_0000269_7737_9317 504
192 3300046477 Ga0495664_0000345 Ga0495664_0000345_15429_17009 504
193 3300046514 Ga0495618_0114998 Ga0495618_0114998_58_1638 504
194 3300046516 Ga0495628_0005758 Ga0495628_0005758_7011_8591 504
195 3300046517 Ga0495630_0093349 Ga0495630_0093349_516_2096 504
196 3300046522 Ga0495643_0000214 Ga0495643_0000214_20163_21749 504
197 3300046524 Ga0495648_0015221 Ga0495648_0015221_3954_5534 504
198 3300046526 Ga0495666_0000216 Ga0495666_0000216_17038_18618 504
199 3300046529 Ga0495652_0109584 Ga0495652_0109584_512_2092 504
200 3300046533 Ga0495640_0084150 Ga0495640_0084150_104_1684 504
201 3300046536 Ga0495587_0035768 Ga0495587_0035768_269_1849 504
202 3300046543 Ga0495645_0015317 Ga0495645_0015317_3232_4812 504
203 3300046642 Ga0495634_0006888 Ga0495634_0006888_517_2097 504
204 3300046663 Ga0495635_0004534 Ga0495635_0004534_95_1675 504
205 3300046665 Ga0495661_0003046 Ga0495661_0003046_10891_12471 504
206 3300046678 Ga0495599_0001246 Ga0495599_0001246_2918_4498 504
207 3300046680 Ga0495646_0000807 Ga0495646_0000807_13679_15259 504
208 3300046689 Ga0495613_0001412 Ga0495613_0001412_13808_15388 504
209 3300046690 Ga0495624_0045264 Ga0495624_0045264_711_2291 504
210 3300047315 Ga0495581_0000314 Ga0495581_0000314_16314_17894 504
211 3300047317 Ga0495604_0005914 Ga0495604_0005914_3195_4775 504
212 3300047321 Ga0495676_0000765 Ga0495676_0000765_6205_7785 504
213 3300047322 Ga0495680_0004580 Ga0495680_0004580_895_2475 504
214 3300047444 Ga0495675_0023164 Ga0495675_0023164_1972_3552 504
215 3300047446 Ga0495679_000682 Ga0495679_000682_2919_4499 504
216 3300047673 Ga0495593_0000218 Ga0495593_0000218_17649_19229 504
217 3300048088 Ga0495602_0011756 Ga0495602_0011756_711_2291 504
218 3300048089 Ga0495614_0007823 Ga0495614_0007823_3042_4622 504
219 iso_pu_bacteria 2786546517 2787435722 504
220 iso_pu_bacteria 2842333319 2842337733 504
221 3300006881 Ga0068865_100068075 Ga0068865_1000680752 505
222 3300025908 Ga0207643_10075610 Ga0207643_100756101 505
223 3300047321 Ga0495676_0048428 Ga0495676_0048428_277_1857 505
224 3300048908 Ga0496105_0006971 Ga0496105_0006971_1536_3125 505
225 3300048908 Ga0496105_0048359 Ga0496105_0048359_1492_3078 505
226 3300005331 Ga0070670_100045457 Ga0070670_1000454572 506
227 3300005344 Ga0070661_100061060 Ga0070661_1000610603 506
228 3300005367 Ga0070667_100019267 Ga0070667_1000192671 506
229 3300005543 Ga0070672_100048358 Ga0070672_1000483583 506
230 3300005937 Ga0081455_10086795 Ga0081455_100867952 506
231 3300005985 Ga0081539_10025390 Ga0081539_100253902 506
232 3300006237 Ga0097621_100021189 Ga0097621_1000211895 506
233 3300013306 Ga0163162_10123225 Ga0163162_101232251 506
234 3300013306 Ga0163162_10142162 Ga0163162_101421621 506
235 3300025315 Ga0207697_10005006 Ga0207697_100050066 506
236 3300025901 Ga0207688_10056438 Ga0207688_100564382 506
237 3300025926 Ga0207659_10040552 Ga0207659_100405522 506
238 3300025931 Ga0207644_10005044 Ga0207644_100050442 506
239 3300025940 Ga0207691_10014808 Ga0207691_100148081 506
240 3300026089 Ga0207648_10018499 Ga0207648_100184992 506
241 3300046452 Ga0495617_000571 Ga0495617_000571_9405_10985 506
242 3300046457 Ga0495590_0003028 Ga0495590_0003028_131_1711 506
243 3300046458 Ga0495591_000216 Ga0495591_000216_42524_44104 506
244 3300046460 Ga0495638_0061284 Ga0495638_0061284_551_2131 506
245 3300046471 Ga0495650_0001000 Ga0495650_0001000_17483_19063 506
246 3300046474 Ga0495605_0004384 Ga0495605_0004384_1322_2902 506
247 3300046474 Ga0495605_0016914 Ga0495605_0016914_327_1904 506
248 3300046491 Ga0495584_0000244 Ga0495584_0000244_16269_17849 506
249 3300046491 Ga0495584_0001001 Ga0495584_0001001_15994_17574 506
250 3300046491 Ga0495584_0001247 Ga0495584_0001247_1615_3195 506
251 3300046491 Ga0495584_0002878 Ga0495584_0002878_4437_6014 506
252 3300046491 Ga0495584_0030125 Ga0495584_0030125_696_2276 506
253 3300046492 Ga0495585_0000260 Ga0495585_0000260_31800_33380 506
254 3300046492 Ga0495585_0000502 Ga0495585_0000502_10790_12370 506
255 3300046492 Ga0495585_0000970 Ga0495585_0000970_1610_3190 506
256 3300046492 Ga0495585_0002060 Ga0495585_0002060_2222_3802 506
257 3300046492 Ga0495585_0008727 Ga0495585_0008727_301_1878 506
258 3300046492 Ga0495585_0026500 Ga0495585_0026500_574_2154 506
259 3300046499 Ga0495594_0016255 Ga0495594_0016255_2172_3752 506
260 3300046500 Ga0495596_0000099 Ga0495596_0000099_19528_21108 506
261 3300046500 Ga0495596_0001079 Ga0495596_0001079_2997_4577 506
262 3300046500 Ga0495596_0004937 Ga0495596_0004937_1977_3557 506
263 3300046501 Ga0495607_0019168 Ga0495607_0019168_735_2315 506
264 3300046501 Ga0495607_0020183 Ga0495607_0020183_2505_4085 506
265 3300046501 Ga0495607_0057156 Ga0495607_0057156_207_1784 506
266 3300046506 Ga0495583_0000064 Ga0495583_0000064_135339_136919 506
267 3300046506 Ga0495583_0001300 Ga0495583_0001300_23653_25233 506
268 3300046507 Ga0495606_0049988 Ga0495606_0049988_836_2401 506
269 3300046512 Ga0495610_0000706 Ga0495610_0000706_4675_6255 506
270 3300046512 Ga0495610_0037016 Ga0495610_0037016_103_1683 506
271 3300046513 Ga0495616_0001224 Ga0495616_0001224_14123_15703 506
272 3300046513 Ga0495616_0001991 Ga0495616_0001991_5859_7439 506
273 3300046513 Ga0495616_0006213 Ga0495616_0006213_42_1622 506
274 3300046513 Ga0495616_0013649 Ga0495616_0013649_2237_3817 506
275 3300046513 Ga0495616_0041933 Ga0495616_0041933_191_1771 506
276 3300046515 Ga0495620_0001927 Ga0495620_0001927_4906_6486 506
277 3300046518 Ga0495631_0001182 Ga0495631_0001182_13611_15191 506
278 3300046518 Ga0495631_0003034 Ga0495631_0003034_6035_7615 506
279 3300046518 Ga0495631_0013111 Ga0495631_0013111_550_2127 506
280 3300046518 Ga0495631_0020339 Ga0495631_0020339_462_2042 506
281 3300046519 Ga0495632_0000072 Ga0495632_0000072_67143_68726 506
282 3300046520 Ga0495637_0000013 Ga0495637_0000013_100385_101965 506
283 3300046522 Ga0495643_0012660 Ga0495643_0012660_2353_3933 506
284 3300046522 Ga0495643_0033957 Ga0495643_0033957_121_1698 506
285 3300046523 Ga0495644_0011080 Ga0495644_0011080_549_2126 506
286 3300046523 Ga0495644_0017463 Ga0495644_0017463_1152_2732 506
287 3300046523 Ga0495644_0031439 Ga0495644_0031439_132_1712 506
288 3300046524 Ga0495648_0000079 Ga0495648_0000079_103731_105311 506
289 3300046524 Ga0495648_0003155 Ga0495648_0003155_5875_7455 506
290 3300046524 Ga0495648_0009819 Ga0495648_0009819_599_2179 506
291 3300046528 Ga0495642_0000737 Ga0495642_0000737_1862_3442 506
292 3300046528 Ga0495642_0003413 Ga0495642_0003413_3742_5319 506
293 3300046535 Ga0495586_0001994 Ga0495586_0001994_5741_7321 506
294 3300046538 Ga0495609_0000872 Ga0495609_0000872_12103_13683 506
295 3300046538 Ga0495609_0007047 Ga0495609_0007047_2198_3778 506
296 3300046538 Ga0495609_0008363 Ga0495609_0008363_191_1771 506
297 3300046542 Ga0495597_0001550 Ga0495597_0001550_1614_3194 506
298 3300046542 Ga0495597_0006714 Ga0495597_0006714_303_1880 506
299 3300046558 Ga0495633_0000927 Ga0495633_0000927_9369_10949 506
300 3300046558 Ga0495633_0001629 Ga0495633_0001629_1131_2711 506
301 3300046558 Ga0495633_0003058 Ga0495633_0003058_1084_2664 506
302 3300046615 Ga0495656_0000474 Ga0495656_0000474_4484_6061 506
303 3300046616 Ga0495668_0007816 Ga0495668_0007816_1332_2909 506
304 3300046616 Ga0495668_0011802 Ga0495668_0011802_1772_3352 506
305 3300046616 Ga0495668_0023530 Ga0495668_0023530_199_1779 506
306 3300046616 Ga0495668_0081558 Ga0495668_0081558_50_1627 506
307 3300046648 Ga0495611_0001643 Ga0495611_0001643_5660_7237 506
308 3300046648 Ga0495611_0002087 Ga0495611_0002087_7678_9258 506
309 3300046648 Ga0495611_0015699 Ga0495611_0015699_1503_3083 506
310 3300046648 Ga0495611_0016374 Ga0495611_0016374_248_1825 506
311 3300046660 Ga0495625_0083696 Ga0495625_0083696_615_2195 506
312 3300046663 Ga0495635_0001886 Ga0495635_0001886_9891_11471 506
313 3300046665 Ga0495661_0000756 Ga0495661_0000756_28062_29642 506
314 3300046665 Ga0495661_0007641 Ga0495661_0007641_119_1699 506
315 3300046665 Ga0495661_0010872 Ga0495661_0010872_1880_3460 506
316 3300046665 Ga0495661_0024351 Ga0495661_0024351_801_2384 506
317 3300046665 Ga0495661_0031932 Ga0495661_0031932_1637_3214 506
318 3300046665 Ga0495661_0053464 Ga0495661_0053464_579_2159 506
319 3300046689 Ga0495613_0011187 Ga0495613_0011187_3051_4631 506
320 3300046691 Ga0495670_0000298 Ga0495670_0000298_13742_15322 506
321 3300046691 Ga0495670_0000682 Ga0495670_0000682_1200_2780 506
322 3300046691 Ga0495670_0005032 Ga0495670_0005032_2901_4481 506
323 3300046691 Ga0495670_0015825 Ga0495670_0015825_1257_2837 506
324 3300046694 Ga0495649_0000072 Ga0495649_0000072_59447_61027 506
325 3300046794 Ga0495589_0002031 Ga0495589_0002031_3436_5016 506
326 3300046810 Ga0495660_0013007 Ga0495660_0013007_1641_3221 506
327 3300046810 Ga0495660_0046405 Ga0495660_0046405_573_2222 506
328 3300047317 Ga0495604_0016268 Ga0495604_0016268_603_2183 506
329 3300047320 Ga0495672_0000067 Ga0495672_0000067_57140_58720 506
330 3300047320 Ga0495672_0001701 Ga0495672_0001701_13141_14721 506
331 3300047320 Ga0495672_0002760 Ga0495672_0002760_7775_9361 506
332 3300047322 Ga0495680_0009705 Ga0495680_0009705_156_1736 506
333 3300047323 Ga0495683_0000064 Ga0495683_0000064_13109_14689 506
334 3300047323 Ga0495683_0000524 Ga0495683_0000524_1678_3258 506
335 3300047323 Ga0495683_0017975 Ga0495683_0017975_841_2421 506
336 3300047323 Ga0495683_0050862 Ga0495683_0050862_31_1611 506
337 3300047445 Ga0495677_0002070 Ga0495677_0002070_131_1711 506
338 3300047445 Ga0495677_0004843 Ga0495677_0004843_1503_3080 506
339 3300047445 Ga0495677_0005893 Ga0495677_0005893_1116_2696 506
340 3300047445 Ga0495677_0038184 Ga0495677_0038184_146_1723 506
341 3300047470 Ga0495681_0001742 Ga0495681_0001742_579_2159 506
342 3300047470 Ga0495681_0001973 Ga0495681_0001973_112_1689 506
343 3300047470 Ga0495681_0005050 Ga0495681_0005050_4814_6394 506
344 3300047472 Ga0495686_0000720 Ga0495686_0000720_20800_22380 506
345 3300047673 Ga0495593_0005534 Ga0495593_0005534_2263_3843 506
346 3300048089 Ga0495614_0013696 Ga0495614_0013696_537_2117 506
347 3300048090 Ga0495615_0008345 Ga0495615_0008345_140_1717 506
348 3300048091 Ga0495626_0001955 Ga0495626_0001955_1151_2731 506
349 3300048905 Ga0496102_0000406 Ga0496102_0000406_20740_22320 506
350 3300048913 Ga0496110_0045828 Ga0496110_0045828_660_2240 506
351 3300049459 Ga0495678_000145 Ga0495678_000145_63895_65475 506
352 3300049459 Ga0495678_000509 Ga0495678_000509_7385_8965 506
353 3300049460 Ga0495682_0000305 Ga0495682_0000305_28583_30163 506
354 3300049460 Ga0495682_0036288 Ga0495682_0036288_218_1798 506
355 3300005334 Ga0068869_100158305 Ga0068869_1001583051 507
356 3300005457 Ga0070662_100030755 Ga0070662_1000307552 507
357 3300005719 Ga0068861_100042093 Ga0068861_1000420933 507
358 3300005842 Ga0068858_100012170 Ga0068858_1000121703 507
359 3300009094 Ga0111539_10121175 Ga0111539_101211752 507
360 3300014326 Ga0157380_10030646 Ga0157380_100306462 507
361 3300014326 Ga0157380_10108883 Ga0157380_101088832 507
362 3300025315 Ga0207697_10004731 Ga0207697_100047313 507
363 3300025901 Ga0207688_10002701 Ga0207688_100027012 507
364 3300025901 Ga0207688_10064800 Ga0207688_100648002 507
365 3300025918 Ga0207662_10011254 Ga0207662_100112543 507
366 3300025933 Ga0207706_10042474 Ga0207706_100424741 507
367 3300026023 Ga0207677_10033772 Ga0207677_100337722 507
368 3300026035 Ga0207703_10040203 Ga0207703_100402032 507
369 3300026118 Ga0207675_100049917 Ga0207675_1000499173 507
370 3300028379 Ga0268266_10221093 Ga0268266_102210931 507
371 3300031548 Ga0307408_100002086 Ga0307408_1000020867 507
372 3300031911 Ga0307412_10047205 Ga0307412_100472052 507
373 3300046452 Ga0495617_000026 Ga0495617_000026_42713_44302 507
374 3300046453 Ga0495627_000043 Ga0495627_000043_20670_22259 507
375 3300046455 Ga0495603_0008841 Ga0495603_0008841_1375_2964 507
376 3300046457 Ga0495590_0000291 Ga0495590_0000291_10006_11589 507
377 3300046457 Ga0495590_0001299 Ga0495590_0001299_2177_3760 507
378 3300046463 Ga0495653_0006078 Ga0495653_0006078_3274_4860 507
379 3300046463 Ga0495653_0047901 Ga0495653_0047901_1204_2787 507
380 3300046473 Ga0495582_0000753 Ga0495582_0000753_12303_13886 507
381 3300046473 Ga0495582_0007203 Ga0495582_0007203_1607_3190 507
382 3300046474 Ga0495605_0000454 Ga0495605_0000454_25766_27355 507
383 3300046474 Ga0495605_0021763 Ga0495605_0021763_457_2040 507
384 3300046491 Ga0495584_0007887 Ga0495584_0007887_1218_2801 507
385 3300046491 Ga0495584_0010021 Ga0495584_0010021_1410_2999 507
386 3300046499 Ga0495594_0014350 Ga0495594_0014350_387_1976 507
387 3300046499 Ga0495594_0028538 Ga0495594_0028538_243_1826 507
388 3300046500 Ga0495596_0001013 Ga0495596_0001013_8026_9609 507
389 3300046500 Ga0495596_0003145 Ga0495596_0003145_5255_6838 507
390 3300046500 Ga0495596_0010779 Ga0495596_0010779_1816_3399 507
391 3300046501 Ga0495607_0038939 Ga0495607_0038939_762_2345 507
392 3300046506 Ga0495583_0000999 Ga0495583_0000999_4306_5889 507
393 3300046506 Ga0495583_0001425 Ga0495583_0001425_1797_3380 507
394 3300046506 Ga0495583_0008408 Ga0495583_0008408_4067_5650 507
395 3300046507 Ga0495606_0006453 Ga0495606_0006453_3498_5081 507
396 3300046513 Ga0495616_0000537 Ga0495616_0000537_4598_6187 507
397 3300046513 Ga0495616_0001703 Ga0495616_0001703_1318_2907 507
398 3300046513 Ga0495616_0006254 Ga0495616_0006254_5436_7019 507
399 3300046517 Ga0495630_0007745 Ga0495630_0007745_658_2241 507
400 3300046518 Ga0495631_0002817 Ga0495631_0002817_7376_8959 507
401 3300046518 Ga0495631_0002837 Ga0495631_0002837_3451_5040 507
402 3300046518 Ga0495631_0005795 Ga0495631_0005795_4290_5873 507
403 3300046518 Ga0495631_0006052 Ga0495631_0006052_2808_4397 507
404 3300046519 Ga0495632_0000282 Ga0495632_0000282_24623_26212 507
405 3300046519 Ga0495632_0001880 Ga0495632_0001880_9108_10691 507
406 3300046523 Ga0495644_0005362 Ga0495644_0005362_2684_4267 507
407 3300046523 Ga0495644_0007477 Ga0495644_0007477_1382_2971 507
408 3300046523 Ga0495644_0018554 Ga0495644_0018554_24_1607 507
409 3300046528 Ga0495642_0000350 Ga0495642_0000350_20690_22279 507
410 3300046528 Ga0495642_0006944 Ga0495642_0006944_1760_3343 507
411 3300046529 Ga0495652_0009681 Ga0495652_0009681_3572_5155 507
412 3300046530 Ga0495654_0012887 Ga0495654_0012887_455_2038 507
413 3300046531 Ga0495665_0022638 Ga0495665_0022638_1336_2919 507
414 3300046536 Ga0495587_0016915 Ga0495587_0016915_931_2514 507
415 3300046542 Ga0495597_0000104 Ga0495597_0000104_58044_59633 507
416 3300046616 Ga0495668_0000131 Ga0495668_0000131_8455_10038 507
417 3300046616 Ga0495668_0038034 Ga0495668_0038034_816_2399 507
418 3300046642 Ga0495634_0002105 Ga0495634_0002105_7544_9127 507
419 3300046648 Ga0495611_0004224 Ga0495611_0004224_2156_3739 507
420 3300046660 Ga0495625_0010549 Ga0495625_0010549_5155_6738 507
421 3300046674 Ga0495588_0005489 Ga0495588_0005489_3343_4932 507
422 3300046674 Ga0495588_0005770 Ga0495588_0005770_3080_4669 507
423 3300046684 Ga0495669_0000066 Ga0495669_0000066_31310_32893 507
424 3300046684 Ga0495669_0001842 Ga0495669_0001842_1512_3101 507
425 3300046684 Ga0495669_0003991 Ga0495669_0003991_1706_3289 507
426 3300046684 Ga0495669_0005284 Ga0495669_0005284_1038_2627 507
427 3300046684 Ga0495669_0023383 Ga0495669_0023383_683_2266 507
428 3300046689 Ga0495613_0034042 Ga0495613_0034042_578_2161 507
429 3300046692 Ga0495671_0000454 Ga0495671_0000454_7605_9194 507
430 3300046692 Ga0495671_0006394 Ga0495671_0006394_277_1860 507
431 3300046692 Ga0495671_0025924 Ga0495671_0025924_1220_2803 507
432 3300046794 Ga0495589_0000125 Ga0495589_0000125_56500_58083 507
433 3300046809 Ga0495600_0012996 Ga0495600_0012996_1384_2967 507
434 3300046810 Ga0495660_0001565 Ga0495660_0001565_2871_4454 507
435 3300046810 Ga0495660_0003320 Ga0495660_0003320_946_2529 507
436 3300046810 Ga0495660_0006341 Ga0495660_0006341_386_1969 507
437 3300047317 Ga0495604_0005170 Ga0495604_0005170_8486_10069 507
438 3300047321 Ga0495676_0000015 Ga0495676_0000015_80250_81833 507
439 3300047322 Ga0495680_0012481 Ga0495680_0012481_5257_6840 507
440 3300047443 Ga0495687_000747 Ga0495687_000747_7154_8737 507
441 3300047443 Ga0495687_001117 Ga0495687_001117_15867_17450 507
442 3300047444 Ga0495675_0013011 Ga0495675_0013011_783_2366 507
443 3300047444 Ga0495675_0029194 Ga0495675_0029194_607_2190 507
444 3300047445 Ga0495677_0000174 Ga0495677_0000174_24933_26516 507
445 3300047445 Ga0495677_0000368 Ga0495677_0000368_5410_6999 507
446 3300047445 Ga0495677_0003901 Ga0495677_0003901_1514_3097 507
447 3300047470 Ga0495681_0000496 Ga0495681_0000496_21465_23048 507
448 3300047470 Ga0495681_0001760 Ga0495681_0001760_9690_11273 507
449 3300047470 Ga0495681_0004339 Ga0495681_0004339_4864_6447 507
450 3300047472 Ga0495686_0062196 Ga0495686_0062196_693_2282 507
451 3300048088 Ga0495602_0013710 Ga0495602_0013710_6309_7892 507
452 3300048089 Ga0495614_0014527 Ga0495614_0014527_236_1819 507
453 3300048091 Ga0495626_0002317 Ga0495626_0002317_4709_6292 507
454 3300048091 Ga0495626_0008550 Ga0495626_0008550_391_1974 507
455 3300048091 Ga0495626_0015623 Ga0495626_0015623_1779_3362 507
456 3300048905 Ga0496102_0000156 Ga0496102_0000156_27595_29184 507
457 3300048913 Ga0496110_0000022 Ga0496110_0000022_17783_19366 507
458 3300048918 Ga0496115_0011906 Ga0496115_0011906_2331_3914 507
459 3300048918 Ga0496115_0052748 Ga0496115_0052748_450_2033 507
460 3300048927 Ga0496124_0057609 Ga0496124_0057609_1390_2979 507
461 3300049459 Ga0495678_000933 Ga0495678_000933_7345_8928 507
462 3300049459 Ga0495678_002426 Ga0495678_002426_3731_5314 507
463 3300049459 Ga0495678_005283 Ga0495678_005283_5311_6894 507
464 3300005615 Ga0070702_100009492 Ga0070702_1000094923 508
465 3300009094 Ga0111539_10233948 Ga0111539_102339482 508
466 3300032002 Ga0307416_100211339 Ga0307416_1002113391 508
467 3300036401 Ga0373937_0032625 Ga0373937_0032625_1878_3461 508
468 3300050508 nmdc:mga09592_109932_c1 nmdc:mga09592_109932_c1_508_2091 508
469 3300002076 JGI24749J21850_1000508 JGI24749J21850_10005082 509
470 3300002705 JGI25156J39149_1000371 JGI25156J39149_10003714 509
471 3300003320 rootH2_10033949 rootH2_100339492 509
472 3300003323 rootH1_10261471 rootH1_102614711 509
473 3300005293 Ga0065715_10153671 Ga0065715_101536711 509
474 3300005329 Ga0070683_100019096 Ga0070683_1000190962 509
475 3300005331 Ga0070670_100010331 Ga0070670_1000103313 509
476 3300005334 Ga0068869_100006879 Ga0068869_1000068795 509
477 3300005339 Ga0070660_100032773 Ga0070660_1000327733 509
478 3300005344 Ga0070661_100008055 Ga0070661_1000080555 509
479 3300005347 Ga0070668_100000374 Ga0070668_1000003746 509
480 3300005347 Ga0070668_100000747 Ga0070668_1000007474 509
481 3300005347 Ga0070668_100032315 Ga0070668_1000323152 509
482 3300005355 Ga0070671_100059064 Ga0070671_1000590642 509
483 3300005356 Ga0070674_100067853 Ga0070674_1000678531 509
484 3300005364 Ga0070673_100084718 Ga0070673_1000847183 509
485 3300005367 Ga0070667_100011871 Ga0070667_1000118713 509
486 3300005438 Ga0070701_10020669 Ga0070701_100206692 509
487 3300005439 Ga0070711_100020787 Ga0070711_1000207873 509
488 3300005455 Ga0070663_100019616 Ga0070663_1000196163 509
489 3300005457 Ga0070662_100043063 Ga0070662_1000430633 509
490 3300005466 Ga0070685_10002592 Ga0070685_100025923 509
491 3300005467 Ga0070706_100079553 Ga0070706_1000795532 509
492 3300005471 Ga0070698_100013609 Ga0070698_1000136094 509
493 3300005535 Ga0070684_100022942 Ga0070684_1000229421 509
494 3300005543 Ga0070672_100006205 Ga0070672_1000062052 509
495 3300005543 Ga0070672_100038069 Ga0070672_1000380692 509
496 3300005548 Ga0070665_100103005 Ga0070665_1001030052 509
497 3300005564 Ga0070664_100021814 Ga0070664_1000218144 509
498 3300005615 Ga0070702_100033918 Ga0070702_1000339183 509
499 3300005617 Ga0068859_100069073 Ga0068859_1000690733 509
500 3300005617 Ga0068859_100100776 Ga0068859_1001007763 509
501 3300005719 Ga0068861_100012766 Ga0068861_1000127663 509
502 3300005719 Ga0068861_100100487 Ga0068861_1001004872 509
503 3300005834 Ga0068851_10028366 Ga0068851_100283661 509
504 3300005834 Ga0068851_10046116 Ga0068851_100461162 509
505 3300005840 Ga0068870_10024981 Ga0068870_100249813 509
506 3300005843 Ga0068860_100129139 Ga0068860_1001291392 509
507 3300005844 Ga0068862_100008612 Ga0068862_1000086123 509
508 3300006173 Ga0070716_100000066 Ga0070716_10000006614 509
509 3300006175 Ga0070712_100018033 Ga0070712_1000180335 509
510 3300006237 Ga0097621_100084597 Ga0097621_1000845972 509
511 3300006844 Ga0075428_100014767 Ga0075428_1000147672 509
512 3300006931 Ga0097620_100069074 Ga0097620_1000690741 509
513 3300006931 Ga0097620_100100777 Ga0097620_1001007772 509
514 3300009094 Ga0111539_10000032 Ga0111539_1000003229 509
515 3300009094 Ga0111539_10013357 Ga0111539_100133576 509
516 3300009094 Ga0111539_10193605 Ga0111539_101936051 509
517 3300009174 Ga0105241_10179271 Ga0105241_101792711 509
518 3300009177 Ga0105248_10095536 Ga0105248_100955362 509
519 3300013296 Ga0157374_10024375 Ga0157374_100243752 509
520 3300013296 Ga0157374_10109896 Ga0157374_101098962 509
521 3300013306 Ga0163162_10024218 Ga0163162_100242184 509
522 3300013306 Ga0163162_10297585 Ga0163162_102975851 509
523 3300013308 Ga0157375_10000873 Ga0157375_1000087328 509
524 3300014325 Ga0163163_10016331 Ga0163163_100163313 509
525 3300014745 Ga0157377_10004055 Ga0157377_100040553 509
526 3300014968 Ga0157379_10048164 Ga0157379_100481643 509
527 3300014969 Ga0157376_10037171 Ga0157376_100371713 509
528 3300015261 Ga0182006_1018164 Ga0182006_10181643 509
529 3300025315 Ga0207697_10000566 Ga0207697_1000056619 509
530 3300025893 Ga0207682_10000358 Ga0207682_100003587 509
531 3300025901 Ga0207688_10003318 Ga0207688_100033182 509
532 3300025906 Ga0207699_10002497 Ga0207699_100024972 509
533 3300025907 Ga0207645_10003754 Ga0207645_100037543 509
534 3300025908 Ga0207643_10001453 Ga0207643_100014534 509
535 3300025915 Ga0207693_10028366 Ga0207693_100283663 509
536 3300025918 Ga0207662_10059566 Ga0207662_100595662 509
537 3300025920 Ga0207649_10068152 Ga0207649_100681522 509
538 3300025923 Ga0207681_10003062 Ga0207681_100030627 509
539 3300025925 Ga0207650_10004369 Ga0207650_100043696 509
540 3300025925 Ga0207650_10020780 Ga0207650_100207805 509
541 3300025925 Ga0207650_10034873 Ga0207650_100348733 509
542 3300025931 Ga0207644_10026532 Ga0207644_100265323 509
543 3300025931 Ga0207644_10057400 Ga0207644_100574003 509
544 3300025933 Ga0207706_10012005 Ga0207706_100120055 509
545 3300025935 Ga0207709_10144380 Ga0207709_101443801 509
546 3300025936 Ga0207670_10046561 Ga0207670_100465611 509
547 3300025938 Ga0207704_10020280 Ga0207704_100202803 509
548 3300025939 Ga0207665_10000036 Ga0207665_1000003669 509
549 3300025940 Ga0207691_10001544 Ga0207691_1000154423 509
550 3300025940 Ga0207691_10037417 Ga0207691_100374172 509
551 3300025940 Ga0207691_10057279 Ga0207691_100572794 509
552 3300025942 Ga0207689_10000264 Ga0207689_1000026446 509
553 3300025972 Ga0207668_10009055 Ga0207668_100090553 509
554 3300025972 Ga0207668_10021442 Ga0207668_100214423 509
555 3300025986 Ga0207658_10171103 Ga0207658_101711032 509
556 3300026035 Ga0207703_10108281 Ga0207703_101082812 509
557 3300026035 Ga0207703_10235108 Ga0207703_102351081 509
558 3300026075 Ga0207708_10128709 Ga0207708_101287091 509
559 3300026078 Ga0207702_10183208 Ga0207702_101832082 509
560 3300026088 Ga0207641_10076557 Ga0207641_100765573 509
561 3300026089 Ga0207648_10016726 Ga0207648_100167261 509
562 3300026095 Ga0207676_10105443 Ga0207676_101054432 509
563 3300026095 Ga0207676_10106276 Ga0207676_101062762 509
564 3300026095 Ga0207676_10136227 Ga0207676_101362272 509
565 3300026116 Ga0207674_10006634 Ga0207674_100066346 509
566 3300026118 Ga0207675_100007774 Ga0207675_1000077743 509
567 3300026118 Ga0207675_100064661 Ga0207675_1000646612 509
568 3300026118 Ga0207675_100138958 Ga0207675_1001389582 509
569 3300026121 Ga0207683_10004381 Ga0207683_100043819 509
570 3300026142 Ga0207698_10052161 Ga0207698_100521612 509
571 3300027907 Ga0207428_10004586 Ga0207428_100045864 509
572 3300028379 Ga0268266_10002367 Ga0268266_1000236718 509
573 3300028379 Ga0268266_10014295 Ga0268266_100142954 509
574 3300028379 Ga0268266_10103544 Ga0268266_101035442 509
575 3300028380 Ga0268265_10184454 Ga0268265_101844541 509
576 3300035695 Ga0373927_0004792 Ga0373927_0004792_7345_8931 509
577 3300046454 Ga0495592_0102617 Ga0495592_0102617_399_1994 509
578 3300046472 Ga0495580_0102446 Ga0495580_0102446_169_1755 509
579 3300046522 Ga0495643_0006429 Ga0495643_0006429_5809_7395 509
580 3300046543 Ga0495645_0026428 Ga0495645_0026428_1289_2875 509
581 3300046615 Ga0495656_0050596 Ga0495656_0050596_139_1725 509
582 3300047317 Ga0495604_0111373 Ga0495604_0111373_342_1928 509
583 3300047322 Ga0495680_0086731 Ga0495680_0086731_505_2091 509
584 3300047444 Ga0495675_0046859 Ga0495675_0046859_65_1651 509
585 3300048904 Ga0496101_0005349 Ga0496101_0005349_2790_4376 509
586 3300048908 Ga0496105_0155464 Ga0496105_0155464_106_1692 509
587 3300048909 Ga0496106_0006757 Ga0496106_0006757_3357_4943 509
588 3300048910 Ga0496107_0009276 Ga0496107_0009276_3202_4788 509
589 3300048912 Ga0496109_0033799 Ga0496109_0033799_690_2276 509
590 3300048913 Ga0496110_0024119 Ga0496110_0024119_983_2569 509
591 3300048917 Ga0496114_0117627 Ga0496114_0117627_588_2177 509
592 3300050511 nmdc:mga08y16_230_c1 nmdc:mga08y16_230_c1_39737_41326 509
593 3300053077 Ga0495601_0003422 Ga0495601_0003422_1597_3183 509
594 3300053085 Ga0495619_0004411 Ga0495619_0004411_5900_7486 509

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06826

Asp-Al_Ex

Predicted Permease Membrane Region

376

546

0.97

PF02080

TrkA_C

TrkA-C domain

296

363

0.96

PF06826

Asp-Al_Ex

Predicted Permease Membrane Region

38

194

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f29-assembly1.cif.gz_A structure of rck domain with cda 0.9272 274 342
5f29-assembly1.cif.gz_A structure of rck domain with cda 0.8782 274 342
4xtt-assembly1.cif.gz_B structural studies of potassium transport protein ktra regulator of conductance of k+ (rck) c domain in complex with cyclic diadenosine monophosphate (c-di-amp) 0.8514 272 340
8djb-assembly1.cif.gz_A mthk-a90l mutant in closed state with 0 ca2+ 0.8277 271 343
4j91-assembly1.cif.gz_C-2 diamond-shaped octameric structure of ktra with adp bound 0.8211 271 340
ID Description Score Start End Superfamily
5f29A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9045 274 342 3.30.70.1450
af_P60872_288_364_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9041 271 345 3.30.70.1450
af_P60872_206_272_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8987 275 337 3.30.70.1450
af_Q57604_260_331_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8943 275 342 3.30.70.1450
af_P60869_303_372_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8914 187 258 3.30.70.1450
ID Description Score Start End GO Terms
AF-A0A3N5YQC6-F1-model_v4 YidE/YbjL duplication 0.9615 1 162 GO:0005886
AF-A0A422QNN9-F1-model_v4 YidE/YbjL duplication 0.9599 1 508 GO:0005886
GO:0006813
GO:0008324
AF-A0A422QNN9-F1-model_v4 YidE/YbjL duplication 0.9562 1 508 GO:0005886
GO:0006813
GO:0008324
AF-A0A7V4KP33-F1-model_v4 YidE/YbjL duplication 0.9509 1 507 GO:0005886
GO:0006813
GO:0008324
AF-A0A3N5YQC6-F1-model_v4 YidE/YbjL duplication 0.9501 1 162 GO:0005886

Feature Viewer

pLDDT pTM Quality
82.51 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map