F467375

General Info

Members Datasets Scaffolds Average Seq Length
594 291 1188 247

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0190399|Ga0495672_0190399_65_928
Length 287
Sequence VLTIAQSAGGTLDGAAQLSDRIGGVHRPIVRTEAAAGYAGRLRAAVLSDVHSNLPALEAALAAVDEASVDEIWCLGDVVGYGADPDACTTLIRERCAVCLVGNHDLAALDALDISSFSETAKAAVEWTREQASAATLEFLGGLQPAMQHAGIALFHASPRDPVWEYVLSIEQAEAGFDAQEARIGLIGHTHVALFFNRPEGARRGYSHGAQAADGAVVDLDDGAWLLNPGSVGQPRDGDPRAAWLELDTEELTARYHRVPYDIEAAAASIRAAGLPEPLAERLKTGR

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
288 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0
Rhizoplane 10.61
Rhizosphere 82.15
Stem 0
Stem Tuber 0
Unclassified 4.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0190399 3300047320 Bacteria 1032
2 JGI24746J21847_1000237 3300001977 Bacteria 7629
3 rootH1_10034760 3300003323 Bacteria 2977
4 Ga0055525_1000038 3300003759 Bacteria 297540
5 Ga0070658_10018363 3300005327 Bacteria 5600
6 Ga0070683_100000336 3300005329 Bacteria 32282
7 Ga0070683_100006361 3300005329 Bacteria 9903
8 Ga0070690_100375320 3300005330 Bacteria 1038
9 Ga0070677_10000004 3300005333 Bacteria 81101
10 Ga0070666_10098718 3300005335 Bacteria 2011
11 Ga0070682_100000045 3300005337 Bacteria 131960
12 Ga0070682_100054916 3300005337 Bacteria 2501
13 Ga0070682_100071547 3300005337 Bacteria 2220
14 Ga0068868_100000033 3300005338 Bacteria 75402
15 Ga0070689_100600904 3300005340 Unclassified 953
16 Ga0070691_10000230 3300005341 Bacteria 19043
17 Ga0070668_100209822 3300005347 Bacteria 1602
18 Ga0070674_100000029 3300005356 Bacteria 69489
19 Ga0070673_100352164 3300005364 Unclassified 1307
20 Ga0070688_100289351 3300005365 Bacteria 1180
21 Ga0070667_100002484 3300005367 Bacteria 16094
22 Ga0070667_100710986 3300005367 Bacteria 930
23 Ga0070714_100005051 3300005435 Bacteria 10037
24 Ga0070714_100051375 3300005435 Bacteria 3514
25 Ga0070714_100705418 3300005435 Bacteria 974
26 Ga0070713_100164982 3300005436 Bacteria 1980
27 Ga0070710_10000009 3300005437 Bacteria 165863
28 Ga0070711_100318520 3300005439 Bacteria 1242
29 Ga0070694_100053782 3300005444 Bacteria 2726
30 Ga0070678_100123443 3300005456 Bacteria 2046
31 Ga0070662_100000004 3300005457 Bacteria 195534
32 Ga0070681_10041175 3300005458 Bacteria 4629
33 Ga0070681_10063405 3300005458 Bacteria 3668
34 Ga0068867_100006138 3300005459 Bacteria 8506
35 Ga0070685_10000189 3300005466 Bacteria 41176
36 Ga0070685_10172668 3300005466 Bacteria 1386
37 Ga0070679_100001522 3300005530 Bacteria 20653
38 Ga0070684_100032664 3300005535 Bacteria 4437
39 Ga0070686_100017458 3300005544 Bacteria 4194
40 Ga0070695_100058042 3300005545 Bacteria 2502
41 Ga0070695_100121881 3300005545 Bacteria 1785
42 Ga0070696_100599419 3300005546 Bacteria 888
43 Ga0070693_100000376 3300005547 Bacteria 20214
44 Ga0070693_100239670 3300005547 Bacteria 1197
45 Ga0070665_100000106 3300005548 Bacteria 157315
46 Ga0070665_100001339 3300005548 Bacteria 29297
47 Ga0070665_100025532 3300005548 Bacteria 5951
48 Ga0070704_100244965 3300005549 Bacteria 1469
49 Ga0070704_100445297 3300005549 Bacteria 1114
50 Ga0070704_100469299 3300005549 Bacteria 1087
51 Ga0070664_100044395 3300005564 Bacteria 3753
52 Ga0068856_100009596 3300005614 Bacteria 9402
53 Ga0068856_100100649 3300005614 Bacteria 2882
54 Ga0068856_100263234 3300005614 Bacteria 1740
55 Ga0068856_100648225 3300005614 Bacteria 1077
56 Ga0068852_100030323 3300005616 Bacteria 4451
57 Ga0068864_100000045 3300005618 Bacteria 154739
58 Ga0068866_10000001 3300005718 Bacteria 519680
59 Ga0068866_10005617 3300005718 Bacteria 5192
60 Ga0068851_10002439 3300005834 Bacteria 8163
61 Ga0068851_10045522 3300005834 Bacteria 2218
62 Ga0068863_100285352 3300005841 Bacteria 1600
63 Ga0068858_100000216 3300005842 Bacteria 62188
64 Ga0068862_100007431 3300005844 Bacteria 9083
65 Ga0081455_10019018 3300005937 Bacteria 6514
66 Ga0081455_10025380 3300005937 Bacteria 5471
67 Ga0081455_10052867 3300005937 Bacteria 3474
68 Ga0081455_10084007 3300005937 Bacteria 2600
69 Ga0081538_10006138 3300005981 Bacteria 10659
70 Ga0081538_10054941 3300005981 Bacteria 2349
71 Ga0081540_1000139 3300005983 Bacteria 76578
72 Ga0081540_1000306 3300005983 Bacteria 50547
73 Ga0081539_10000791 3300005985 Bacteria 61600
74 Ga0081539_10007194 3300005985 Bacteria 10253
75 Ga0070717_10000013 3300006028 Bacteria 228046
76 Ga0070717_10038496 3300006028 Bacteria 3888
77 Ga0070717_10043229 3300006028 Bacteria 3676
78 Ga0070717_10494672 3300006028 Bacteria 1105
79 Ga0075365_10006237 3300006038 Bacteria 6540
80 Ga0075365_10008204 3300006038 Bacteria 5911
81 Ga0075365_10162159 3300006038 Bacteria 1558
82 Ga0075363_100052178 3300006048 Bacteria 2182
83 Ga0075363_100065868 3300006048 Bacteria 1959
84 Ga0075364_10085526 3300006051 Bacteria 2089
85 Ga0075364_10207873 3300006051 Bacteria 1327
86 Ga0075364_10236690 3300006051 Bacteria 1240
87 Ga0070715_10000001 3300006163 Bacteria 693690
88 Ga0070716_100144005 3300006173 Bacteria 1524
89 Ga0070712_100038325 3300006175 Bacteria 3275
90 Ga0070712_100213587 3300006175 Bacteria 1523
91 Ga0070712_100234664 3300006175 Bacteria 1458
92 Ga0070712_100703686 3300006175 Bacteria 861
93 Ga0075367_10112681 3300006178 Bacteria 1671
94 Ga0075367_10136985 3300006178 Bacteria 1515
95 Ga0075431_100000075 3300006847 Bacteria 57994
96 Ga0075431_100237253 3300006847 Bacteria 1856
97 Ga0075431_100411681 3300006847 Bacteria 1352
98 Ga0075433_10001554 3300006852 Bacteria 16977
99 Ga0075433_10232383 3300006852 Bacteria 1637
100 Ga0075434_100184148 3300006871 Bacteria 2109
101 Ga0075429_100020086 3300006880 Bacteria 5793
102 Ga0068865_100000160 3300006881 Bacteria 36781
103 Ga0068865_100104459 3300006881 Bacteria 2079
104 Ga0105240_10076421 3300009093 Bacteria 4129
105 Ga0105240_10512525 3300009093 Bacteria 1332
106 Ga0111539_10033520 3300009094 Bacteria 6235
107 Ga0105245_10000016 3300009098 Bacteria 204372
108 Ga0105245_10000456 3300009098 Bacteria 37383
109 Ga0105245_10006725 3300009098 Bacteria 10088
110 Ga0105247_10172425 3300009101 Bacteria 1439
111 Ga0114129_10049265 3300009147 Bacteria 5919
112 Ga0114129_10120046 3300009147 Bacteria 3620
113 Ga0114129_10235481 3300009147 Bacteria 2464
114 Ga0105243_10368892 3300009148 Bacteria 1324
115 Ga0105242_10001264 3300009176 Bacteria 19974
116 Ga0105238_10000011 3300009551 Bacteria 261080
117 Ga0105249_10000068 3300009553 Bacteria 148594
118 Ga0105249_10020058 3300009553 Bacteria 5971
119 Ga0105239_10222117 3300010375 Bacteria 2119
120 Ga0105239_10326893 3300010375 Bacteria 1730
121 Ga0157369_10000110 3300013105 Bacteria 115514
122 Ga0157374_10006397 3300013296 Bacteria 9999
123 Ga0157374_10152658 3300013296 Bacteria 2246
124 Ga0157378_10102699 3300013297 Bacteria 2612
125 Ga0157378_10275902 3300013297 Bacteria 1619
126 Ga0163162_11150621 3300013306 Unclassified 880
127 Ga0157375_10001152 3300013308 Bacteria 22842
128 Ga0157375_10002277 3300013308 Bacteria 16605
129 Ga0157375_10095826 3300013308 Bacteria 3039
130 Ga0157375_11283005 3300013308 Bacteria 861
131 Ga0157380_10123871 3300014326 Bacteria 2194
132 Ga0157379_10001717 3300014968 Bacteria 18137
133 Ga0157379_10045627 3300014968 Bacteria 3911
134 Ga0163161_10000035 3300017792 Bacteria 155979
135 Ga0163161_10522932 3300017792 Unclassified 969
136 Ga0213873_10025840 3300021358 Unclassified 1421
137 Ga0213872_10000018 3300021361 Bacteria 175951
138 Ga0213874_10043004 3300021377 Unclassified 1359
139 Ga0213874_10055705 3300021377 Archaea 1225
140 Ga0213875_10014421 3300021388 Bacteria 3856
141 Ga0213875_10100575 3300021388 Bacteria 1349
142 Ga0209563_100005 3300025230 Bacteria 1774893
143 Ga0207656_10000964 3300025321 Bacteria 9407
144 Ga0207656_10007171 3300025321 Bacteria 4051
145 Ga0207692_10000005 3300025898 Bacteria 370169
146 Ga0207642_10000002 3300025899 Bacteria 658166
147 Ga0207642_10032370 3300025899 Bacteria 2201
148 Ga0207688_10117132 3300025901 Bacteria 1552
149 Ga0207680_10013593 3300025903 Bacteria 4188
150 Ga0207685_10000036 3300025905 Bacteria 65666
151 Ga0207699_10159301 3300025906 Bacteria 1501
152 Ga0207705_10090366 3300025909 Bacteria 2242
153 Ga0207707_10006013 3300025912 Bacteria 10621
154 Ga0207707_10191347 3300025912 Bacteria 1785
155 Ga0207695_10054492 3300025913 Bacteria 4175
156 Ga0207693_10007579 3300025915 Bacteria 8918
157 Ga0207693_10012330 3300025915 Bacteria 6905
158 Ga0207693_10185270 3300025915 Bacteria 1639
159 Ga0207663_10321864 3300025916 Bacteria 1162
160 Ga0207660_10341277 3300025917 Archaea 1199
161 Ga0207652_10005524 3300025921 Bacteria 10249
162 Ga0207650_10063628 3300025925 Bacteria 2759
163 Ga0207687_10000007 3300025927 Bacteria 604185
164 Ga0207687_10000018 3300025927 Bacteria 236159
165 Ga0207687_10106403 3300025927 Bacteria 2074
166 Ga0207700_10019771 3300025928 Bacteria 4556
167 Ga0207664_10057603 3300025929 Bacteria 3089
168 Ga0207664_10061739 3300025929 Bacteria 2991
169 Ga0207664_10220453 3300025929 Bacteria 1645
170 Ga0207664_10465247 3300025929 Bacteria 1130
171 Ga0207706_10000012 3300025933 Bacteria 195475
172 Ga0207686_10000033 3300025934 Bacteria 143602
173 Ga0207686_10171473 3300025934 Bacteria 1530
174 Ga0207670_10134353 3300025936 Unclassified 1817
175 Ga0207669_10000012 3300025937 Bacteria 138242
176 Ga0207704_10001688 3300025938 Bacteria 9886
177 Ga0207665_10062592 3300025939 Bacteria 2525
178 Ga0207665_10073256 3300025939 Bacteria 2342
179 Ga0207661_10000224 3300025944 Bacteria 36954
180 Ga0207661_10003313 3300025944 Bacteria 11175
181 Ga0207679_10025440 3300025945 Bacteria 4071
182 Ga0207712_10093233 3300025961 Bacteria 2222
183 Ga0207668_10032498 3300025972 Bacteria 3448
184 Ga0207658_10000789 3300025986 Bacteria 26987
185 Ga0207677_10000338 3300026023 Bacteria 33505
186 Ga0207677_10038465 3300026023 Bacteria 3137
187 Ga0207703_10000023 3300026035 Bacteria 222018
188 Ga0207639_10004799 3300026041 Bacteria 9122
189 Ga0207702_10003484 3300026078 Bacteria 14344
190 Ga0207702_10532308 3300026078 Unclassified 1148
191 Ga0207648_10000766 3300026089 Bacteria 36117
192 Ga0207676_10000016 3300026095 Bacteria 311561
193 Ga0207683_10154163 3300026121 Bacteria 2074
194 Ga0207683_10315734 3300026121 Bacteria 1431
195 Ga0207698_10023188 3300026142 Bacteria 4331
196 Ga0207428_10007128 3300027907 Bacteria 10225
197 Ga0268266_10000047 3300028379 Bacteria 310996
198 Ga0268266_10045384 3300028379 Bacteria 3760
199 Ga0268266_10204706 3300028379 Bacteria 1807
200 Ga0268264_10013352 3300028381 Bacteria 6759
201 Ga0265337_1000231 3300028556 Bacteria 30088
202 Ga0265326_10000007 3300028558 Bacteria 223057
203 Ga0265326_10000024 3300028558 Bacteria 112928
204 Ga0265319_1000015 3300028563 Bacteria 176382
205 Ga0265319_1001582 3300028563 Bacteria 13344
206 Ga0265334_10000151 3300028573 Bacteria 42917
207 Ga0265322_10000001 3300028654 Bacteria 543854
208 Ga0265336_10000622 3300028666 Bacteria 19519
209 Ga0265336_10040681 3300028666 Bacteria 1422
210 Ga0265338_10024213 3300028800 Bacteria 6210
211 Ga0265324_10001009 3300029957 Bacteria 17266
212 Ga0265324_10012308 3300029957 Bacteria 3230
213 Ga0265330_10081576 3300031235 Bacteria 1393
214 Ga0265332_10033616 3300031238 Bacteria 2232
215 Ga0265320_10000002 3300031240 Bacteria 542875
216 Ga0265320_10011515 3300031240 Bacteria 5201
217 Ga0265320_10069240 3300031240 Bacteria 1666
218 Ga0265329_10026743 3300031242 Bacteria 1899
219 Ga0265331_10001887 3300031250 Bacteria 14737
220 Ga0265327_10000011 3300031251 Bacteria 543807
221 Ga0265327_10008455 3300031251 Bacteria 7658
222 Ga0265327_10031586 3300031251 Bacteria 2973
223 Ga0265316_10010658 3300031344 Bacteria 8357
224 Ga0316579_10021491 3300031691 Bacteria 2877
225 Ga0265314_10000062 3300031711 Bacteria 159496
226 Ga0265342_10158331 3300031712 Bacteria 1253
227 Ga0307410_10027731 3300031852 Bacteria 3582
228 Ga0307409_100029001 3300031995 Bacteria 3954
229 Ga0307416_100027340 3300032002 Bacteria 4223
230 Ga0307415_100038577 3300032126 Bacteria 3150
231 Ga0373951_0000260 3300035091 Bacteria 17321
232 Ga0373953_0016408 3300035117 Bacteria 2703
233 Ga0316574_0187073 3300035398 Bacteria 1332
234 Ga0373937_0038632 3300036401 Bacteria 4350
235 Ga0395899_0057335 3300037312 Bacteria 2876
236 Ga0395899_0092804 3300037312 Bacteria 2186
237 Ga0395900_0008002 3300037418 Bacteria 10877
238 Ga0395900_0009508 3300037418 Bacteria 9968
239 Ga0395900_0015550 3300037418 Bacteria 7756
240 Ga0395900_0087158 3300037418 Bacteria 3209
241 Ga0395900_0202835 3300037418 Bacteria 2006
242 Ga0395900_0377697 3300037418 Bacteria 1386
243 Ga0395898_0029748 3300037466 Bacteria 5467
244 Ga0395898_0130861 3300037466 Bacteria 2404
245 Ga0395898_0160056 3300037466 Bacteria 2153
246 Ga0395898_0469842 3300037466 Bacteria 1197
247 Ga0395905_0017484 3300037471 Bacteria 6807
248 Ga0436364_0055825 3300037853 Bacteria 1665
249 Ga0436364_0300582 3300037853 Bacteria 9432
250 Ga0395901_0011233 3300038443 Bacteria 9071
251 Ga0395901_0019129 3300038443 Bacteria 7003
252 Ga0395901_0080516 3300038443 Bacteria 3401
253 Ga0395901_0128188 3300038443 Bacteria 2667
254 Ga0395901_0990436 3300038443 Archaea 817
255 Ga0436365_0912124 3300039437 Bacteria 5815
256 Ga0436365_1577946 3300039437 Bacteria 3683
257 Ga0436361_0677882 3300039447 Bacteria 228834
258 Ga0436363_0212268 3300039450 Bacteria 3676
259 Ga0436363_0365326 3300039450 Bacteria 16368
260 Ga0436363_0918359 3300039450 Bacteria 910
261 Ga0436363_1389992 3300039450 Unclassified 2075
262 Ga0436362_0022934 3300039453 Bacteria 1221
263 Ga0436362_0760682 3300039453 Bacteria 2340
264 Ga0436362_0832687 3300039453 Bacteria 3101
265 Ga0451853_1374451 3300041512 Bacteria 1873
266 Ga0451577_0031186 3300042876 Bacteria 4811
267 Ga0451577_0198427 3300042876 Bacteria 1811
268 Ga0451577_0291704 3300042876 Bacteria 1478
269 Ga0451577_0343327 3300042876 Bacteria 1354
270 Ga0451577_0615439 3300042876 Bacteria 985
271 Ga0451577_0727847 3300042876 Bacteria 898
272 Ga0466969_0008856 3300044656 Bacteria 5338
273 Ga0453683_0001164 3300044673 Bacteria 23761
274 Ga0453683_0056062 3300044673 Bacteria 2466
275 Ga0453683_0091200 3300044673 Bacteria 1910
276 Ga0453683_0193552 3300044673 Bacteria 1290
277 Ga0453683_0266712 3300044673 Bacteria 1092
278 Ga0466965_0166096 3300044683 Bacteria 1159
279 Ga0466966_0011913 3300044684 Bacteria 5764
280 Ga0466961_0038370 3300044693 Bacteria 3073
281 Ga0466963_0000001 3300044694 Bacteria 110556
282 Ga0466963_0003004 3300044694 Bacteria 9545
283 Ga0466963_0038385 3300044694 Bacteria 3131
284 Ga0466963_0106176 3300044694 Unclassified 1925
285 Ga0466963_0128478 3300044694 Bacteria 1749
286 Ga0466964_0077639 3300044706 Bacteria 1418
287 Ga0466964_0188037 3300044706 Bacteria 983
288 Ga0453684_0001371 3300044712 Bacteria 70492
289 Ga0453684_0001389 3300044712 Bacteria 70078
290 Ga0453684_0009118 3300044712 Bacteria 17477
291 Ga0453684_0011205 3300044712 Bacteria 15096
292 Ga0453684_0037293 3300044712 Bacteria 6673
293 Ga0453684_0056220 3300044712 Bacteria 5106
294 Ga0453684_0067262 3300044712 Bacteria 4557
295 Ga0453684_0074077 3300044712 Bacteria 4289
296 Ga0453684_0128401 3300044712 Bacteria 3046
297 Ga0453684_0151546 3300044712 Bacteria 2754
298 Ga0453684_0477469 3300044712 Bacteria 1384
299 Ga0453684_0626657 3300044712 Bacteria 1176
300 Ga0466971_0010565 3300044719 Bacteria 4036
301 Ga0466971_0144939 3300044719 Archaea 1107
302 Ga0466968_0006296 3300044735 Bacteria 4468
303 Ga0466968_0018561 3300044735 Bacteria 2791
304 Ga0466970_0030338 3300044765 Bacteria 2851
305 Ga0466970_0067549 3300044765 Bacteria 1920
306 Ga0466957_0062516 3300044842 Bacteria 2287
307 Ga0466959_0004786 3300045049 Bacteria 9132
308 Ga0466959_0006088 3300045049 Bacteria 8327
309 Ga0466959_0133559 3300045049 Bacteria 1758
310 Ga0466959_0258762 3300045049 Unclassified 1198
311 Ga0466959_0334817 3300045049 Archaea 1033
312 Ga0451576_0040917 3300045051 Bacteria 4900
313 Ga0451576_0089980 3300045051 Bacteria 3192
314 Ga0451576_0126019 3300045051 Bacteria 2668
315 Ga0451576_0371006 3300045051 Bacteria 1499
316 Ga0451576_0575739 3300045051 Bacteria 1183
317 Ga0466958_0003716 3300045836 Bacteria 7970
318 Ga0466958_0046760 3300045836 Bacteria 2612
319 Ga0466958_0053180 3300045836 Bacteria 2455
320 Ga0466958_0143370 3300045836 Unclassified 1505
321 Ga0466958_0189692 3300045836 Bacteria 1306
322 Ga0466967_0002063 3300045976 Bacteria 12278
323 Ga0466967_0004922 3300045976 Bacteria 9130
324 Ga0466967_0486396 3300045976 Bacteria 1210
325 Ga0466967_0841128 3300045976 Bacteria 912
326 Ga0495592_0181864 3300046454 Bacteria 1431
327 Ga0495592_0492611 3300046454 Unclassified 762
328 Ga0495603_0000030 3300046455 Bacteria 60760
329 Ga0495603_0109616 3300046455 Bacteria 1611
330 Ga0495603_0113663 3300046455 Bacteria 1579
331 Ga0495629_0000272 3300046459 Bacteria 44883
332 Ga0495629_0007077 3300046459 Bacteria 8265
333 Ga0495629_0134310 3300046459 Bacteria 1723
334 Ga0495638_0025573 3300046460 Bacteria 3834
335 Ga0495641_0000044 3300046461 Bacteria 77415
336 Ga0495641_0018491 3300046461 Bacteria 3595
337 Ga0495641_0029640 3300046461 Bacteria 2635
338 Ga0495651_0329034 3300046462 Bacteria 1016
339 Ga0495582_0000011 3300046473 Bacteria 113352
340 Ga0495582_0139870 3300046473 Bacteria 1371
341 Ga0495662_0000458 3300046476 Bacteria 18383
342 Ga0495662_0010519 3300046476 Bacteria 4526
343 Ga0495662_0029864 3300046476 Bacteria 2631
344 Ga0495664_0074780 3300046477 Bacteria 2027
345 Ga0495594_0000003 3300046499 Bacteria 199267
346 Ga0495606_0000752 3300046507 Bacteria 50099
347 Ga0495608_0000068 3300046511 Bacteria 79694
348 Ga0495608_0001531 3300046511 Bacteria 16466
349 Ga0495608_0005242 3300046511 Bacteria 9263
350 Ga0495610_0049823 3300046512 Bacteria 2048
351 Ga0495618_0000594 3300046514 Bacteria 25841
352 Ga0495618_0105036 3300046514 Bacteria 1809
353 Ga0495620_0000144 3300046515 Bacteria 58204
354 Ga0495628_0001219 3300046516 Bacteria 23555
355 Ga0495628_0011925 3300046516 Bacteria 7331
356 Ga0495628_0014438 3300046516 Bacteria 6621
357 Ga0495628_0035880 3300046516 Bacteria 3983
358 Ga0495630_0000056 3300046517 Bacteria 91477
359 Ga0495644_0000642 3300046523 Bacteria 14607
360 Ga0495652_0000019 3300046529 Bacteria 190248
361 Ga0495652_0042721 3300046529 Bacteria 3908
362 Ga0495652_0146568 3300046529 Bacteria 1850
363 Ga0495652_0202521 3300046529 Bacteria 1505
364 Ga0495640_0003352 3300046533 Bacteria 12891
365 Ga0495640_0006130 3300046533 Bacteria 9529
366 Ga0495586_0010794 3300046535 Bacteria 4856
367 Ga0495587_0063045 3300046536 Bacteria 2169
368 Ga0495587_0185246 3300046536 Unclassified 1179
369 Ga0495645_0000558 3300046543 Bacteria 25592
370 Ga0495645_0012086 3300046543 Bacteria 6083
371 Ga0495622_0000180 3300046557 Bacteria 51095
372 Ga0495667_0000032 3300046559 Bacteria 143493
373 Ga0495667_0069189 3300046559 Bacteria 2304
374 Ga0495668_0093742 3300046616 Unclassified 1644
375 Ga0495634_0000018 3300046642 Bacteria 121323
376 Ga0495634_0000247 3300046642 Bacteria 50931
377 Ga0495634_0013773 3300046642 Bacteria 5840
378 Ga0495634_0138676 3300046642 Bacteria 1546
379 Ga0495625_0000696 3300046660 Bacteria 47763
380 Ga0495635_0078350 3300046663 Bacteria 2262
381 Ga0495661_0318980 3300046665 Bacteria 773
382 Ga0495588_0000165 3300046674 Bacteria 85841
383 Ga0495657_0000004 3300046675 Bacteria 266465
384 Ga0495657_0027421 3300046675 Bacteria 4019
385 Ga0495599_0002223 3300046678 Bacteria 11296
386 Ga0495599_0042141 3300046678 Bacteria 2865
387 Ga0495599_0207814 3300046678 Bacteria 1201
388 Ga0495647_0000008 3300046681 Bacteria 101193
389 Ga0495647_0000169 3300046681 Bacteria 17284
390 Ga0495647_0001061 3300046681 Bacteria 8370
391 Ga0495658_0000005 3300046683 Bacteria 149839
392 Ga0495658_0015075 3300046683 Bacteria 3961
393 Ga0495669_0000211 3300046684 Bacteria 35387
394 Ga0495669_0151554 3300046684 Bacteria 1098
395 Ga0495613_0000113 3300046689 Bacteria 79559
396 Ga0495613_0000203 3300046689 Bacteria 58232
397 Ga0495624_0000267 3300046690 Bacteria 41318
398 Ga0495624_0158054 3300046690 Bacteria 1385
399 Ga0495649_0001624 3300046694 Bacteria 16726
400 Ga0495600_0009841 3300046809 Bacteria 5914
401 Ga0495600_0036142 3300046809 Bacteria 3209
402 Ga0495604_0000019 3300047317 Bacteria 175064
403 Ga0495604_0002470 3300047317 Bacteria 14758
404 Ga0495604_0135325 3300047317 Bacteria 1766
405 Ga0495604_0149473 3300047317 Bacteria 1661
406 Ga0495604_0323818 3300047317 Unclassified 1029
407 Ga0495674_0001564 3300047319 Bacteria 22423
408 Ga0495676_0000299 3300047321 Bacteria 40098
409 Ga0495676_0008653 3300047321 Bacteria 9317
410 Ga0495676_0028282 3300047321 Bacteria 4790
411 Ga0495676_0104140 3300047321 Bacteria 2094
412 Ga0495676_0155634 3300047321 Bacteria 1622
413 Ga0495680_0002092 3300047322 Bacteria 20739
414 Ga0495680_0008488 3300047322 Bacteria 9332
415 Ga0495680_0072533 3300047322 Bacteria 2618
416 Ga0495675_0000107 3300047444 Bacteria 59970
417 Ga0495675_0054941 3300047444 Bacteria 2526
418 Ga0495679_005703 3300047446 Bacteria 5489
419 Ga0495684_0127569 3300047471 Bacteria 1913
420 Ga0495684_0225300 3300047471 Bacteria 1373
421 Ga0495684_0227011 3300047471 Bacteria 1367
422 Ga0495686_0051641 3300047472 Bacteria 2579
423 Ga0495686_0156166 3300047472 Bacteria 1336
424 Ga0495602_0000208 3300048088 Bacteria 54818
425 Ga0495602_0000497 3300048088 Bacteria 36490
426 Ga0495602_0131904 3300048088 Bacteria 1991
427 Ga0495602_0183526 3300048088 Bacteria 1611
428 Ga0495602_0243462 3300048088 Bacteria 1344
429 Ga0496100_0000002 3300048903 Bacteria 489057
430 Ga0496100_0000018 3300048903 Bacteria 162451
431 Ga0496100_0004549 3300048903 Bacteria 7370
432 Ga0496101_0000062 3300048904 Bacteria 126595
433 Ga0496101_0026996 3300048904 Bacteria 3994
434 Ga0496102_0000039 3300048905 Bacteria 198306
435 Ga0496102_0047755 3300048905 Bacteria 3891
436 Ga0496102_0278156 3300048905 Bacteria 1578
437 Ga0496102_0771578 3300048905 Archaea 884
438 Ga0496103_0000008 3300048906 Bacteria 340474
439 Ga0496103_0020259 3300048906 Bacteria 3995
440 Ga0496104_0000009 3300048907 Bacteria 488055
441 Ga0496104_0000129 3300048907 Bacteria 69982
442 Ga0496104_0003364 3300048907 Bacteria 13809
443 Ga0496104_0022893 3300048907 Bacteria 5740
444 Ga0496104_1050866 3300048907 Bacteria 718
445 Ga0496105_0000007 3300048908 Bacteria 339658
446 Ga0496105_0004668 3300048908 Bacteria 10329
447 Ga0496105_0030752 3300048908 Bacteria 4400
448 Ga0496106_0000145 3300048909 Bacteria 52447
449 Ga0496106_0109361 3300048909 Bacteria 2151
450 Ga0496106_0115931 3300048909 Bacteria 2089
451 Ga0496107_0000006 3300048910 Bacteria 258746
452 Ga0496107_0012966 3300048910 Bacteria 5824
453 Ga0496107_0192056 3300048910 Bacteria 1517
454 Ga0496107_0259900 3300048910 Bacteria 1292
455 Ga0496108_0000001 3300048911 Bacteria 919044
456 Ga0496108_0000062 3300048911 Bacteria 122391
457 Ga0496108_0025918 3300048911 Bacteria 4835
458 Ga0496108_0043336 3300048911 Bacteria 3759
459 Ga0496109_0000003 3300048912 Bacteria 420862
460 Ga0496109_0000007 3300048912 Bacteria 247554
461 Ga0496109_0000129 3300048912 Bacteria 77469
462 Ga0496109_0001311 3300048912 Bacteria 20538
463 Ga0496109_0040263 3300048912 Bacteria 4232
464 Ga0496109_0068765 3300048912 Archaea 3246
465 Ga0496109_0212645 3300048912 Bacteria 1819
466 Ga0496109_0249793 3300048912 Bacteria 1670
467 Ga0496109_0271532 3300048912 Bacteria 1598
468 Ga0496110_0000062 3300048913 Bacteria 53333
469 Ga0496110_0089308 3300048913 Bacteria 2754
470 Ga0496110_0180866 3300048913 Bacteria 1915
471 Ga0496110_0337585 3300048913 Bacteria 1373
472 Ga0496110_0543651 3300048913 Archaea 1056
473 Ga0496111_0000010 3300048914 Bacteria 92600
474 Ga0496111_0027094 3300048914 Bacteria 4051
475 Ga0496111_0209635 3300048914 Bacteria 1447
476 Ga0496111_0323385 3300048914 Bacteria 1142
477 Ga0496111_0560036 3300048914 Bacteria 839
478 Ga0496112_0000003 3300048915 Bacteria 660147
479 Ga0496112_0001122 3300048915 Bacteria 19906
480 Ga0496112_0434735 3300048915 Bacteria 1250
481 Ga0496112_0571658 3300048915 Bacteria 1063
482 Ga0496113_0000014 3300048916 Bacteria 79850
483 Ga0496113_0041966 3300048916 Bacteria 3378
484 Ga0496113_0224415 3300048916 Bacteria 1498
485 Ga0496113_0717377 3300048916 Bacteria 797
486 Ga0496114_0000955 3300048917 Bacteria 21621
487 Ga0496114_0024543 3300048917 Bacteria 4923
488 Ga0496114_0451468 3300048917 Bacteria 1138
489 Ga0496115_0000003 3300048918 Bacteria 354994
490 Ga0496115_0003578 3300048918 Bacteria 11174
491 Ga0496115_0008297 3300048918 Bacteria 7678
492 Ga0496125_0258796 3300048928 Unclassified 1092
493 Ga0501031_0010454 3300049568 Bacteria 6044
494 Ga0501038_0327277 3300049574 Bacteria 1198
495 Ga0501039_0037007 3300049575 Bacteria 3766
496 Ga0501040_0096609 3300049576 Bacteria 2057
497 Ga0501040_0104334 3300049576 Bacteria 1980
498 Ga0501041_0009609 3300049577 Bacteria 5701
499 Ga0501041_0052755 3300049577 Bacteria 2479
500 Ga0501042_0058869 3300049578 Bacteria 2743
501 Ga0501042_0086901 3300049578 Bacteria 2243
502 Ga0501042_0364997 3300049578 Bacteria 1045
503 Ga0501046_0352666 3300049580 Bacteria 1068
504 Ga0501047_0249890 3300049581 Bacteria 1622
505 Ga0501048_0066425 3300049582 Bacteria 2550
506 Ga0501048_0160990 3300049582 Bacteria 1589
507 Ga0501067_0029047 3300049583 Bacteria 3065
508 Ga0501067_0115524 3300049583 Bacteria 1493
509 Ga0501068_0121156 3300049584 Unclassified 1631
510 Ga0501069_0119118 3300049585 Bacteria 1507
511 Ga0501069_0163959 3300049585 Unclassified 1280
512 Ga0501070_0027946 3300049586 Bacteria 4732
513 Ga0501070_0029020 3300049586 Bacteria 4639
514 Ga0501070_0290932 3300049586 Bacteria 1331
515 Ga0501071_0014464 3300049587 Bacteria 5397
516 Ga0501071_0113845 3300049587 Bacteria 2001
517 Ga0501071_0153457 3300049587 Bacteria 1719
518 Ga0501071_0289287 3300049587 Unclassified 1241
519 Ga0501071_0329114 3300049587 Bacteria 1161
520 Ga0501072_0027817 3300049588 Bacteria 4411
521 Ga0501072_0045691 3300049588 Bacteria 3445
522 Ga0501072_0198816 3300049588 Bacteria 1598
523 Ga0501072_0462607 3300049588 Bacteria 1004
524 Ga0501072_0587986 3300049588 Bacteria 878
525 Ga0501073_0052133 3300049589 Bacteria 2865
526 Ga0501074_0032506 3300049590 Bacteria 3780
527 Ga0501074_0156832 3300049590 Bacteria 1626
528 Ga0501075_0001259 3300049591 Bacteria 16393
529 Ga0501075_0004081 3300049591 Bacteria 9859
530 Ga0501075_0688948 3300049591 Bacteria 779
531 Ga0501076_0019202 3300049592 Bacteria 5220
532 Ga0501076_0166890 3300049592 Bacteria 1794
533 Ga0501076_0176955 3300049592 Bacteria 1739
534 Ga0501077_0030494 3300049593 Bacteria 3431
535 Ga0501079_0067582 3300049741 Unclassified 2758
536 Ga0501080_0638653 3300049742 Bacteria 943
537 Ga0501081_0061891 3300049743 Bacteria 2595
538 Ga0501081_0111508 3300049743 Bacteria 1941
539 Ga0501081_0511556 3300049743 Bacteria 895
540 Ga0501044_0390361 3300049823 Bacteria 1306
541 Ga0501045_0020945 3300049824 Bacteria 4674
542 Ga0501045_0173999 3300049824 Bacteria 1604
543 Ga0501045_0330578 3300049824 Bacteria 1134
544 Ga0501045_0388074 3300049824 Bacteria 1039
545 nmdc:mga03n38_140402_c1 3300050490 Bacteria 1206
546 nmdc:mga00v17_190395_c1 3300050491 Bacteria 1325
547 nmdc:mga00v17_220815_c1 3300050491 Bacteria 1227
548 nmdc:mga00v17_343437_c1 3300050491 Bacteria 970
549 nmdc:mga00v17_46223_c1 3300050491 Unclassified 2633
550 nmdc:mga00v17_78056_c1 3300050491 Unclassified 2063
551 nmdc:mga0yw44_1248_c1 3300050492 Bacteria 9994
552 nmdc:mga0yw44_137046_c1 3300050492 Bacteria 1235
553 nmdc:mga0yw44_19826_c1 3300050492 Bacteria 3717
554 nmdc:mga0yw44_866_c1 3300050492 Bacteria 11350
555 nmdc:mga0yw44_96114_c1 3300050492 Archaea 1880
556 nmdc:mga06z11_227318_c1 3300050494 Bacteria 1092
557 nmdc:mga06z11_90436_c1 3300050494 Bacteria 1660
558 nmdc:mga05p37_37814_c1 3300050507 Bacteria 5919
559 nmdc:mga05p37_97684_c1 3300050507 Bacteria 3618
560 nmdc:mga09592_17372_c1 3300050508 Bacteria 5894
561 nmdc:mga06r32_244_c1 3300050510 Bacteria 44802
562 nmdc:mga08y16_30597_c1 3300050511 Bacteria 5664
563 nmdc:mga08y16_717187_c1 3300050511 Unclassified 998
564 nmdc:mga0rr50_36609_c1 3300050513 Bacteria 3535
565 nmdc:mga0rr50_430612_c1 3300050513 Bacteria 1117
566 nmdc:mga0rr50_615359_c1 3300050513 Unclassified 926
567 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
568 nmdc:mga0a205_285197_c1 3300050515 Bacteria 1526
569 Ga0495601_0000013 3300053077 Bacteria 226476
570 Ga0495601_0000326 3300053077 Bacteria 25282
571 Ga0495601_0015759 3300053077 Bacteria 4573
572 Ga0495601_0019131 3300053077 Bacteria 4174
573 Ga0495601_0163065 3300053077 Bacteria 1457
574 Ga0495601_0183261 3300053077 Bacteria 1369
575 Ga0495612_0001299 3300053078 Bacteria 10313
576 Ga0495655_0000001 3300053083 Bacteria 419518
577 Ga0495655_0002897 3300053083 Bacteria 2770
578 Ga0495595_0000003 3300053084 Bacteria 266465
579 Ga0495595_0007829 3300053084 Bacteria 4375
580 Ga0495619_0000031 3300053085 Bacteria 145508
581 Ga0495619_0000106 3300053085 Bacteria 62413
582 Ga0495619_0001746 3300053085 Bacteria 14440
583 Ga0500566_0024110 3300053094 Bacteria 3573
584 Ga0500614_000397 3300053123 Bacteria 11312
585 Ga0500628_000010 3300053129 Bacteria 122210
586 Ga0501084_0067127 3300054114 Bacteria 3002
587 Ga0501084_0073980 3300054114 Bacteria 2853
588 Ga0501084_0379288 3300054114 Bacteria 1195
589 Ga0501084_0429802 3300054114 Bacteria 1116
590 Ga0501082_0073587 3300060353 Bacteria 2943
591 Ga0501082_0235884 3300060353 Bacteria 1592
592 Ga0501082_0333042 3300060353 Bacteria 1323
593 Ga0530510_0006043 3300061734 Bacteria 8405
594 Ga0530510_0133718 3300061734 Bacteria 1825
595 Ga0495672_0190399
596 JGI24746J21847_1000237
597 rootH1_10034760
598 Ga0055525_1000038
599 Ga0070658_10018363
600 Ga0070683_100000336
601 Ga0070683_100006361
602 Ga0070690_100375320
603 Ga0070677_10000004
604 Ga0070666_10098718
605 Ga0070682_100000045
606 Ga0070682_100054916
607 Ga0070682_100071547
608 Ga0068868_100000033
609 Ga0070689_100600904
610 Ga0070691_10000230
611 Ga0070668_100209822
612 Ga0070674_100000029
613 Ga0070673_100352164
614 Ga0070688_100289351
615 Ga0070667_100002484
616 Ga0070667_100710986
617 Ga0070714_100005051
618 Ga0070714_100051375
619 Ga0070714_100705418
620 Ga0070713_100164982
621 Ga0070710_10000009
622 Ga0070711_100318520
623 Ga0070694_100053782
624 Ga0070678_100123443
625 Ga0070662_100000004
626 Ga0070681_10041175
627 Ga0070681_10063405
628 Ga0068867_100006138
629 Ga0070685_10000189
630 Ga0070685_10172668
631 Ga0070679_100001522
632 Ga0070684_100032664
633 Ga0070686_100017458
634 Ga0070695_100058042
635 Ga0070695_100121881
636 Ga0070696_100599419
637 Ga0070693_100000376
638 Ga0070693_100239670
639 Ga0070665_100000106
640 Ga0070665_100001339
641 Ga0070665_100025532
642 Ga0070704_100244965
643 Ga0070704_100445297
644 Ga0070704_100469299
645 Ga0070664_100044395
646 Ga0068856_100009596
647 Ga0068856_100100649
648 Ga0068856_100263234
649 Ga0068856_100648225
650 Ga0068852_100030323
651 Ga0068864_100000045
652 Ga0068866_10000001
653 Ga0068866_10005617
654 Ga0068851_10002439
655 Ga0068851_10045522
656 Ga0068863_100285352
657 Ga0068858_100000216
658 Ga0068862_100007431
659 Ga0081455_10019018
660 Ga0081455_10025380
661 Ga0081455_10052867
662 Ga0081455_10084007
663 Ga0081538_10006138
664 Ga0081538_10054941
665 Ga0081540_1000139
666 Ga0081540_1000306
667 Ga0081539_10000791
668 Ga0081539_10007194
669 Ga0070717_10000013
670 Ga0070717_10038496
671 Ga0070717_10043229
672 Ga0070717_10494672
673 Ga0075365_10006237
674 Ga0075365_10008204
675 Ga0075365_10162159
676 Ga0075363_100052178
677 Ga0075363_100065868
678 Ga0075364_10085526
679 Ga0075364_10207873
680 Ga0075364_10236690
681 Ga0070715_10000001
682 Ga0070716_100144005
683 Ga0070712_100038325
684 Ga0070712_100213587
685 Ga0070712_100234664
686 Ga0070712_100703686
687 Ga0075367_10112681
688 Ga0075367_10136985
689 Ga0075431_100000075
690 Ga0075431_100237253
691 Ga0075431_100411681
692 Ga0075433_10001554
693 Ga0075433_10232383
694 Ga0075434_100184148
695 Ga0075429_100020086
696 Ga0068865_100000160
697 Ga0068865_100104459
698 Ga0105240_10076421
699 Ga0105240_10512525
700 Ga0111539_10033520
701 Ga0105245_10000016
702 Ga0105245_10000456
703 Ga0105245_10006725
704 Ga0105247_10172425
705 Ga0114129_10049265
706 Ga0114129_10120046
707 Ga0114129_10235481
708 Ga0105243_10368892
709 Ga0105242_10001264
710 Ga0105238_10000011
711 Ga0105249_10000068
712 Ga0105249_10020058
713 Ga0105239_10222117
714 Ga0105239_10326893
715 Ga0157369_10000110
716 Ga0157374_10006397
717 Ga0157374_10152658
718 Ga0157378_10102699
719 Ga0157378_10275902
720 Ga0163162_11150621
721 Ga0157375_10001152
722 Ga0157375_10002277
723 Ga0157375_10095826
724 Ga0157375_11283005
725 Ga0157380_10123871
726 Ga0157379_10001717
727 Ga0157379_10045627
728 Ga0163161_10000035
729 Ga0163161_10522932
730 Ga0213873_10025840
731 Ga0213872_10000018
732 Ga0213874_10043004
733 Ga0213874_10055705
734 Ga0213875_10014421
735 Ga0213875_10100575
736 Ga0209563_100005
737 Ga0207656_10000964
738 Ga0207656_10007171
739 Ga0207692_10000005
740 Ga0207642_10000002
741 Ga0207642_10032370
742 Ga0207688_10117132
743 Ga0207680_10013593
744 Ga0207685_10000036
745 Ga0207699_10159301
746 Ga0207705_10090366
747 Ga0207707_10006013
748 Ga0207707_10191347
749 Ga0207695_10054492
750 Ga0207693_10007579
751 Ga0207693_10012330
752 Ga0207693_10185270
753 Ga0207663_10321864
754 Ga0207660_10341277
755 Ga0207652_10005524
756 Ga0207650_10063628
757 Ga0207687_10000007
758 Ga0207687_10000018
759 Ga0207687_10106403
760 Ga0207700_10019771
761 Ga0207664_10057603
762 Ga0207664_10061739
763 Ga0207664_10220453
764 Ga0207664_10465247
765 Ga0207706_10000012
766 Ga0207686_10000033
767 Ga0207686_10171473
768 Ga0207670_10134353
769 Ga0207669_10000012
770 Ga0207704_10001688
771 Ga0207665_10062592
772 Ga0207665_10073256
773 Ga0207661_10000224
774 Ga0207661_10003313
775 Ga0207679_10025440
776 Ga0207712_10093233
777 Ga0207668_10032498
778 Ga0207658_10000789
779 Ga0207677_10000338
780 Ga0207677_10038465
781 Ga0207703_10000023
782 Ga0207639_10004799
783 Ga0207702_10003484
784 Ga0207702_10532308
785 Ga0207648_10000766
786 Ga0207676_10000016
787 Ga0207683_10154163
788 Ga0207683_10315734
789 Ga0207698_10023188
790 Ga0207428_10007128
791 Ga0268266_10000047
792 Ga0268266_10045384
793 Ga0268266_10204706
794 Ga0268264_10013352
795 Ga0265337_1000231
796 Ga0265326_10000007
797 Ga0265326_10000024
798 Ga0265319_1000015
799 Ga0265319_1001582
800 Ga0265334_10000151
801 Ga0265322_10000001
802 Ga0265336_10000622
803 Ga0265336_10040681
804 Ga0265338_10024213
805 Ga0265324_10001009
806 Ga0265324_10012308
807 Ga0265330_10081576
808 Ga0265332_10033616
809 Ga0265320_10000002
810 Ga0265320_10011515
811 Ga0265320_10069240
812 Ga0265329_10026743
813 Ga0265331_10001887
814 Ga0265327_10000011
815 Ga0265327_10008455
816 Ga0265327_10031586
817 Ga0265316_10010658
818 Ga0316579_10021491
819 Ga0265314_10000062
820 Ga0265342_10158331
821 Ga0307410_10027731
822 Ga0307409_100029001
823 Ga0307416_100027340
824 Ga0307415_100038577
825 Ga0373951_0000260
826 Ga0373953_0016408
827 Ga0316574_0187073
828 Ga0373937_0038632
829 Ga0395899_0057335
830 Ga0395899_0092804
831 Ga0395900_0008002
832 Ga0395900_0009508
833 Ga0395900_0015550
834 Ga0395900_0087158
835 Ga0395900_0202835
836 Ga0395900_0377697
837 Ga0395898_0029748
838 Ga0395898_0130861
839 Ga0395898_0160056
840 Ga0395898_0469842
841 Ga0395905_0017484
842 Ga0436364_0055825
843 Ga0436364_0300582
844 Ga0395901_0011233
845 Ga0395901_0019129
846 Ga0395901_0080516
847 Ga0395901_0128188
848 Ga0395901_0990436
849 Ga0436365_0912124
850 Ga0436365_1577946
851 Ga0436361_0677882
852 Ga0436363_0212268
853 Ga0436363_0365326
854 Ga0436363_0918359
855 Ga0436363_1389992
856 Ga0436362_0022934
857 Ga0436362_0760682
858 Ga0436362_0832687
859 Ga0451853_1374451
860 Ga0451577_0031186
861 Ga0451577_0198427
862 Ga0451577_0291704
863 Ga0451577_0343327
864 Ga0451577_0615439
865 Ga0451577_0727847
866 Ga0466969_0008856
867 Ga0453683_0001164
868 Ga0453683_0056062
869 Ga0453683_0091200
870 Ga0453683_0193552
871 Ga0453683_0266712
872 Ga0466965_0166096
873 Ga0466966_0011913
874 Ga0466961_0038370
875 Ga0466963_0000001
876 Ga0466963_0003004
877 Ga0466963_0038385
878 Ga0466963_0106176
879 Ga0466963_0128478
880 Ga0466964_0077639
881 Ga0466964_0188037
882 Ga0453684_0001371
883 Ga0453684_0001389
884 Ga0453684_0009118
885 Ga0453684_0011205
886 Ga0453684_0037293
887 Ga0453684_0056220
888 Ga0453684_0067262
889 Ga0453684_0074077
890 Ga0453684_0128401
891 Ga0453684_0151546
892 Ga0453684_0477469
893 Ga0453684_0626657
894 Ga0466971_0010565
895 Ga0466971_0144939
896 Ga0466968_0006296
897 Ga0466968_0018561
898 Ga0466970_0030338
899 Ga0466970_0067549
900 Ga0466957_0062516
901 Ga0466959_0004786
902 Ga0466959_0006088
903 Ga0466959_0133559
904 Ga0466959_0258762
905 Ga0466959_0334817
906 Ga0451576_0040917
907 Ga0451576_0089980
908 Ga0451576_0126019
909 Ga0451576_0371006
910 Ga0451576_0575739
911 Ga0466958_0003716
912 Ga0466958_0046760
913 Ga0466958_0053180
914 Ga0466958_0143370
915 Ga0466958_0189692
916 Ga0466967_0002063
917 Ga0466967_0004922
918 Ga0466967_0486396
919 Ga0466967_0841128
920 Ga0495592_0181864
921 Ga0495592_0492611
922 Ga0495603_0000030
923 Ga0495603_0109616
924 Ga0495603_0113663
925 Ga0495629_0000272
926 Ga0495629_0007077
927 Ga0495629_0134310
928 Ga0495638_0025573
929 Ga0495641_0000044
930 Ga0495641_0018491
931 Ga0495641_0029640
932 Ga0495651_0329034
933 Ga0495582_0000011
934 Ga0495582_0139870
935 Ga0495662_0000458
936 Ga0495662_0010519
937 Ga0495662_0029864
938 Ga0495664_0074780
939 Ga0495594_0000003
940 Ga0495606_0000752
941 Ga0495608_0000068
942 Ga0495608_0001531
943 Ga0495608_0005242
944 Ga0495610_0049823
945 Ga0495618_0000594
946 Ga0495618_0105036
947 Ga0495620_0000144
948 Ga0495628_0001219
949 Ga0495628_0011925
950 Ga0495628_0014438
951 Ga0495628_0035880
952 Ga0495630_0000056
953 Ga0495644_0000642
954 Ga0495652_0000019
955 Ga0495652_0042721
956 Ga0495652_0146568
957 Ga0495652_0202521
958 Ga0495640_0003352
959 Ga0495640_0006130
960 Ga0495586_0010794
961 Ga0495587_0063045
962 Ga0495587_0185246
963 Ga0495645_0000558
964 Ga0495645_0012086
965 Ga0495622_0000180
966 Ga0495667_0000032
967 Ga0495667_0069189
968 Ga0495668_0093742
969 Ga0495634_0000018
970 Ga0495634_0000247
971 Ga0495634_0013773
972 Ga0495634_0138676
973 Ga0495625_0000696
974 Ga0495635_0078350
975 Ga0495661_0318980
976 Ga0495588_0000165
977 Ga0495657_0000004
978 Ga0495657_0027421
979 Ga0495599_0002223
980 Ga0495599_0042141
981 Ga0495599_0207814
982 Ga0495647_0000008
983 Ga0495647_0000169
984 Ga0495647_0001061
985 Ga0495658_0000005
986 Ga0495658_0015075
987 Ga0495669_0000211
988 Ga0495669_0151554
989 Ga0495613_0000113
990 Ga0495613_0000203
991 Ga0495624_0000267
992 Ga0495624_0158054
993 Ga0495649_0001624
994 Ga0495600_0009841
995 Ga0495600_0036142
996 Ga0495604_0000019
997 Ga0495604_0002470
998 Ga0495604_0135325
999 Ga0495604_0149473
1000 Ga0495604_0323818
1001 Ga0495674_0001564
1002 Ga0495676_0000299
1003 Ga0495676_0008653
1004 Ga0495676_0028282
1005 Ga0495676_0104140
1006 Ga0495676_0155634
1007 Ga0495680_0002092
1008 Ga0495680_0008488
1009 Ga0495680_0072533
1010 Ga0495675_0000107
1011 Ga0495675_0054941
1012 Ga0495679_005703
1013 Ga0495684_0127569
1014 Ga0495684_0225300
1015 Ga0495684_0227011
1016 Ga0495686_0051641
1017 Ga0495686_0156166
1018 Ga0495602_0000208
1019 Ga0495602_0000497
1020 Ga0495602_0131904
1021 Ga0495602_0183526
1022 Ga0495602_0243462
1023 Ga0496100_0000002
1024 Ga0496100_0000018
1025 Ga0496100_0004549
1026 Ga0496101_0000062
1027 Ga0496101_0026996
1028 Ga0496102_0000039
1029 Ga0496102_0047755
1030 Ga0496102_0278156
1031 Ga0496102_0771578
1032 Ga0496103_0000008
1033 Ga0496103_0020259
1034 Ga0496104_0000009
1035 Ga0496104_0000129
1036 Ga0496104_0003364
1037 Ga0496104_0022893
1038 Ga0496104_1050866
1039 Ga0496105_0000007
1040 Ga0496105_0004668
1041 Ga0496105_0030752
1042 Ga0496106_0000145
1043 Ga0496106_0109361
1044 Ga0496106_0115931
1045 Ga0496107_0000006
1046 Ga0496107_0012966
1047 Ga0496107_0192056
1048 Ga0496107_0259900
1049 Ga0496108_0000001
1050 Ga0496108_0000062
1051 Ga0496108_0025918
1052 Ga0496108_0043336
1053 Ga0496109_0000003
1054 Ga0496109_0000007
1055 Ga0496109_0000129
1056 Ga0496109_0001311
1057 Ga0496109_0040263
1058 Ga0496109_0068765
1059 Ga0496109_0212645
1060 Ga0496109_0249793
1061 Ga0496109_0271532
1062 Ga0496110_0000062
1063 Ga0496110_0089308
1064 Ga0496110_0180866
1065 Ga0496110_0337585
1066 Ga0496110_0543651
1067 Ga0496111_0000010
1068 Ga0496111_0027094
1069 Ga0496111_0209635
1070 Ga0496111_0323385
1071 Ga0496111_0560036
1072 Ga0496112_0000003
1073 Ga0496112_0001122
1074 Ga0496112_0434735
1075 Ga0496112_0571658
1076 Ga0496113_0000014
1077 Ga0496113_0041966
1078 Ga0496113_0224415
1079 Ga0496113_0717377
1080 Ga0496114_0000955
1081 Ga0496114_0024543
1082 Ga0496114_0451468
1083 Ga0496115_0000003
1084 Ga0496115_0003578
1085 Ga0496115_0008297
1086 Ga0496125_0258796
1087 Ga0501031_0010454
1088 Ga0501038_0327277
1089 Ga0501039_0037007
1090 Ga0501040_0096609
1091 Ga0501040_0104334
1092 Ga0501041_0009609
1093 Ga0501041_0052755
1094 Ga0501042_0058869
1095 Ga0501042_0086901
1096 Ga0501042_0364997
1097 Ga0501046_0352666
1098 Ga0501047_0249890
1099 Ga0501048_0066425
1100 Ga0501048_0160990
1101 Ga0501067_0029047
1102 Ga0501067_0115524
1103 Ga0501068_0121156
1104 Ga0501069_0119118
1105 Ga0501069_0163959
1106 Ga0501070_0027946
1107 Ga0501070_0029020
1108 Ga0501070_0290932
1109 Ga0501071_0014464
1110 Ga0501071_0113845
1111 Ga0501071_0153457
1112 Ga0501071_0289287
1113 Ga0501071_0329114
1114 Ga0501072_0027817
1115 Ga0501072_0045691
1116 Ga0501072_0198816
1117 Ga0501072_0462607
1118 Ga0501072_0587986
1119 Ga0501073_0052133
1120 Ga0501074_0032506
1121 Ga0501074_0156832
1122 Ga0501075_0001259
1123 Ga0501075_0004081
1124 Ga0501075_0688948
1125 Ga0501076_0019202
1126 Ga0501076_0166890
1127 Ga0501076_0176955
1128 Ga0501077_0030494
1129 Ga0501079_0067582
1130 Ga0501080_0638653
1131 Ga0501081_0061891
1132 Ga0501081_0111508
1133 Ga0501081_0511556
1134 Ga0501044_0390361
1135 Ga0501045_0020945
1136 Ga0501045_0173999
1137 Ga0501045_0330578
1138 Ga0501045_0388074
1139 nmdc:mga03n38_140402_c1
1140 nmdc:mga00v17_190395_c1
1141 nmdc:mga00v17_220815_c1
1142 nmdc:mga00v17_343437_c1
1143 nmdc:mga00v17_46223_c1
1144 nmdc:mga00v17_78056_c1
1145 nmdc:mga0yw44_1248_c1
1146 nmdc:mga0yw44_137046_c1
1147 nmdc:mga0yw44_19826_c1
1148 nmdc:mga0yw44_866_c1
1149 nmdc:mga0yw44_96114_c1
1150 nmdc:mga06z11_227318_c1
1151 nmdc:mga06z11_90436_c1
1152 nmdc:mga05p37_37814_c1
1153 nmdc:mga05p37_97684_c1
1154 nmdc:mga09592_17372_c1
1155 nmdc:mga06r32_244_c1
1156 nmdc:mga08y16_30597_c1
1157 nmdc:mga08y16_717187_c1
1158 nmdc:mga0rr50_36609_c1
1159 nmdc:mga0rr50_430612_c1
1160 nmdc:mga0rr50_615359_c1
1161 nmdc:mga0a205_24_c2
1162 nmdc:mga0a205_285197_c1
1163 Ga0495601_0000013
1164 Ga0495601_0000326
1165 Ga0495601_0015759
1166 Ga0495601_0019131
1167 Ga0495601_0163065
1168 Ga0495601_0183261
1169 Ga0495612_0001299
1170 Ga0495655_0000001
1171 Ga0495655_0002897
1172 Ga0495595_0000003
1173 Ga0495595_0007829
1174 Ga0495619_0000031
1175 Ga0495619_0000106
1176 Ga0495619_0001746
1177 Ga0500566_0024110
1178 Ga0500614_000397
1179 Ga0500628_000010
1180 Ga0501084_0067127
1181 Ga0501084_0073980
1182 Ga0501084_0379288
1183 Ga0501084_0429802
1184 Ga0501082_0073587
1185 Ga0501082_0235884
1186 Ga0501082_0333042
1187 Ga0530510_0006043
1188 Ga0530510_0133718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

42

250

0.82

PF00149

Metallophos

Calcineurin-like phosphoesterase

42

193

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9227 1 246
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9189 1 246
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9161 1 246
3rqz-assembly3.cif.gz_C crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9108 1 246
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9052 1 246
ID Description Score Start End Superfamily
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9174 3 246 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9143 3 246 3.60.21.10
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9098 3 246 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9068 3 246 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7877 2 246 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2W6BGG5-F1-model_v4 Metallophosphoesterase 0.9938 1 246 GO:0005737
GO:0016791
AF-A0A538F5X4-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9926 2 246 GO:0005737
GO:0016791
AF-A0A538LJH1-F1-model_v4 Metallophosphoesterase family protein 0.9925 2 246 GO:0005737
GO:0016791
AF-A0A350MUS2-F1-model_v4 Metallophosphoesterase 0.9923 1 102 GO:0005737
GO:0016791
AF-A0A7W1KAK5-F1-model_v4 Metallophosphoesterase 0.992 1 124 GO:0005737
GO:0016791

Map