F467391

General Info

Members Datasets Scaffolds Average Seq Length
594 276 583 244

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0039991|Ga0501032_0039991_531_1424
Length 285
Sequence MWSRFGATGQQANKLERVSEIGLPGRLRLVTVTPVILDKFRLDDQVAVVTGGGDVGADVVIASRTQSELEAVAEKVRAAGRRAHIVTADLAQPEVTAELAAAAVEAFGRLDIVVNNVGGTMPNGLLTTSTKDLKSAFTFNVATAHALTVAAVPLMLEHSRGGSIINITSTMGRLAGRGFAAYGTAKAALAHYTRLAALDLCPRIRVNAIAPGSIATSALDIVASNDELRAPMEKATPLRRLGEPDEIAAAAVYLASPAGAYLTGKVIEVDGGITFPNLDLPIPDL

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
6 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
7 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
8 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
9 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
10 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
11 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
266 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
267 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
268 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
269 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
270 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
271 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0.17
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.28
Nodule 0.17
Rhizoplane 9.76
Rhizosphere 71.72
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1001627 3300002070 Bacteria 2761
2 JGI24744J21845_10003779 3300002077 Bacteria 3126
3 Ga0055540_1000022 3300003792 Bacteria 201257
4 Ga0055540_1002859 3300003792 Bacteria 8782
5 Ga0055540_1006292 3300003792 Bacteria 4749
6 Ga0070676_10040869 3300005328 Bacteria 2687
7 Ga0070683_100693706 3300005329 Bacteria 975
8 Ga0070690_100009964 3300005330 Bacteria 5515
9 Ga0070666_10010885 3300005335 Bacteria 5699
10 Ga0070666_10109078 3300005335 Bacteria 1913
11 Ga0070680_100184773 3300005336 Bacteria 1756
12 Ga0070682_100001259 3300005337 Bacteria 14382
13 Ga0068868_100000922 3300005338 Bacteria 20013
14 Ga0068868_100026861 3300005338 Bacteria 4389
15 Ga0070660_100022863 3300005339 Bacteria 4629
16 Ga0070689_100090341 3300005340 Bacteria 2413
17 Ga0070691_10072258 3300005341 Bacteria 1676
18 Ga0070668_100015351 3300005347 Bacteria 5724
19 Ga0070668_100419063 3300005347 Bacteria 1146
20 Ga0070669_100161554 3300005353 Bacteria 1741
21 Ga0070669_100343743 3300005353 Bacteria 1210
22 Ga0070671_100003987 3300005355 Bacteria 11629
23 Ga0070671_100161860 3300005355 Bacteria 1892
24 Ga0070674_100000824 3300005356 Bacteria 16007
25 Ga0070674_100024424 3300005356 Bacteria 3922
26 Ga0070673_100267678 3300005364 Bacteria 1495
27 Ga0070688_100005743 3300005365 Bacteria 6558
28 Ga0070659_100014319 3300005366 Bacteria 5925
29 Ga0070667_100000468 3300005367 Bacteria 41520
30 Ga0070667_100021896 3300005367 Bacteria 5304
31 Ga0070667_100029695 3300005367 Bacteria 4557
32 Ga0070667_100059700 3300005367 Bacteria 3226
33 Ga0070667_100468221 3300005367 Bacteria 1153
34 Ga0070703_10053035 3300005406 Bacteria 1303
35 Ga0070713_100087494 3300005436 Bacteria 2672
36 Ga0070710_10010769 3300005437 Bacteria 4498
37 Ga0070711_100002643 3300005439 Bacteria 10261
38 Ga0070711_100007884 3300005439 Bacteria 6492
39 Ga0070705_100013735 3300005440 Bacteria 4148
40 Ga0070700_100073396 3300005441 Bacteria 2190
41 Ga0070663_100203105 3300005455 Bacteria 1548
42 Ga0070678_100003584 3300005456 Bacteria 8665
43 Ga0070678_100007567 3300005456 Bacteria 6452
44 Ga0070662_100009455 3300005457 Bacteria 6374
45 Ga0068867_100006264 3300005459 Bacteria 8415
46 Ga0068867_100141073 3300005459 Bacteria 1883
47 Ga0070685_10060721 3300005466 Bacteria 2211
48 Ga0068853_100011209 3300005539 Bacteria 7276
49 Ga0068853_100249111 3300005539 Bacteria 1629
50 Ga0070686_100396332 3300005544 Bacteria 1049
51 Ga0070695_100032575 3300005545 Bacteria 3259
52 Ga0070693_100005927 3300005547 Bacteria 5909
53 Ga0070693_100144760 3300005547 Bacteria 1500
54 Ga0070665_100004640 3300005548 Bacteria 14364
55 Ga0070665_100041217 3300005548 Bacteria 4641
56 Ga0070665_100162189 3300005548 Bacteria 2237
57 Ga0070704_100005634 3300005549 Bacteria 7311
58 Ga0070704_100289904 3300005549 Bacteria 1359
59 Ga0068855_100207063 3300005563 Bacteria 2206
60 Ga0068855_100446471 3300005563 Bacteria 1412
61 Ga0068854_100002961 3300005578 Bacteria 10532
62 Ga0068856_100129858 3300005614 Bacteria 2524
63 Ga0070702_100003368 3300005615 Bacteria 7138
64 Ga0070702_100080938 3300005615 Bacteria 1945
65 Ga0068852_100055907 3300005616 Bacteria 3408
66 Ga0068852_100086884 3300005616 Bacteria 2789
67 Ga0068859_100022427 3300005617 Bacteria 6330
68 Ga0068859_100093918 3300005617 Bacteria 3051
69 Ga0068864_100383997 3300005618 Bacteria 1332
70 Ga0068866_10002151 3300005718 Bacteria 8204
71 Ga0068866_10019143 3300005718 Bacteria 3109
72 Ga0068861_100001030 3300005719 Bacteria 17064
73 Ga0068861_100148083 3300005719 Bacteria 1923
74 Ga0068863_100003802 3300005841 Bacteria 14920
75 Ga0068863_100224764 3300005841 Bacteria 1809
76 Ga0068863_100348836 3300005841 Bacteria 1441
77 Ga0068858_100018193 3300005842 Bacteria 6580
78 Ga0068858_100054357 3300005842 Bacteria 3703
79 Ga0068860_100000162 3300005843 Bacteria 109869
80 Ga0068860_100009201 3300005843 Bacteria 9817
81 Ga0068860_100154380 3300005843 Bacteria 2212
82 Ga0068862_100000373 3300005844 Bacteria 48546
83 Ga0068862_100002929 3300005844 Bacteria 14925
84 Ga0068862_100084748 3300005844 Bacteria 2753
85 Ga0081455_10089093 3300005937 Bacteria 2505
86 Ga0081540_1142849 3300005983 Bacteria 958
87 Ga0070717_10083227 3300006028 Bacteria 2690
88 Ga0075365_10002471 3300006038 Bacteria 9082
89 Ga0075365_10002721 3300006038 Bacteria 8811
90 Ga0075365_10041323 3300006038 Bacteria 3012
91 Ga0075365_10048800 3300006038 Bacteria 2787
92 Ga0075365_10365096 3300006038 Bacteria 1018
93 Ga0075363_100000238 3300006048 Bacteria 15436
94 Ga0075363_100001805 3300006048 Bacteria 8377
95 Ga0075363_100003662 3300006048 Bacteria 6599
96 Ga0075363_100008701 3300006048 Bacteria 4740
97 Ga0075363_100014674 3300006048 Bacteria 3836
98 Ga0075363_100021045 3300006048 Bacteria 3279
99 Ga0075363_100041612 3300006048 Bacteria 2424
100 Ga0075363_100179870 3300006048 Bacteria 1203
101 Ga0075364_10002158 3300006051 Bacteria 11031
102 Ga0075364_10005306 3300006051 Bacteria 7478
103 Ga0075364_10038615 3300006051 Bacteria 3093
104 Ga0070715_10001652 3300006163 Bacteria 6607
105 Ga0070716_100004752 3300006173 Bacteria 6515
106 Ga0070712_100000457 3300006175 Bacteria 23417
107 Ga0070712_100002193 3300006175 Bacteria 12006
108 Ga0075362_10037191 3300006177 Bacteria 2133
109 Ga0075367_10005805 3300006178 Bacteria 6176
110 Ga0075369_10001821 3300006186 Bacteria 7433
111 Ga0075369_10015279 3300006186 Bacteria 3080
112 Ga0075369_10158510 3300006186 Bacteria 1037
113 Ga0075370_10033040 3300006353 Bacteria 2895
114 Ga0075370_10108497 3300006353 Bacteria 1611
115 Ga0075370_10240575 3300006353 Bacteria 1072
116 Ga0075428_100008627 3300006844 Bacteria 11303
117 Ga0075428_100041708 3300006844 Bacteria 5044
118 Ga0075430_100023002 3300006846 Bacteria 5301
119 Ga0075430_100139091 3300006846 Bacteria 2022
120 Ga0075430_100152415 3300006846 Bacteria 1925
121 Ga0075431_100023204 3300006847 Bacteria 6346
122 Ga0075431_100024742 3300006847 Bacteria 6155
123 Ga0068865_100080172 3300006881 Bacteria 2340
124 Ga0097620_100022431 3300006931 Bacteria 6330
125 Ga0097620_100093918 3300006931 Bacteria 3051
126 Ga0105245_10010356 3300009098 Bacteria 8122
127 Ga0105245_10024506 3300009098 Bacteria 5299
128 Ga0105247_10000079 3300009101 Bacteria 110309
129 Ga0105247_10001160 3300009101 Bacteria 19542
130 Ga0114129_10091723 3300009147 Bacteria 4208
131 Ga0114129_10149018 3300009147 Bacteria 3203
132 Ga0105243_10001175 3300009148 Bacteria 23704
133 Ga0105241_10087754 3300009174 Bacteria 2449
134 Ga0105241_10094089 3300009174 Bacteria 2369
135 Ga0105241_10146441 3300009174 Bacteria 1928
136 Ga0105242_10002885 3300009176 Bacteria 13454
137 Ga0105242_10289906 3300009176 Bacteria 1490
138 Ga0105242_10591979 3300009176 Bacteria 1070
139 Ga0105248_10000827 3300009177 Bacteria 34797
140 Ga0105248_10005516 3300009177 Bacteria 13894
141 Ga0105248_10010987 3300009177 Bacteria 9990
142 Ga0105248_10329234 3300009177 Bacteria 1720
143 Ga0105237_10023699 3300009545 Bacteria 6284
144 Ga0105237_10298016 3300009545 Bacteria 1615
145 Ga0105238_10241940 3300009551 Bacteria 1782
146 Ga0105249_10000098 3300009553 Bacteria 120091
147 Ga0105249_10017037 3300009553 Bacteria 6448
148 Ga0105249_10043013 3300009553 Bacteria 4109
149 Ga0105239_10004540 3300010375 Bacteria 16544
150 Ga0105239_10025074 3300010375 Bacteria 6569
151 Ga0105239_10030638 3300010375 Bacteria 5917
152 Ga0105239_10056707 3300010375 Bacteria 4297
153 Ga0105239_10084138 3300010375 Bacteria 3504
154 Ga0105239_10384234 3300010375 Bacteria 1587
155 Ga0105246_10314727 3300011119 Bacteria 1269
156 Ga0157369_10068402 3300013105 Bacteria 3816
157 Ga0157374_10044464 3300013296 Bacteria 4105
158 Ga0157378_10004599 3300013297 Bacteria 12106
159 Ga0163162_10007329 3300013306 Bacteria 10718
160 Ga0163162_10040659 3300013306 Bacteria 4651
161 Ga0163162_10141992 3300013306 Bacteria 2515
162 Ga0163162_10291583 3300013306 Bacteria 1763
163 Ga0157372_10562430 3300013307 Bacteria 1329
164 Ga0157372_10657375 3300013307 Bacteria 1220
165 Ga0157375_10025498 3300013308 Bacteria 5494
166 Ga0163163_10029438 3300014325 Bacteria 5282
167 Ga0163163_10085577 3300014325 Bacteria 3161
168 Ga0157380_10001639 3300014326 Bacteria 14742
169 Ga0157379_10010784 3300014968 Bacteria 7965
170 Ga0157379_10031573 3300014968 Bacteria 4720
171 Ga0157379_10848508 3300014968 Bacteria 864
172 Ga0157376_10013139 3300014969 Bacteria 6170
173 Ga0163161_10045230 3300017792 Bacteria 3174
174 Ga0206353_11119700 3300020082 Bacteria 6705
175 Ga0213876_10017730 3300021384 Bacteria 3757
176 Ga0213876_10079661 3300021384 Bacteria 1731
177 Ga0213875_10005783 3300021388 Bacteria 6584
178 Ga0209673_1031346 3300025273 Bacteria 1656
179 Ga0209051_1000033 3300025303 Bacteria 380540
180 Ga0209051_1000539 3300025303 Bacteria 46616
181 Ga0209051_1001358 3300025303 Bacteria 21222
182 Ga0209051_1006667 3300025303 Bacteria 6460
183 Ga0209051_1017772 3300025303 Bacteria 3168
184 Ga0207656_10165933 3300025321 Bacteria 1053
185 Ga0207653_10033310 3300025885 Bacteria 1671
186 Ga0207692_10015660 3300025898 Bacteria 3342
187 Ga0207692_10181386 3300025898 Bacteria 1227
188 Ga0207642_10001918 3300025899 Bacteria 6412
189 Ga0207710_10000022 3300025900 Bacteria 335632
190 Ga0207710_10022200 3300025900 Bacteria 2724
191 Ga0207688_10004769 3300025901 Bacteria 7386
192 Ga0207688_10028820 3300025901 Bacteria 3054
193 Ga0207680_10053744 3300025903 Bacteria 2419
194 Ga0207647_10005286 3300025904 Bacteria 9494
195 Ga0207647_10017481 3300025904 Bacteria 4875
196 Ga0207685_10095156 3300025905 Bacteria 1263
197 Ga0207685_10165541 3300025905 Bacteria 1013
198 Ga0207643_10067126 3300025908 Bacteria 2058
199 Ga0207654_10061379 3300025911 Bacteria 2199
200 Ga0207695_10256817 3300025913 Bacteria 1646
201 Ga0207671_10173534 3300025914 Bacteria 1675
202 Ga0207693_10000670 3300025915 Bacteria 30783
203 Ga0207693_10004661 3300025915 Bacteria 11556
204 Ga0207660_10428293 3300025917 Bacteria 1068
205 Ga0207657_10038571 3300025919 Bacteria 4251
206 Ga0207681_10011031 3300025923 Bacteria 5550
207 Ga0207681_10091800 3300025923 Bacteria 2170
208 Ga0207687_10004852 3300025927 Bacteria 8939
209 Ga0207687_10014059 3300025927 Bacteria 5233
210 Ga0207700_10636453 3300025928 Bacteria 950
211 Ga0207644_10084779 3300025931 Bacteria 2349
212 Ga0207644_10329499 3300025931 Bacteria 1236
213 Ga0207690_10040051 3300025932 Bacteria 3061
214 Ga0207706_10018429 3300025933 Bacteria 6281
215 Ga0207686_10004278 3300025934 Bacteria 7655
216 Ga0207709_10035252 3300025935 Bacteria 2957
217 Ga0207709_10042607 3300025935 Bacteria 2732
218 Ga0207670_10272318 3300025936 Bacteria 1316
219 Ga0207669_10008030 3300025937 Bacteria 4931
220 Ga0207704_10003790 3300025938 Bacteria 6887
221 Ga0207704_10185232 3300025938 Bacteria 1508
222 Ga0207665_10002055 3300025939 Bacteria 13566
223 Ga0207665_10009512 3300025939 Bacteria 6384
224 Ga0207691_10254089 3300025940 Bacteria 1516
225 Ga0207711_10000404 3300025941 Bacteria 45690
226 Ga0207711_10009036 3300025941 Bacteria 8329
227 Ga0207689_10042623 3300025942 Bacteria 3753
228 Ga0207689_10063204 3300025942 Bacteria 3045
229 Ga0207661_10626111 3300025944 Bacteria 988
230 Ga0207667_10359076 3300025949 Bacteria 1486
231 Ga0207712_10000076 3300025961 Bacteria 120445
232 Ga0207712_10003329 3300025961 Bacteria 10187
233 Ga0207712_10341025 3300025961 Bacteria 1243
234 Ga0207668_10009507 3300025972 Bacteria 5833
235 Ga0207668_10105536 3300025972 Bacteria 2103
236 Ga0207640_10200705 3300025981 Bacteria 1511
237 Ga0207640_10401320 3300025981 Bacteria 1117
238 Ga0207658_10000821 3300025986 Bacteria 25967
239 Ga0207658_10004195 3300025986 Bacteria 10041
240 Ga0207658_10004895 3300025986 Bacteria 9240
241 Ga0207677_10006552 3300026023 Bacteria 6392
242 Ga0207677_10041306 3300026023 Bacteria 3048
243 Ga0207703_10007364 3300026035 Bacteria 8744
244 Ga0207703_10023871 3300026035 Bacteria 4809
245 Ga0207703_10097769 3300026035 Bacteria 2481
246 Ga0207703_10329681 3300026035 Bacteria 1400
247 Ga0207639_10009810 3300026041 Bacteria 6617
248 Ga0207639_10104734 3300026041 Bacteria 2294
249 Ga0207639_10173878 3300026041 Bacteria 1826
250 Ga0207678_10005038 3300026067 Bacteria 11849
251 Ga0207678_10162133 3300026067 Bacteria 1909
252 Ga0207708_10073578 3300026075 Bacteria 2619
253 Ga0207708_10102666 3300026075 Bacteria 2214
254 Ga0207641_10002622 3300026088 Bacteria 16486
255 Ga0207641_10017231 3300026088 Bacteria 5912
256 Ga0207641_10027295 3300026088 Bacteria 4715
257 Ga0207648_10003535 3300026089 Bacteria 16339
258 Ga0207674_10392301 3300026116 Bacteria 1342
259 Ga0207675_100007414 3300026118 Bacteria 10366
260 Ga0207675_100197897 3300026118 Bacteria 1929
261 Ga0207683_10001111 3300026121 Bacteria 24444
262 Ga0207698_10010836 3300026142 Bacteria 5884
263 Ga0207428_10349655 3300027907 Bacteria 1088
264 Ga0268266_10021614 3300028379 Bacteria 5481
265 Ga0268266_10025370 3300028379 Bacteria 5042
266 Ga0268266_10152793 3300028379 Bacteria 2082
267 Ga0268266_10279667 3300028379 Bacteria 1551
268 Ga0268265_10000368 3300028380 Bacteria 48834
269 Ga0268265_10009210 3300028380 Bacteria 6673
270 Ga0268264_10000017 3300028381 Bacteria 498037
271 Ga0268264_10017083 3300028381 Bacteria 5941
272 Ga0268264_10089136 3300028381 Bacteria 2656
273 Ga0265338_10127190 3300028800 Bacteria 2020
274 Ga0265327_10000019 3300031251 Bacteria 427653
275 Ga0265327_10000304 3300031251 Bacteria 95401
276 Ga0265327_10004677 3300031251 Bacteria 11980
277 Ga0265327_10056074 3300031251 Bacteria 2032
278 Ga0265327_10064963 3300031251 Bacteria 1847
279 Ga0307413_10066399 3300031824 Bacteria 2251
280 Ga0307413_10165548 3300031824 Bacteria 1559
281 Ga0307410_10006678 3300031852 Bacteria 6247
282 Ga0307410_10116885 3300031852 Bacteria 1939
283 Ga0307407_10197006 3300031903 Bacteria 1347
284 Ga0307409_100096110 3300031995 Bacteria 2443
285 Ga0307409_100114372 3300031995 Bacteria 2270
286 Ga0307416_100030418 3300032002 Bacteria 4051
287 Ga0307411_10117347 3300032005 Bacteria 1918
288 Ga0316583_10071371 3300032133 Bacteria 1215
289 Ga0373938_0051663 3300034957 Bacteria 941
290 Ga0373932_0077310 3300035112 Bacteria 1044
291 Ga0373939_0080994 3300035114 Bacteria 1078
292 Ga0373931_0072809 3300035691 Bacteria 1880
293 Ga0373931_0083081 3300035691 Bacteria 1771
294 Ga0373931_0115090 3300035691 Bacteria 1530
295 Ga0316584_0038322 3300036712 Bacteria 3565
296 Ga0395900_0248571 3300037418 Bacteria 1781
297 Ga0436364_1073926 3300037853 Bacteria 9666
298 Ga0436364_1439348 3300037853 Bacteria 29283
299 Ga0436365_0503789 3300039437 Bacteria 3808
300 Ga0436365_0508192 3300039437 Bacteria 28264
301 Ga0436365_0671847 3300039437 Bacteria 34209
302 Ga0436365_1434130 3300039437 Bacteria 9079
303 Ga0439461_0007687 3300041410 Bacteria 1916
304 Ga0439466_0009966 3300041411 Bacteria 3535
305 Ga0439466_0020894 3300041411 Bacteria 2328
306 Ga0439465_0004772 3300041413 Bacteria 4365
307 Ga0439465_0006799 3300041413 Bacteria 3635
308 Ga0439465_0026897 3300041413 Bacteria 1820
309 Ga0451791_0634884 3300041451 Bacteria 1069
310 Ga0439431_0003816 3300041997 Bacteria 3330
311 Ga0439431_0034436 3300041997 Bacteria 1269
312 Ga0439445_0077969 3300042004 Bacteria 923
313 Ga0439448_0110098 3300042005 Bacteria 940
314 Ga0439434_0002598 3300042435 Bacteria 5259
315 Ga0439434_0028861 3300042435 Bacteria 1681
316 Ga0439434_0064715 3300042435 Bacteria 1147
317 Ga0466969_0027309 3300044656 Bacteria 2923
318 Ga0466969_0110056 3300044656 Bacteria 1290
319 Ga0466969_0113878 3300044656 Bacteria 1264
320 Ga0466969_0115538 3300044656 Bacteria 1253
321 Ga0466972_0003512 3300044658 Bacteria 7782
322 Ga0466972_0025419 3300044658 Bacteria 2936
323 Ga0466972_0067538 3300044658 Bacteria 1708
324 Ga0466972_0086447 3300044658 Bacteria 1490
325 Ga0466972_0096326 3300044658 Bacteria 1402
326 Ga0466972_0102115 3300044658 Bacteria 1357
327 Ga0466972_0208192 3300044658 Bacteria 915
328 Ga0466965_0021177 3300044683 Bacteria 3128
329 Ga0466965_0161592 3300044683 Bacteria 1175
330 Ga0466965_0278062 3300044683 Bacteria 903
331 Ga0466966_0003611 3300044684 Bacteria 10207
332 Ga0466966_0025745 3300044684 Bacteria 3843
333 Ga0466966_0062036 3300044684 Bacteria 2357
334 Ga0466961_0004127 3300044693 Bacteria 9071
335 Ga0466961_0008888 3300044693 Bacteria 6407
336 Ga0466961_0011105 3300044693 Bacteria 5757
337 Ga0466961_0023700 3300044693 Bacteria 3949
338 Ga0466961_0029827 3300044693 Bacteria 3504
339 Ga0466961_0039689 3300044693 Bacteria 3018
340 Ga0466961_0329552 3300044693 Bacteria 930
341 Ga0466963_0042462 3300044694 Bacteria 2986
342 Ga0466963_0071212 3300044694 Bacteria 2340
343 Ga0466963_0086971 3300044694 Bacteria 2125
344 Ga0466963_0151499 3300044694 Bacteria 1610
345 Ga0466963_0169314 3300044694 Bacteria 1522
346 Ga0466963_0174191 3300044694 Bacteria 1501
347 Ga0466963_0235965 3300044694 Bacteria 1282
348 Ga0466963_0342972 3300044694 Bacteria 1052
349 Ga0466964_0023951 3300044706 Bacteria 2376
350 Ga0466964_0026321 3300044706 Bacteria 2277
351 Ga0466971_0012476 3300044719 Bacteria 3726
352 Ga0466971_0105113 3300044719 Bacteria 1300
353 Ga0466971_0168055 3300044719 Bacteria 1028
354 Ga0466968_0004756 3300044735 Bacteria 5084
355 Ga0466968_0027711 3300044735 Bacteria 2332
356 Ga0466968_0031370 3300044735 Bacteria 2205
357 Ga0466968_0037257 3300044735 Bacteria 2040
358 Ga0466970_0012795 3300044765 Bacteria 4295
359 Ga0466970_0018798 3300044765 Bacteria 3580
360 Ga0466970_0021151 3300044765 Bacteria 3387
361 Ga0466957_0002052 3300044842 Bacteria 10765
362 Ga0466957_0077047 3300044842 Bacteria 2071
363 Ga0466957_0119630 3300044842 Bacteria 1678
364 Ga0466960_0000255 3300044901 Bacteria 18324
365 Ga0466960_0000500 3300044901 Bacteria 13409
366 Ga0466960_0047020 3300044901 Bacteria 2068
367 Ga0466960_0080001 3300044901 Bacteria 1645
368 Ga0466960_0081028 3300044901 Bacteria 1636
369 Ga0466960_0268522 3300044901 Bacteria 953
370 Ga0466959_0003887 3300045049 Bacteria 9913
371 Ga0466959_0006506 3300045049 Bacteria 8099
372 Ga0466959_0093267 3300045049 Bacteria 2161
373 Ga0466959_0185313 3300045049 Bacteria 1454
374 Ga0466958_0007640 3300045836 Bacteria 5958
375 Ga0466958_0020589 3300045836 Bacteria 3849
376 Ga0466958_0039727 3300045836 Bacteria 2827
377 Ga0466958_0079229 3300045836 Bacteria 2020
378 Ga0466958_0085825 3300045836 Bacteria 1942
379 Ga0466958_0261465 3300045836 Bacteria 1108
380 Ga0466958_0327659 3300045836 Bacteria 985
381 Ga0466967_0009518 3300045976 Bacteria 7215
382 Ga0466967_0016140 3300045976 Bacteria 5879
383 Ga0466967_0057992 3300045976 Bacteria 3420
384 Ga0466967_0081217 3300045976 Bacteria 2928
385 Ga0466967_0093973 3300045976 Bacteria 2730
386 Ga0466967_0109259 3300045976 Bacteria 2539
387 Ga0466967_0114801 3300045976 Bacteria 2479
388 Ga0466967_0167721 3300045976 Bacteria 2064
389 Ga0466967_0186686 3300045976 Bacteria 1958
390 Ga0466967_0616656 3300045976 Bacteria 1071
391 Ga0466967_0837882 3300045976 Bacteria 914
392 Ga0495603_0015662 3300046455 Bacteria 4587
393 Ga0495629_0024600 3300046459 Bacteria 4288
394 Ga0495597_0150517 3300046542 Bacteria 955
395 Ga0495646_0167664 3300046680 Bacteria 1212
396 Ga0495649_0160733 3300046694 Bacteria 1178
397 Ga0495674_0014565 3300047319 Bacteria 7358
398 Ga0495686_0000930 3300047472 Bacteria 36471
399 Ga0496100_0000097 3300048903 Bacteria 50092
400 Ga0496100_0005457 3300048903 Bacteria 6851
401 Ga0496100_0010001 3300048903 Bacteria 5355
402 Ga0496100_0021103 3300048903 Bacteria 3917
403 Ga0496100_0052629 3300048903 Bacteria 2648
404 Ga0496101_0000032 3300048904 Bacteria 186783
405 Ga0496101_0000974 3300048904 Bacteria 16918
406 Ga0496101_0001023 3300048904 Bacteria 16494
407 Ga0496101_0043222 3300048904 Bacteria 3220
408 Ga0496101_0079820 3300048904 Bacteria 2416
409 Ga0496101_0180101 3300048904 Bacteria 1627
410 Ga0496101_0340009 3300048904 Bacteria 1179
411 Ga0496102_0000721 3300048905 Bacteria 32596
412 Ga0496102_0001591 3300048905 Bacteria 20026
413 Ga0496102_0003704 3300048905 Bacteria 12920
414 Ga0496102_0004723 3300048905 Bacteria 11535
415 Ga0496102_0040122 3300048905 Bacteria 4233
416 Ga0496102_0058888 3300048905 Bacteria 3511
417 Ga0496102_0159977 3300048905 Bacteria 2118
418 Ga0496103_0000649 3300048906 Bacteria 26319
419 Ga0496103_0000801 3300048906 Bacteria 23137
420 Ga0496103_0001216 3300048906 Bacteria 17663
421 Ga0496103_0215664 3300048906 Bacteria 1234
422 Ga0496104_0011989 3300048907 Bacteria 7776
423 Ga0496104_0025387 3300048907 Bacteria 5462
424 Ga0496104_0084672 3300048907 Bacteria 3026
425 Ga0496104_0143935 3300048907 Bacteria 2290
426 Ga0496105_0205313 3300048908 Bacteria 1607
427 Ga0496106_0006414 3300048909 Bacteria 8710
428 Ga0496106_0008971 3300048909 Bacteria 7387
429 Ga0496106_0009704 3300048909 Bacteria 7107
430 Ga0496106_0042972 3300048909 Bacteria 3390
431 Ga0496106_0343098 3300048909 Bacteria 1199
432 Ga0496107_0000522 3300048910 Bacteria 21371
433 Ga0496107_0001241 3300048910 Bacteria 15581
434 Ga0496107_0011211 3300048910 Bacteria 6238
435 Ga0496108_0002487 3300048911 Bacteria 14750
436 Ga0496109_0000030 3300048912 Bacteria 164120
437 Ga0496109_0007926 3300048912 Bacteria 9004
438 Ga0496109_0070666 3300048912 Bacteria 3204
439 Ga0496110_0021281 3300048913 Bacteria 5488
440 Ga0496110_0075992 3300048913 Bacteria 2985
441 Ga0496110_0084483 3300048913 Bacteria 2833
442 Ga0496111_0001243 3300048914 Bacteria 14263
443 Ga0496112_0010711 3300048915 Bacteria 8335
444 Ga0496112_0025035 3300048915 Bacteria 5725
445 Ga0496112_0098286 3300048915 Bacteria 2897
446 Ga0496112_0526786 3300048915 Bacteria 1116
447 Ga0496113_0066460 3300048916 Bacteria 2731
448 Ga0496113_0134842 3300048916 Bacteria 1939
449 Ga0496114_0000187 3300048917 Bacteria 44786
450 Ga0496114_0002134 3300048917 Bacteria 15039
451 Ga0496114_0004401 3300048917 Bacteria 10924
452 Ga0496115_0009045 3300048918 Bacteria 7389
453 Ga0496115_0091246 3300048918 Bacteria 2490
454 Ga0496115_0244842 3300048918 Bacteria 1477
455 Ga0496115_0593484 3300048918 Bacteria 881
456 Ga0496116_0004962 3300048919 Bacteria 12540
457 Ga0496116_0026632 3300048919 Bacteria 4223
458 Ga0496117_0002717 3300048920 Bacteria 21755
459 Ga0496117_0072826 3300048920 Bacteria 2294
460 Ga0496118_0004669 3300048921 Bacteria 16062
461 Ga0496118_0077676 3300048921 Bacteria 2353
462 Ga0496118_0084087 3300048921 Bacteria 2222
463 Ga0496119_0008172 3300048922 Bacteria 9261
464 Ga0496119_0022623 3300048922 Bacteria 4491
465 Ga0496120_0002518 3300048923 Bacteria 18325
466 Ga0496121_0000004 3300048924 Bacteria 1139011
467 Ga0496121_0005473 3300048924 Bacteria 16258
468 Ga0496122_0000173 3300048925 Bacteria 153768
469 Ga0496122_0008989 3300048925 Bacteria 10619
470 Ga0496123_0003164 3300048926 Bacteria 18798
471 Ga0496123_0014807 3300048926 Bacteria 6438
472 Ga0496124_0000012 3300048927 Bacteria 512581
473 Ga0496125_0000003 3300048928 Bacteria 1189767
474 Ga0496125_0024973 3300048928 Bacteria 5482
475 Ga0496126_0000001 3300048929 Bacteria 1139011
476 Ga0496126_0003985 3300048929 Bacteria 18036
477 Ga0496126_0057396 3300048929 Bacteria 3514
478 Ga0496126_0447091 3300048929 Bacteria 1041
479 Ga0501031_0018093 3300049568 Bacteria 4583
480 Ga0501031_0147560 3300049568 Bacteria 1537
481 Ga0501032_0006176 3300049569 Bacteria 8817
482 Ga0501032_0039153 3300049569 Bacteria 3225
483 Ga0501032_0039991 3300049569 Bacteria 3188
484 Ga0501033_0000478 3300049570 Bacteria 37805
485 Ga0501033_0019305 3300049570 Bacteria 5153
486 Ga0501033_0080229 3300049570 Bacteria 2394
487 Ga0501033_0189790 3300049570 Bacteria 1471
488 Ga0501034_0035492 3300049571 Bacteria 5055
489 Ga0501034_0038548 3300049571 Bacteria 4838
490 Ga0501034_0070774 3300049571 Bacteria 3499
491 Ga0501034_0080779 3300049571 Bacteria 3254
492 Ga0501034_0680644 3300049571 Bacteria 928
493 Ga0501036_0153544 3300049572 Bacteria 1942
494 Ga0501036_0327299 3300049572 Bacteria 1280
495 Ga0501037_0001327 3300049573 Bacteria 18165
496 Ga0501037_0015220 3300049573 Bacteria 5660
497 Ga0501037_0071522 3300049573 Bacteria 2523
498 Ga0501037_0100363 3300049573 Bacteria 2090
499 Ga0501038_0000163 3300049574 Bacteria 56384
500 Ga0501038_0017898 3300049574 Bacteria 6402
501 Ga0501039_0002905 3300049575 Bacteria 12821
502 Ga0501039_0203138 3300049575 Bacteria 1558
503 Ga0501043_0083316 3300049579 Bacteria 2514
504 Ga0501043_0241455 3300049579 Bacteria 1393
505 Ga0501043_0349246 3300049579 Bacteria 1124
506 Ga0501046_0006533 3300049580 Bacteria 10311
507 Ga0501046_0287422 3300049580 Bacteria 1203
508 Ga0501047_0000405 3300049581 Bacteria 48286
509 Ga0501047_0001872 3300049581 Bacteria 20254
510 Ga0501047_0004633 3300049581 Bacteria 12942
511 Ga0501047_0019351 3300049581 Bacteria 6532
512 Ga0501047_0087649 3300049581 Bacteria 2990
513 Ga0501047_0164047 3300049581 Bacteria 2093
514 Ga0501047_0378488 3300049581 Bacteria 1250
515 Ga0501048_0000286 3300049582 Bacteria 34220
516 Ga0501048_0031512 3300049582 Bacteria 3835
517 Ga0501069_0056855 3300049585 Bacteria 2180
518 Ga0501069_0067320 3300049585 Bacteria 2003
519 Ga0501070_0000165 3300049586 Bacteria 60736
520 Ga0501070_0011898 3300049586 Bacteria 7349
521 Ga0501070_0077470 3300049586 Bacteria 2752
522 Ga0501070_0098286 3300049586 Bacteria 2421
523 Ga0501070_0255872 3300049586 Bacteria 1432
524 Ga0501070_0265771 3300049586 Bacteria 1402
525 Ga0501073_0081373 3300049589 Bacteria 2253
526 Ga0501073_0143453 3300049589 Bacteria 1655
527 Ga0501073_0196497 3300049589 Bacteria 1395
528 Ga0501080_0089528 3300049742 Bacteria 2859
529 Ga0501080_0324098 3300049742 Bacteria 1394
530 Ga0501080_0331512 3300049742 Bacteria 1376
531 Ga0501083_0050100 3300049744 Bacteria 2812
532 Ga0501035_0000283 3300049822 Bacteria 60218
533 Ga0501035_0000982 3300049822 Bacteria 30177
534 Ga0501035_0031548 3300049822 Bacteria 4825
535 Ga0501035_0065896 3300049822 Bacteria 3215
536 Ga0501035_0101788 3300049822 Bacteria 2521
537 Ga0501044_0001287 3300049823 Bacteria 29635
538 Ga0501044_0005780 3300049823 Bacteria 13692
539 Ga0501044_0008797 3300049823 Bacteria 11044
540 Ga0501044_0043238 3300049823 Bacteria 4682
541 Ga0501044_0271750 3300049823 Bacteria 1630
542 nmdc:mga03683_21602_c1 3300050489 Bacteria 2484
543 nmdc:mga03n38_12377_c1 3300050490 Bacteria 3208
544 nmdc:mga03n38_2073_c1 3300050490 Bacteria 6062
545 nmdc:mga03n38_23660_c1 3300050490 Bacteria 2503
546 nmdc:mga03n38_28617_c1 3300050490 Bacteria 2325
547 nmdc:mga03n38_3566_c1 3300050490 Bacteria 5021
548 nmdc:mga03n38_6506_c1 3300050490 Bacteria 4064
549 nmdc:mga03n38_83752_c1 3300050490 Bacteria 1504
550 nmdc:mga00v17_16677_c1 3300050491 Bacteria 4143
551 nmdc:mga00v17_18704_c1 3300050491 Bacteria 3941
552 nmdc:mga00v17_28982_c1 3300050491 Bacteria 3246
553 nmdc:mga00v17_40503_c1 3300050491 Bacteria 2795
554 nmdc:mga00v17_9337_c1 3300050491 Bacteria 5302
555 nmdc:mga0yw44_288_c1 3300050492 Bacteria 17355
556 nmdc:mga0yw44_365965_c1 3300050492 Bacteria 972
557 nmdc:mga06z11_127387_c1 3300050494 Bacteria 1426
558 nmdc:mga04h51_121882_c1 3300050495 Bacteria 972
559 nmdc:mga07m45_1835_c1 3300050496 Bacteria 9808
560 nmdc:mga07m45_24829_c1 3300050496 Bacteria 3286
561 nmdc:mga07m45_278323_c1 3300050496 Bacteria 973
562 nmdc:mga05p37_407419_c1 3300050507 Bacteria 1586
563 nmdc:mga0qj67_220197_c1 3300050509 Bacteria 1541
564 nmdc:mga0qj67_30288_c1 3300050509 Bacteria 4210
565 nmdc:mga08y16_464748_c1 3300050511 Bacteria 1289
566 nmdc:mga0sz30_4590_c1 3300050516 Bacteria 5003
567 nmdc:mga0sz30_54866_c1 3300050516 Bacteria 1695
568 nmdc:mga0sz30_97732_c1 3300050516 Bacteria 1281
569 Ga0500610_0020380 3300053079 Bacteria 3237
570 Ga0500635_0003085 3300053080 Bacteria 4166
571 Ga0495655_0034083 3300053083 Bacteria 1257
572 Ga0500643_004478 3300053087 Bacteria 6307
573 Ga0500643_048298 3300053087 Bacteria 1224
574 Ga0500650_0188836 3300053098 Bacteria 942
575 Ga0500556_0003445 3300053104 Bacteria 4658
576 Ga0500652_001400 3300053131 Bacteria 7518
577 Ga0500568_0049560 3300053139 Bacteria 1657
578 Ga0500616_0004390 3300053153 Bacteria 10074
579 Ga0500627_0111788 3300053158 Bacteria 1230
580 Ga0500645_000025 3300053730 Bacteria 125835
581 Ga0466962_0024764 3300061719 Bacteria 2882
582 Ga0466962_0031944 3300061719 Bacteria 2521
583 Ga0466962_0165997 3300061719 Bacteria 1074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0018093 Ga0501031_0018093_2360_3151 193
2 3300049569 Ga0501032_0039153 Ga0501032_0039153_606_1397 193
3 3300049571 Ga0501034_0070774 Ga0501034_0070774_445_1236 193
4 3300049572 Ga0501036_0153544 Ga0501036_0153544_168_959 193
5 3300049573 Ga0501037_0015220 Ga0501037_0015220_4017_4808 193
6 3300049574 Ga0501038_0000163 Ga0501038_0000163_39684_40475 193
7 3300049575 Ga0501039_0203138 Ga0501039_0203138_354_1145 193
8 3300049579 Ga0501043_0083316 Ga0501043_0083316_182_973 193
9 3300049580 Ga0501046_0287422 Ga0501046_0287422_148_939 193
10 3300049581 Ga0501047_0001872 Ga0501047_0001872_8195_8986 193
11 3300049582 Ga0501048_0000286 Ga0501048_0000286_13663_14454 193
12 3300049586 Ga0501070_0011898 Ga0501070_0011898_6509_7300 193
13 3300049822 Ga0501035_0031548 Ga0501035_0031548_3306_4097 193
14 3300044694 Ga0466963_0042462 Ga0466963_0042462_1154_1948 210
15 3300044719 Ga0466971_0105113 Ga0466971_0105113_269_1063 210
16 3300045836 Ga0466958_0039727 Ga0466958_0039727_1745_2539 210
17 3300006038 Ga0075365_10002471 Ga0075365_100024715 212
18 3300050492 nmdc:mga0yw44_288_c1 nmdc:mga0yw44_288_c1_4635_5426 212
19 3300045976 Ga0466967_0837882 Ga0466967_0837882_94_885 218
20 3300006844 Ga0075428_100008627 Ga0075428_1000086272 220
21 3300006846 Ga0075430_100023002 Ga0075430_1000230022 220
22 3300006847 Ga0075431_100023204 Ga0075431_1000232043 220
23 3300009147 Ga0114129_10091723 Ga0114129_100917233 220
24 3300042005 Ga0439448_0110098 Ga0439448_0110098_170_919 220
25 3300050507 nmdc:mga05p37_407419_c1 nmdc:mga05p37_407419_c1_682_1470 220
26 3300050509 nmdc:mga0qj67_30288_c1 nmdc:mga0qj67_30288_c1_2039_2827 220
27 3300049742 Ga0501080_0324098 Ga0501080_0324098_313_1104 221
28 3300026041 Ga0207639_10173878 Ga0207639_101738782 222
29 3300037418 Ga0395900_0248571 Ga0395900_0248571_433_1224 223
30 3300041451 Ga0451791_0634884 Ga0451791_0634884_37_753 223
31 3300042435 Ga0439434_0064715 Ga0439434_0064715_43_759 223
32 3300044683 Ga0466965_0278062 Ga0466965_0278062_29_745 223
33 3300044765 Ga0466970_0021151 Ga0466970_0021151_2012_2728 223
34 3300048905 Ga0496102_0004723 Ga0496102_0004723_10508_11224 223
35 3300048907 Ga0496104_0011989 Ga0496104_0011989_307_1023 223
36 3300048913 Ga0496110_0084483 Ga0496110_0084483_463_1179 223
37 3300048915 Ga0496112_0098286 Ga0496112_0098286_49_765 223
38 3300050490 nmdc:mga03n38_6506_c1 nmdc:mga03n38_6506_c1_3327_4043 223
39 3300050494 nmdc:mga06z11_127387_c1 nmdc:mga06z11_127387_c1_562_1278 223
40 3300044694 Ga0466963_0086971 Ga0466963_0086971_91_885 224
41 3300010375 Ga0105239_10084138 Ga0105239_100841382 227
42 3300011119 Ga0105246_10314727 Ga0105246_103147272 227
43 3300014325 Ga0163163_10085577 Ga0163163_100855772 227
44 3300048911 Ga0496108_0002487 Ga0496108_0002487_4601_5371 227
45 3300048912 Ga0496109_0007926 Ga0496109_0007926_4565_5335 227
46 3300048913 Ga0496110_0021281 Ga0496110_0021281_4406_5176 227
47 3300048915 Ga0496112_0010711 Ga0496112_0010711_2406_3176 227
48 3300050490 nmdc:mga03n38_2073_c1 nmdc:mga03n38_2073_c1_3003_3773 227
49 3300053083 Ga0495655_0034083 Ga0495655_0034083_113_883 227
50 3300049586 Ga0501070_0255872 Ga0501070_0255872_432_1223 228
51 iso_pu_bacteria 2866612099 2866613352 229
52 3300003792 Ga0055540_1006292 Ga0055540_10062923 230
53 3300005937 Ga0081455_10089093 Ga0081455_100890932 230
54 3300006038 Ga0075365_10041323 Ga0075365_100413233 230
55 3300006048 Ga0075363_100000238 Ga0075363_1000002382 230
56 3300006051 Ga0075364_10002158 Ga0075364_100021585 230
57 3300006186 Ga0075369_10015279 Ga0075369_100152793 230
58 3300006353 Ga0075370_10240575 Ga0075370_102405751 230
59 3300025273 Ga0209673_1031346 Ga0209673_10313462 230
60 3300025303 Ga0209051_1000539 Ga0209051_100053936 230
61 3300025303 Ga0209051_1006667 Ga0209051_10066673 230
62 3300025303 Ga0209051_1017772 Ga0209051_10177725 230
63 3300050490 nmdc:mga03n38_3566_c1 nmdc:mga03n38_3566_c1_815_1606 230
64 3300050496 nmdc:mga07m45_1835_c1 nmdc:mga07m45_1835_c1_4755_5546 230
65 3300050516 nmdc:mga0sz30_54866_c1 nmdc:mga0sz30_54866_c1_86_877 230
66 iso_pu_bacteria 2643221687 2644486875 230
67 iso_pu_bacteria 2643221715 2644637124 230
68 iso_pu_bacteria 2738541274 2738707279 230
69 iso_pu_bacteria 2738543028 2739328594 230
70 iso_pu_bacteria 2842134933 2842139704 230
71 iso_pu_bacteria 2902799365 2902799854 230
72 iso_pu_bacteria 2902810491 2902814753 230
73 iso_pu_bacteria 2902837492 2902843139 230
74 iso_pu_bacteria 2929212328 2929217627 230
75 3300005338 Ga0068868_100026861 Ga0068868_1000268614 231
76 3300005353 Ga0070669_100343743 Ga0070669_1003437432 231
77 3300005364 Ga0070673_100267678 Ga0070673_1002676782 231
78 3300005539 Ga0068853_100249111 Ga0068853_1002491112 231
79 3300005548 Ga0070665_100162189 Ga0070665_1001621893 231
80 3300005618 Ga0068864_100383997 Ga0068864_1003839972 231
81 3300005719 Ga0068861_100148083 Ga0068861_1001480832 231
82 3300005844 Ga0068862_100084748 Ga0068862_1000847481 231
83 3300009174 Ga0105241_10094089 Ga0105241_100940892 231
84 3300009176 Ga0105242_10289906 Ga0105242_102899062 231
85 3300013296 Ga0157374_10044464 Ga0157374_100444644 231
86 3300025321 Ga0207656_10165933 Ga0207656_101659331 231
87 3300025901 Ga0207688_10004769 Ga0207688_100047692 231
88 3300025904 Ga0207647_10017481 Ga0207647_100174816 231
89 3300025908 Ga0207643_10067126 Ga0207643_100671262 231
90 3300025935 Ga0207709_10042607 Ga0207709_100426074 231
91 3300025940 Ga0207691_10254089 Ga0207691_102540892 231
92 3300025942 Ga0207689_10042623 Ga0207689_100426232 231
93 3300025961 Ga0207712_10341025 Ga0207712_103410251 231
94 3300026023 Ga0207677_10041306 Ga0207677_100413062 231
95 3300026035 Ga0207703_10023871 Ga0207703_100238713 231
96 3300026075 Ga0207708_10073578 Ga0207708_100735783 231
97 3300026118 Ga0207675_100197897 Ga0207675_1001978972 231
98 3300028379 Ga0268266_10152793 Ga0268266_101527932 231
99 3300048907 Ga0496104_0143935 Ga0496104_0143935_434_1225 231
100 3300049581 Ga0501047_0019351 Ga0501047_0019351_5151_5942 231
101 3300044693 Ga0466961_0023700 Ga0466961_0023700_2908_3702 232
102 3300053087 Ga0500643_048298 Ga0500643_048298_423_1214 232
103 3300005356 Ga0070674_100024424 Ga0070674_1000244245 233
104 3300005367 Ga0070667_100468221 Ga0070667_1004682212 233
105 3300005459 Ga0068867_100141073 Ga0068867_1001410732 233
106 3300005547 Ga0070693_100144760 Ga0070693_1001447602 233
107 3300005549 Ga0070704_100289904 Ga0070704_1002899041 233
108 3300009176 Ga0105242_10591979 Ga0105242_105919791 233
109 3300009551 Ga0105238_10241940 Ga0105238_102419402 233
110 3300021384 Ga0213876_10079661 Ga0213876_100796612 233
111 3300025905 Ga0207685_10165541 Ga0207685_101655411 233
112 3300025939 Ga0207665_10002055 Ga0207665_100020559 233
113 3300025972 Ga0207668_10105536 Ga0207668_101055362 233
114 3300025981 Ga0207640_10200705 Ga0207640_102007052 233
115 3300031251 Ga0265327_10000304 Ga0265327_1000030462 233
116 3300031251 Ga0265327_10004677 Ga0265327_1000467710 233
117 3300035112 Ga0373932_0077310 Ga0373932_0077310_194_985 233
118 3300035691 Ga0373931_0115090 Ga0373931_0115090_61_852 233
119 3300039437 Ga0436365_1434130 Ga0436365_1434130_2331_3122 233
120 3300044683 Ga0466965_0161592 Ga0466965_0161592_318_1118 233
121 3300044684 Ga0466966_0062036 Ga0466966_0062036_1547_2338 233
122 3300048904 Ga0496101_0079820 Ga0496101_0079820_1577_2365 233
123 3300048909 Ga0496106_0042972 Ga0496106_0042972_1858_2646 233
124 3300048915 Ga0496112_0526786 Ga0496112_0526786_135_923 233
125 3300048918 Ga0496115_0593484 Ga0496115_0593484_45_836 233
126 3300049570 Ga0501033_0000478 Ga0501033_0000478_31275_32063 233
127 3300049581 Ga0501047_0087649 Ga0501047_0087649_1751_2539 233
128 3300049585 Ga0501069_0056855 Ga0501069_0056855_1223_2011 233
129 3300049823 Ga0501044_0005780 Ga0501044_0005780_8934_9722 233
130 3300050491 nmdc:mga00v17_40503_c1 nmdc:mga00v17_40503_c1_598_1389 233
131 3300003792 Ga0055540_1000022 Ga0055540_100002259 234
132 3300003792 Ga0055540_1002859 Ga0055540_10028597 234
133 3300005329 Ga0070683_100693706 Ga0070683_1006937061 234
134 3300005335 Ga0070666_10109078 Ga0070666_101090782 234
135 3300005337 Ga0070682_100001259 Ga0070682_10000125910 234
136 3300005339 Ga0070660_100022863 Ga0070660_1000228635 234
137 3300005347 Ga0070668_100419063 Ga0070668_1004190632 234
138 3300005355 Ga0070671_100003987 Ga0070671_1000039872 234
139 3300005367 Ga0070667_100000468 Ga0070667_10000046814 234
140 3300005367 Ga0070667_100021896 Ga0070667_1000218963 234
141 3300005367 Ga0070667_100029695 Ga0070667_1000296953 234
142 3300005436 Ga0070713_100087494 Ga0070713_1000874943 234
143 3300005439 Ga0070711_100007884 Ga0070711_1000078841 234
144 3300005456 Ga0070678_100003584 Ga0070678_1000035843 234
145 3300005544 Ga0070686_100396332 Ga0070686_1003963322 234
146 3300005548 Ga0070665_100004640 Ga0070665_10000464012 234
147 3300005548 Ga0070665_100041217 Ga0070665_1000412175 234
148 3300005563 Ga0068855_100207063 Ga0068855_1002070632 234
149 3300005563 Ga0068855_100446471 Ga0068855_1004464711 234
150 3300005614 Ga0068856_100129858 Ga0068856_1001298582 234
151 3300005615 Ga0070702_100080938 Ga0070702_1000809382 234
152 3300005616 Ga0068852_100055907 Ga0068852_1000559073 234
153 3300005616 Ga0068852_100086884 Ga0068852_1000868842 234
154 3300005617 Ga0068859_100093918 Ga0068859_1000939183 234
155 3300005718 Ga0068866_10019143 Ga0068866_100191431 234
156 3300005841 Ga0068863_100003802 Ga0068863_10000380213 234
157 3300005841 Ga0068863_100224764 Ga0068863_1002247642 234
158 3300005841 Ga0068863_100348836 Ga0068863_1003488362 234
159 3300005842 Ga0068858_100054357 Ga0068858_1000543573 234
160 3300005843 Ga0068860_100000162 Ga0068860_10000016214 234
161 3300005843 Ga0068860_100154380 Ga0068860_1001543802 234
162 3300005844 Ga0068862_100000373 Ga0068862_10000037332 234
163 3300005983 Ga0081540_1142849 Ga0081540_11428491 234
164 3300006028 Ga0070717_10083227 Ga0070717_100832272 234
165 3300006038 Ga0075365_10002721 Ga0075365_100027218 234
166 3300006038 Ga0075365_10048800 Ga0075365_100488003 234
167 3300006048 Ga0075363_100001805 Ga0075363_1000018052 234
168 3300006048 Ga0075363_100003662 Ga0075363_1000036623 234
169 3300006048 Ga0075363_100008701 Ga0075363_1000087013 234
170 3300006048 Ga0075363_100014674 Ga0075363_1000146743 234
171 3300006048 Ga0075363_100021045 Ga0075363_1000210454 234
172 3300006048 Ga0075363_100041612 Ga0075363_1000416122 234
173 3300006048 Ga0075363_100179870 Ga0075363_1001798701 234
174 3300006051 Ga0075364_10005306 Ga0075364_100053064 234
175 3300006051 Ga0075364_10038615 Ga0075364_100386152 234
176 3300006175 Ga0070712_100002193 Ga0070712_1000021932 234
177 3300006177 Ga0075362_10037191 Ga0075362_100371912 234
178 3300006178 Ga0075367_10005805 Ga0075367_100058055 234
179 3300006186 Ga0075369_10001821 Ga0075369_100018215 234
180 3300006186 Ga0075369_10158510 Ga0075369_101585101 234
181 3300006353 Ga0075370_10033040 Ga0075370_100330404 234
182 3300006353 Ga0075370_10108497 Ga0075370_101084972 234
183 3300006844 Ga0075428_100041708 Ga0075428_1000417082 234
184 3300006846 Ga0075430_100139091 Ga0075430_1001390913 234
185 3300006846 Ga0075430_100152415 Ga0075430_1001524152 234
186 3300006847 Ga0075431_100024742 Ga0075431_1000247427 234
187 3300006931 Ga0097620_100093918 Ga0097620_1000939182 234
188 3300009098 Ga0105245_10024506 Ga0105245_100245065 234
189 3300009101 Ga0105247_10000079 Ga0105247_1000007914 234
190 3300009147 Ga0114129_10149018 Ga0114129_101490182 234
191 3300009174 Ga0105241_10087754 Ga0105241_100877542 234
192 3300009174 Ga0105241_10146441 Ga0105241_101464412 234
193 3300009177 Ga0105248_10000827 Ga0105248_1000082713 234
194 3300009177 Ga0105248_10010987 Ga0105248_100109879 234
195 3300009177 Ga0105248_10329234 Ga0105248_103292342 234
196 3300009545 Ga0105237_10023699 Ga0105237_100236996 234
197 3300009553 Ga0105249_10000098 Ga0105249_1000009814 234
198 3300009553 Ga0105249_10043013 Ga0105249_100430133 234
199 3300010375 Ga0105239_10004540 Ga0105239_100045408 234
200 3300010375 Ga0105239_10056707 Ga0105239_100567075 234
201 3300010375 Ga0105239_10384234 Ga0105239_103842342 234
202 3300013105 Ga0157369_10068402 Ga0157369_100684026 234
203 3300013306 Ga0163162_10040659 Ga0163162_100406591 234
204 3300013306 Ga0163162_10141992 Ga0163162_101419922 234
205 3300013306 Ga0163162_10291583 Ga0163162_102915833 234
206 3300013307 Ga0157372_10562430 Ga0157372_105624302 234
207 3300013307 Ga0157372_10657375 Ga0157372_106573752 234
208 3300014325 Ga0163163_10029438 Ga0163163_100294385 234
209 3300014968 Ga0157379_10010784 Ga0157379_100107843 234
210 3300014968 Ga0157379_10848508 Ga0157379_108485081 234
211 3300020082 Ga0206353_11119700 Ga0206353_111197002 234
212 3300021384 Ga0213876_10017730 Ga0213876_100177302 234
213 3300021388 Ga0213875_10005783 Ga0213875_100057835 234
214 3300025303 Ga0209051_1000033 Ga0209051_100003359 234
215 3300025303 Ga0209051_1001358 Ga0209051_10013582 234
216 3300025900 Ga0207710_10000022 Ga0207710_10000022254 234
217 3300025904 Ga0207647_10005286 Ga0207647_100052864 234
218 3300025911 Ga0207654_10061379 Ga0207654_100613792 234
219 3300025913 Ga0207695_10256817 Ga0207695_102568171 234
220 3300025914 Ga0207671_10173534 Ga0207671_101735342 234
221 3300025915 Ga0207693_10004661 Ga0207693_100046617 234
222 3300025919 Ga0207657_10038571 Ga0207657_100385714 234
223 3300025923 Ga0207681_10011031 Ga0207681_100110312 234
224 3300025927 Ga0207687_10014059 Ga0207687_100140595 234
225 3300025928 Ga0207700_10636453 Ga0207700_106364531 234
226 3300025931 Ga0207644_10329499 Ga0207644_103294991 234
227 3300025938 Ga0207704_10185232 Ga0207704_101852322 234
228 3300025941 Ga0207711_10000404 Ga0207711_1000040413 234
229 3300025941 Ga0207711_10009036 Ga0207711_100090362 234
230 3300025944 Ga0207661_10626111 Ga0207661_106261112 234
231 3300025949 Ga0207667_10359076 Ga0207667_103590762 234
232 3300025961 Ga0207712_10000076 Ga0207712_1000007614 234
233 3300025981 Ga0207640_10401320 Ga0207640_104013201 234
234 3300025986 Ga0207658_10000821 Ga0207658_1000082112 234
235 3300025986 Ga0207658_10004195 Ga0207658_100041953 234
236 3300025986 Ga0207658_10004895 Ga0207658_100048953 234
237 3300026035 Ga0207703_10097769 Ga0207703_100977694 234
238 3300026035 Ga0207703_10329681 Ga0207703_103296812 234
239 3300026041 Ga0207639_10104734 Ga0207639_101047342 234
240 3300026067 Ga0207678_10005038 Ga0207678_100050385 234
241 3300026067 Ga0207678_10162133 Ga0207678_101621332 234
242 3300026088 Ga0207641_10002622 Ga0207641_100026226 234
243 3300026088 Ga0207641_10017231 Ga0207641_100172318 234
244 3300026088 Ga0207641_10027295 Ga0207641_100272952 234
245 3300026116 Ga0207674_10392301 Ga0207674_103923011 234
246 3300026142 Ga0207698_10010836 Ga0207698_100108363 234
247 3300027907 Ga0207428_10349655 Ga0207428_103496552 234
248 3300028379 Ga0268266_10021614 Ga0268266_100216145 234
249 3300028379 Ga0268266_10025370 Ga0268266_100253703 234
250 3300028380 Ga0268265_10000368 Ga0268265_1000036830 234
251 3300028381 Ga0268264_10000017 Ga0268264_10000017461 234
252 3300028381 Ga0268264_10089136 Ga0268264_100891362 234
253 3300031251 Ga0265327_10000019 Ga0265327_10000019249 234
254 3300031251 Ga0265327_10064963 Ga0265327_100649632 234
255 3300031824 Ga0307413_10066399 Ga0307413_100663992 234
256 3300031824 Ga0307413_10165548 Ga0307413_101655483 234
257 3300031852 Ga0307410_10006678 Ga0307410_100066786 234
258 3300031852 Ga0307410_10116885 Ga0307410_101168852 234
259 3300031903 Ga0307407_10197006 Ga0307407_101970062 234
260 3300031995 Ga0307409_100096110 Ga0307409_1000961101 234
261 3300031995 Ga0307409_100114372 Ga0307409_1001143722 234
262 3300032002 Ga0307416_100030418 Ga0307416_1000304183 234
263 3300032005 Ga0307411_10117347 Ga0307411_101173471 234
264 3300032133 Ga0316583_10071371 Ga0316583_100713711 234
265 3300034957 Ga0373938_0051663 Ga0373938_0051663_31_822 234
266 3300035114 Ga0373939_0080994 Ga0373939_0080994_195_986 234
267 3300035691 Ga0373931_0083081 Ga0373931_0083081_309_1100 234
268 3300036712 Ga0316584_0038322 Ga0316584_0038322_399_1190 234
269 3300037853 Ga0436364_1073926 Ga0436364_1073926_3279_4070 234
270 3300037853 Ga0436364_1439348 Ga0436364_1439348_11898_12689 234
271 3300039437 Ga0436365_0503789 Ga0436365_0503789_1537_2328 234
272 3300039437 Ga0436365_0508192 Ga0436365_0508192_5492_6283 234
273 3300039437 Ga0436365_0671847 Ga0436365_0671847_3350_4141 234
274 3300041410 Ga0439461_0007687 Ga0439461_0007687_895_1686 234
275 3300041411 Ga0439466_0009966 Ga0439466_0009966_1237_2028 234
276 3300041411 Ga0439466_0020894 Ga0439466_0020894_1089_1880 234
277 3300041413 Ga0439465_0004772 Ga0439465_0004772_3072_3863 234
278 3300041413 Ga0439465_0006799 Ga0439465_0006799_2477_3268 234
279 3300041413 Ga0439465_0026897 Ga0439465_0026897_775_1566 234
280 3300041997 Ga0439431_0003816 Ga0439431_0003816_1374_2165 234
281 3300041997 Ga0439431_0034436 Ga0439431_0034436_131_922 234
282 3300042004 Ga0439445_0077969 Ga0439445_0077969_20_811 234
283 3300042435 Ga0439434_0002598 Ga0439434_0002598_1886_2677 234
284 3300042435 Ga0439434_0028861 Ga0439434_0028861_632_1423 234
285 3300044656 Ga0466969_0027309 Ga0466969_0027309_1955_2746 234
286 3300044656 Ga0466969_0110056 Ga0466969_0110056_346_1140 234
287 3300044656 Ga0466969_0113878 Ga0466969_0113878_419_1213 234
288 3300044656 Ga0466969_0115538 Ga0466969_0115538_188_979 234
289 3300044658 Ga0466972_0003512 Ga0466972_0003512_4276_5070 234
290 3300044658 Ga0466972_0025419 Ga0466972_0025419_472_1263 234
291 3300044658 Ga0466972_0067538 Ga0466972_0067538_677_1468 234
292 3300044658 Ga0466972_0086447 Ga0466972_0086447_384_1175 234
293 3300044658 Ga0466972_0096326 Ga0466972_0096326_216_1007 234
294 3300044658 Ga0466972_0102115 Ga0466972_0102115_252_1043 234
295 3300044658 Ga0466972_0208192 Ga0466972_0208192_79_870 234
296 3300044683 Ga0466965_0021177 Ga0466965_0021177_975_1766 234
297 3300044684 Ga0466966_0003611 Ga0466966_0003611_3530_4321 234
298 3300044684 Ga0466966_0025745 Ga0466966_0025745_453_1244 234
299 3300044693 Ga0466961_0004127 Ga0466961_0004127_439_1230 234
300 3300044693 Ga0466961_0011105 Ga0466961_0011105_397_1188 234
301 3300044693 Ga0466961_0029827 Ga0466961_0029827_2365_3156 234
302 3300044693 Ga0466961_0039689 Ga0466961_0039689_1725_2519 234
303 3300044693 Ga0466961_0329552 Ga0466961_0329552_84_875 234
304 3300044694 Ga0466963_0071212 Ga0466963_0071212_872_1663 234
305 3300044694 Ga0466963_0151499 Ga0466963_0151499_626_1417 234
306 3300044694 Ga0466963_0169314 Ga0466963_0169314_684_1475 234
307 3300044694 Ga0466963_0174191 Ga0466963_0174191_301_1113 234
308 3300044694 Ga0466963_0235965 Ga0466963_0235965_223_1014 234
309 3300044694 Ga0466963_0342972 Ga0466963_0342972_211_1002 234
310 3300044706 Ga0466964_0023951 Ga0466964_0023951_574_1386 234
311 3300044706 Ga0466964_0026321 Ga0466964_0026321_835_1626 234
312 3300044719 Ga0466971_0012476 Ga0466971_0012476_2243_3034 234
313 3300044719 Ga0466971_0168055 Ga0466971_0168055_68_859 234
314 3300044735 Ga0466968_0027711 Ga0466968_0027711_492_1283 234
315 3300044735 Ga0466968_0031370 Ga0466968_0031370_1015_1806 234
316 3300044735 Ga0466968_0037257 Ga0466968_0037257_250_1041 234
317 3300044765 Ga0466970_0012795 Ga0466970_0012795_2062_2853 234
318 3300044842 Ga0466957_0002052 Ga0466957_0002052_9363_10154 234
319 3300044842 Ga0466957_0077047 Ga0466957_0077047_1122_1913 234
320 3300044842 Ga0466957_0119630 Ga0466957_0119630_769_1560 234
321 3300044901 Ga0466960_0000255 Ga0466960_0000255_1724_2515 234
322 3300044901 Ga0466960_0000500 Ga0466960_0000500_3649_4440 234
323 3300044901 Ga0466960_0047020 Ga0466960_0047020_310_1101 234
324 3300044901 Ga0466960_0080001 Ga0466960_0080001_78_869 234
325 3300044901 Ga0466960_0081028 Ga0466960_0081028_68_859 234
326 3300044901 Ga0466960_0268522 Ga0466960_0268522_71_862 234
327 3300045049 Ga0466959_0003887 Ga0466959_0003887_394_1185 234
328 3300045049 Ga0466959_0093267 Ga0466959_0093267_298_1089 234
329 3300045049 Ga0466959_0185313 Ga0466959_0185313_280_1071 234
330 3300045836 Ga0466958_0007640 Ga0466958_0007640_534_1325 234
331 3300045836 Ga0466958_0079229 Ga0466958_0079229_1137_1928 234
332 3300045836 Ga0466958_0085825 Ga0466958_0085825_859_1650 234
333 3300045836 Ga0466958_0261465 Ga0466958_0261465_244_1035 234
334 3300045836 Ga0466958_0327659 Ga0466958_0327659_138_929 234
335 3300045976 Ga0466967_0009518 Ga0466967_0009518_2092_2883 234
336 3300045976 Ga0466967_0016140 Ga0466967_0016140_373_1164 234
337 3300045976 Ga0466967_0057992 Ga0466967_0057992_1139_1930 234
338 3300045976 Ga0466967_0081217 Ga0466967_0081217_415_1206 234
339 3300045976 Ga0466967_0093973 Ga0466967_0093973_984_1775 234
340 3300045976 Ga0466967_0109259 Ga0466967_0109259_945_1736 234
341 3300045976 Ga0466967_0114801 Ga0466967_0114801_47_838 234
342 3300045976 Ga0466967_0186686 Ga0466967_0186686_978_1790 234
343 3300045976 Ga0466967_0616656 Ga0466967_0616656_103_894 234
344 3300046455 Ga0495603_0015662 Ga0495603_0015662_1702_2493 234
345 3300046459 Ga0495629_0024600 Ga0495629_0024600_3207_3998 234
346 3300046542 Ga0495597_0150517 Ga0495597_0150517_39_830 234
347 3300046680 Ga0495646_0167664 Ga0495646_0167664_28_819 234
348 3300046694 Ga0495649_0160733 Ga0495649_0160733_24_815 234
349 3300047319 Ga0495674_0014565 Ga0495674_0014565_3916_4707 234
350 3300047472 Ga0495686_0000930 Ga0495686_0000930_3782_4573 234
351 3300048903 Ga0496100_0000097 Ga0496100_0000097_17284_18075 234
352 3300048903 Ga0496100_0005457 Ga0496100_0005457_77_868 234
353 3300048903 Ga0496100_0010001 Ga0496100_0010001_596_1387 234
354 3300048903 Ga0496100_0021103 Ga0496100_0021103_2557_3348 234
355 3300048903 Ga0496100_0052629 Ga0496100_0052629_1761_2552 234
356 3300048904 Ga0496101_0000032 Ga0496101_0000032_50531_51322 234
357 3300048904 Ga0496101_0000974 Ga0496101_0000974_8916_9707 234
358 3300048904 Ga0496101_0001023 Ga0496101_0001023_3585_4376 234
359 3300048904 Ga0496101_0043222 Ga0496101_0043222_1522_2313 234
360 3300048904 Ga0496101_0180101 Ga0496101_0180101_68_859 234
361 3300048904 Ga0496101_0340009 Ga0496101_0340009_14_805 234
362 3300048905 Ga0496102_0000721 Ga0496102_0000721_27793_28584 234
363 3300048905 Ga0496102_0001591 Ga0496102_0001591_6267_7058 234
364 3300048905 Ga0496102_0003704 Ga0496102_0003704_4010_4801 234
365 3300048905 Ga0496102_0040122 Ga0496102_0040122_238_1029 234
366 3300048905 Ga0496102_0058888 Ga0496102_0058888_272_1063 234
367 3300048905 Ga0496102_0159977 Ga0496102_0159977_19_810 234
368 3300048906 Ga0496103_0000649 Ga0496103_0000649_1766_2557 234
369 3300048906 Ga0496103_0000801 Ga0496103_0000801_797_1588 234
370 3300048906 Ga0496103_0001216 Ga0496103_0001216_10769_11560 234
371 3300048906 Ga0496103_0215664 Ga0496103_0215664_401_1192 234
372 3300048907 Ga0496104_0025387 Ga0496104_0025387_845_1636 234
373 3300048907 Ga0496104_0084672 Ga0496104_0084672_1878_2669 234
374 3300048908 Ga0496105_0205313 Ga0496105_0205313_674_1465 234
375 3300048909 Ga0496106_0006414 Ga0496106_0006414_3760_4551 234
376 3300048909 Ga0496106_0008971 Ga0496106_0008971_1396_2187 234
377 3300048909 Ga0496106_0009704 Ga0496106_0009704_6111_6902 234
378 3300048909 Ga0496106_0343098 Ga0496106_0343098_100_891 234
379 3300048910 Ga0496107_0000522 Ga0496107_0000522_2286_3077 234
380 3300048910 Ga0496107_0001241 Ga0496107_0001241_260_1051 234
381 3300048910 Ga0496107_0011211 Ga0496107_0011211_864_1655 234
382 3300048912 Ga0496109_0000030 Ga0496109_0000030_18438_19229 234
383 3300048912 Ga0496109_0070666 Ga0496109_0070666_1281_2072 234
384 3300048913 Ga0496110_0075992 Ga0496110_0075992_1945_2736 234
385 3300048914 Ga0496111_0001243 Ga0496111_0001243_12375_13166 234
386 3300048915 Ga0496112_0025035 Ga0496112_0025035_3540_4331 234
387 3300048916 Ga0496113_0066460 Ga0496113_0066460_1708_2499 234
388 3300048916 Ga0496113_0134842 Ga0496113_0134842_312_1103 234
389 3300048917 Ga0496114_0000187 Ga0496114_0000187_20916_21707 234
390 3300048917 Ga0496114_0002134 Ga0496114_0002134_7489_8280 234
391 3300048917 Ga0496114_0004401 Ga0496114_0004401_6070_6861 234
392 3300048918 Ga0496115_0009045 Ga0496115_0009045_5390_6181 234
393 3300048918 Ga0496115_0091246 Ga0496115_0091246_1499_2290 234
394 3300048918 Ga0496115_0244842 Ga0496115_0244842_449_1240 234
395 3300048919 Ga0496116_0004962 Ga0496116_0004962_10302_11093 234
396 3300048919 Ga0496116_0026632 Ga0496116_0026632_930_1721 234
397 3300048920 Ga0496117_0002717 Ga0496117_0002717_6395_7186 234
398 3300048920 Ga0496117_0072826 Ga0496117_0072826_1320_2111 234
399 3300048921 Ga0496118_0004669 Ga0496118_0004669_714_1505 234
400 3300048921 Ga0496118_0077676 Ga0496118_0077676_496_1287 234
401 3300048921 Ga0496118_0084087 Ga0496118_0084087_1089_1880 234
402 3300048922 Ga0496119_0008172 Ga0496119_0008172_6337_7128 234
403 3300048922 Ga0496119_0022623 Ga0496119_0022623_2883_3674 234
404 3300048923 Ga0496120_0002518 Ga0496120_0002518_2942_3733 234
405 3300048924 Ga0496121_0000004 Ga0496121_0000004_341256_342047 234
406 3300048924 Ga0496121_0005473 Ga0496121_0005473_771_1562 234
407 3300048925 Ga0496122_0000173 Ga0496122_0000173_135462_136253 234
408 3300048925 Ga0496122_0008989 Ga0496122_0008989_5106_5897 234
409 3300048926 Ga0496123_0003164 Ga0496123_0003164_16346_17137 234
410 3300048926 Ga0496123_0014807 Ga0496123_0014807_4209_5000 234
411 3300048927 Ga0496124_0000012 Ga0496124_0000012_66049_66840 234
412 3300048928 Ga0496125_0000003 Ga0496125_0000003_847721_848512 234
413 3300048928 Ga0496125_0024973 Ga0496125_0024973_1809_2600 234
414 3300048929 Ga0496126_0000001 Ga0496126_0000001_341256_342047 234
415 3300048929 Ga0496126_0003985 Ga0496126_0003985_8906_9697 234
416 3300048929 Ga0496126_0057396 Ga0496126_0057396_771_1562 234
417 3300048929 Ga0496126_0447091 Ga0496126_0447091_158_949 234
418 3300049568 Ga0501031_0147560 Ga0501031_0147560_351_1142 234
419 3300049569 Ga0501032_0006176 Ga0501032_0006176_1438_2229 234
420 3300049570 Ga0501033_0080229 Ga0501033_0080229_790_1581 234
421 3300049570 Ga0501033_0189790 Ga0501033_0189790_435_1226 234
422 3300049571 Ga0501034_0038548 Ga0501034_0038548_3720_4511 234
423 3300049571 Ga0501034_0680644 Ga0501034_0680644_51_842 234
424 3300049572 Ga0501036_0327299 Ga0501036_0327299_199_990 234
425 3300049573 Ga0501037_0071522 Ga0501037_0071522_1380_2171 234
426 3300049573 Ga0501037_0100363 Ga0501037_0100363_968_1759 234
427 3300049579 Ga0501043_0241455 Ga0501043_0241455_353_1144 234
428 3300049579 Ga0501043_0349246 Ga0501043_0349246_293_1084 234
429 3300049580 Ga0501046_0006533 Ga0501046_0006533_6064_6855 234
430 3300049581 Ga0501047_0000405 Ga0501047_0000405_47009_47800 234
431 3300049581 Ga0501047_0164047 Ga0501047_0164047_752_1543 234
432 3300049581 Ga0501047_0378488 Ga0501047_0378488_81_872 234
433 3300049582 Ga0501048_0031512 Ga0501048_0031512_389_1180 234
434 3300049585 Ga0501069_0067320 Ga0501069_0067320_448_1239 234
435 3300049586 Ga0501070_0000165 Ga0501070_0000165_42527_43318 234
436 3300049586 Ga0501070_0077470 Ga0501070_0077470_895_1686 234
437 3300049586 Ga0501070_0098286 Ga0501070_0098286_806_1597 234
438 3300049586 Ga0501070_0265771 Ga0501070_0265771_429_1220 234
439 3300049589 Ga0501073_0081373 Ga0501073_0081373_404_1195 234
440 3300049589 Ga0501073_0196497 Ga0501073_0196497_333_1124 234
441 3300049742 Ga0501080_0089528 Ga0501080_0089528_1694_2485 234
442 3300049742 Ga0501080_0331512 Ga0501080_0331512_487_1278 234
443 3300049744 Ga0501083_0050100 Ga0501083_0050100_1891_2682 234
444 3300049822 Ga0501035_0000283 Ga0501035_0000283_12292_13083 234
445 3300049822 Ga0501035_0065896 Ga0501035_0065896_2125_2916 234
446 3300049822 Ga0501035_0101788 Ga0501035_0101788_1545_2336 234
447 3300049823 Ga0501044_0008797 Ga0501044_0008797_6662_7453 234
448 3300049823 Ga0501044_0271750 Ga0501044_0271750_80_871 234
449 3300050489 nmdc:mga03683_21602_c1 nmdc:mga03683_21602_c1_341_1132 234
450 3300050490 nmdc:mga03n38_12377_c1 nmdc:mga03n38_12377_c1_638_1429 234
451 3300050490 nmdc:mga03n38_23660_c1 nmdc:mga03n38_23660_c1_477_1268 234
452 3300050490 nmdc:mga03n38_28617_c1 nmdc:mga03n38_28617_c1_1065_1856 234
453 3300050490 nmdc:mga03n38_83752_c1 nmdc:mga03n38_83752_c1_663_1454 234
454 3300050491 nmdc:mga00v17_16677_c1 nmdc:mga00v17_16677_c1_318_1109 234
455 3300050491 nmdc:mga00v17_18704_c1 nmdc:mga00v17_18704_c1_1524_2315 234
456 3300050491 nmdc:mga00v17_28982_c1 nmdc:mga00v17_28982_c1_2034_2825 234
457 3300050491 nmdc:mga00v17_9337_c1 nmdc:mga00v17_9337_c1_1124_1915 234
458 3300050492 nmdc:mga0yw44_365965_c1 nmdc:mga0yw44_365965_c1_97_888 234
459 3300050495 nmdc:mga04h51_121882_c1 nmdc:mga04h51_121882_c1_53_844 234
460 3300050496 nmdc:mga07m45_24829_c1 nmdc:mga07m45_24829_c1_1998_2789 234
461 3300050496 nmdc:mga07m45_278323_c1 nmdc:mga07m45_278323_c1_26_817 234
462 3300050509 nmdc:mga0qj67_220197_c1 nmdc:mga0qj67_220197_c1_26_817 234
463 3300050511 nmdc:mga08y16_464748_c1 nmdc:mga08y16_464748_c1_468_1259 234
464 3300050516 nmdc:mga0sz30_4590_c1 nmdc:mga0sz30_4590_c1_943_1734 234
465 3300050516 nmdc:mga0sz30_97732_c1 nmdc:mga0sz30_97732_c1_304_1095 234
466 3300053079 Ga0500610_0020380 Ga0500610_0020380_330_1121 234
467 3300053087 Ga0500643_004478 Ga0500643_004478_2472_3263 234
468 3300053098 Ga0500650_0188836 Ga0500650_0188836_77_868 234
469 3300053104 Ga0500556_0003445 Ga0500556_0003445_2044_2835 234
470 3300053139 Ga0500568_0049560 Ga0500568_0049560_603_1394 234
471 3300053158 Ga0500627_0111788 Ga0500627_0111788_331_1122 234
472 3300053730 Ga0500645_000025 Ga0500645_000025_76_867 234
473 3300061719 Ga0466962_0024764 Ga0466962_0024764_491_1282 234
474 3300061719 Ga0466962_0031944 Ga0466962_0031944_1417_2208 234
475 3300035691 Ga0373931_0072809 Ga0373931_0072809_986_1783 236
476 3300045976 Ga0466967_0167721 Ga0466967_0167721_351_1151 237
477 3300006038 Ga0075365_10365096 Ga0075365_103650961 238
478 3300028800 Ga0265338_10127190 Ga0265338_101271903 239
479 3300031251 Ga0265327_10056074 Ga0265327_100560741 239
480 iso_pu_bacteria 2738541356 2739145991 243
481 3300049571 Ga0501034_0080779 Ga0501034_0080779_99_920 244
482 3300049573 Ga0501037_0001327 Ga0501037_0001327_4590_5411 244
483 3300049574 Ga0501038_0017898 Ga0501038_0017898_5199_6020 244
484 3300049575 Ga0501039_0002905 Ga0501039_0002905_9269_10090 244
485 3300049589 Ga0501073_0143453 Ga0501073_0143453_405_1226 244
486 3300049823 Ga0501044_0043238 Ga0501044_0043238_3147_3968 244
487 3300025898 Ga0207692_10181386 Ga0207692_101813862 246
488 3300044693 Ga0466961_0008888 Ga0466961_0008888_531_1364 246
489 3300044735 Ga0466968_0004756 Ga0466968_0004756_4145_4978 246
490 3300044765 Ga0466970_0018798 Ga0466970_0018798_250_1083 246
491 3300045049 Ga0466959_0006506 Ga0466959_0006506_5508_6341 246
492 3300045836 Ga0466958_0020589 Ga0466958_0020589_1955_2788 246
493 3300049569 Ga0501032_0039991 Ga0501032_0039991_531_1424 246
494 3300049570 Ga0501033_0019305 Ga0501033_0019305_2499_3392 246
495 3300049571 Ga0501034_0035492 Ga0501034_0035492_1676_2569 246
496 3300049581 Ga0501047_0004633 Ga0501047_0004633_8426_9319 246
497 3300049822 Ga0501035_0000982 Ga0501035_0000982_17327_18220 246
498 3300049823 Ga0501044_0001287 Ga0501044_0001287_20976_21869 246
499 3300053080 Ga0500635_0003085 Ga0500635_0003085_246_1079 246
500 3300053131 Ga0500652_001400 Ga0500652_001400_3279_4112 246
501 3300061719 Ga0466962_0165997 Ga0466962_0165997_46_879 246
502 3300010375 Ga0105239_10025074 Ga0105239_100250743 247
503 3300002070 JGI24750J21931_1001627 JGI24750J21931_10016273 258
504 3300002077 JGI24744J21845_10003779 JGI24744J21845_100037792 258
505 3300005328 Ga0070676_10040869 Ga0070676_100408692 258
506 3300005330 Ga0070690_100009964 Ga0070690_1000099645 258
507 3300005335 Ga0070666_10010885 Ga0070666_100108855 258
508 3300005336 Ga0070680_100184773 Ga0070680_1001847732 258
509 3300005338 Ga0068868_100000922 Ga0068868_10000092221 258
510 3300005340 Ga0070689_100090341 Ga0070689_1000903412 258
511 3300005341 Ga0070691_10072258 Ga0070691_100722582 258
512 3300005347 Ga0070668_100015351 Ga0070668_1000153516 258
513 3300005353 Ga0070669_100161554 Ga0070669_1001615542 258
514 3300005355 Ga0070671_100161860 Ga0070671_1001618601 258
515 3300005356 Ga0070674_100000824 Ga0070674_10000082418 258
516 3300005365 Ga0070688_100005743 Ga0070688_1000057437 258
517 3300005366 Ga0070659_100014319 Ga0070659_1000143195 258
518 3300005367 Ga0070667_100059700 Ga0070667_1000597002 258
519 3300005406 Ga0070703_10053035 Ga0070703_100530352 258
520 3300005437 Ga0070710_10010769 Ga0070710_100107693 258
521 3300005439 Ga0070711_100002643 Ga0070711_1000026439 258
522 3300005440 Ga0070705_100013735 Ga0070705_1000137355 258
523 3300005441 Ga0070700_100073396 Ga0070700_1000733963 258
524 3300005455 Ga0070663_100203105 Ga0070663_1002031053 258
525 3300005456 Ga0070678_100007567 Ga0070678_1000075671 258
526 3300005457 Ga0070662_100009455 Ga0070662_1000094552 258
527 3300005459 Ga0068867_100006264 Ga0068867_1000062648 258
528 3300005466 Ga0070685_10060721 Ga0070685_100607212 258
529 3300005539 Ga0068853_100011209 Ga0068853_1000112095 258
530 3300005545 Ga0070695_100032575 Ga0070695_1000325755 258
531 3300005547 Ga0070693_100005927 Ga0070693_1000059277 258
532 3300005549 Ga0070704_100005634 Ga0070704_1000056345 258
533 3300005578 Ga0068854_100002961 Ga0068854_1000029616 258
534 3300005615 Ga0070702_100003368 Ga0070702_1000033681 258
535 3300005617 Ga0068859_100022427 Ga0068859_1000224277 258
536 3300005718 Ga0068866_10002151 Ga0068866_100021515 258
537 3300005719 Ga0068861_100001030 Ga0068861_1000010307 258
538 3300005842 Ga0068858_100018193 Ga0068858_1000181932 258
539 3300005843 Ga0068860_100009201 Ga0068860_1000092015 258
540 3300005844 Ga0068862_100002929 Ga0068862_10000292910 258
541 3300006163 Ga0070715_10001652 Ga0070715_100016523 258
542 3300006173 Ga0070716_100004752 Ga0070716_1000047527 258
543 3300006175 Ga0070712_100000457 Ga0070712_1000004577 258
544 3300006881 Ga0068865_100080172 Ga0068865_1000801724 258
545 3300006931 Ga0097620_100022431 Ga0097620_1000224317 258
546 3300009098 Ga0105245_10010356 Ga0105245_100103567 258
547 3300009101 Ga0105247_10001160 Ga0105247_1000116020 258
548 3300009148 Ga0105243_10001175 Ga0105243_1000117520 258
549 3300009176 Ga0105242_10002885 Ga0105242_100028857 258
550 3300009177 Ga0105248_10005516 Ga0105248_1000551612 258
551 3300009545 Ga0105237_10298016 Ga0105237_102980161 258
552 3300009553 Ga0105249_10017037 Ga0105249_100170373 258
553 3300010375 Ga0105239_10030638 Ga0105239_100306381 258
554 3300013297 Ga0157378_10004599 Ga0157378_100045997 258
555 3300013306 Ga0163162_10007329 Ga0163162_100073297 258
556 3300013308 Ga0157375_10025498 Ga0157375_100254983 258
557 3300014326 Ga0157380_10001639 Ga0157380_100016396 258
558 3300014968 Ga0157379_10031573 Ga0157379_100315732 258
559 3300014969 Ga0157376_10013139 Ga0157376_100131393 258
560 3300017792 Ga0163161_10045230 Ga0163161_100452302 258
561 3300025885 Ga0207653_10033310 Ga0207653_100333102 258
562 3300025898 Ga0207692_10015660 Ga0207692_100156603 258
563 3300025899 Ga0207642_10001918 Ga0207642_100019187 258
564 3300025900 Ga0207710_10022200 Ga0207710_100222003 258
565 3300025901 Ga0207688_10028820 Ga0207688_100288203 258
566 3300025903 Ga0207680_10053744 Ga0207680_100537442 258
567 3300025905 Ga0207685_10095156 Ga0207685_100951561 258
568 3300025915 Ga0207693_10000670 Ga0207693_1000067016 258
569 3300025917 Ga0207660_10428293 Ga0207660_104282931 258
570 3300025923 Ga0207681_10091800 Ga0207681_100918002 258
571 3300025927 Ga0207687_10004852 Ga0207687_100048523 258
572 3300025931 Ga0207644_10084779 Ga0207644_100847792 258
573 3300025932 Ga0207690_10040051 Ga0207690_100400515 258
574 3300025933 Ga0207706_10018429 Ga0207706_100184293 258
575 3300025934 Ga0207686_10004278 Ga0207686_100042788 258
576 3300025935 Ga0207709_10035252 Ga0207709_100352522 258
577 3300025936 Ga0207670_10272318 Ga0207670_102723181 258
578 3300025937 Ga0207669_10008030 Ga0207669_100080306 258
579 3300025938 Ga0207704_10003790 Ga0207704_100037901 258
580 3300025939 Ga0207665_10009512 Ga0207665_100095125 258
581 3300025942 Ga0207689_10063204 Ga0207689_100632044 258
582 3300025961 Ga0207712_10003329 Ga0207712_100033293 258
583 3300025972 Ga0207668_10009507 Ga0207668_100095077 258
584 3300026023 Ga0207677_10006552 Ga0207677_100065527 258
585 3300026035 Ga0207703_10007364 Ga0207703_100073647 258
586 3300026041 Ga0207639_10009810 Ga0207639_100098107 258
587 3300026075 Ga0207708_10102666 Ga0207708_101026663 258
588 3300026089 Ga0207648_10003535 Ga0207648_1000353517 258
589 3300026118 Ga0207675_100007414 Ga0207675_1000074147 258
590 3300026121 Ga0207683_10001111 Ga0207683_100011117 258
591 3300028379 Ga0268266_10279667 Ga0268266_102796671 258
592 3300028380 Ga0268265_10009210 Ga0268265_100092107 258
593 3300028381 Ga0268264_10017083 Ga0268264_100170837 258
594 3300053153 Ga0500616_0004390 Ga0500616_0004390_2361_3224 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

227

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

274

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aus-assembly1.cif.gz_A crystal structure of bacillus megaterium glucose dehydrogenase 4 in ligand-free form 0.9505 40 247
3gaf-assembly1.cif.gz_H 2.2a crystal structure of 7-alpha-hydroxysteroid dehydrogenase from brucella melitensis 0.9479 40 248
3gaf-assembly2.cif.gz_C 2.2a crystal structure of 7-alpha-hydroxysteroid dehydrogenase from brucella melitensis 0.9473 40 248
1g6k-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant e96a complexed with nad+ 0.9466 43 247
8jfa-assembly1.cif.gz_B crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori 0.9466 43 245
ID Description Score Start End Superfamily
af_P9WGQ5_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9777 39 249 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 43 247 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9384 40 247 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9357 43 246 3.40.50.720
af_I6YCE1_8_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9353 53 245 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A533V5Y0-F1-model_v4 SDR family oxidoreductase 0.9626 165 247
AF-A0A2P8ERE6-F1-model_v4 7-alpha-hydroxysteroid dehydrogenase 0.9555 40 250 GO:0016491
AF-R1DG55-F1-model_v4 Uncharacterized protein 0.9529 82 245 GO:0016491
AF-A0A2C9B558-F1-model_v4 deleted 0.9524 40 247
AF-A0A1M5KSI9-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9491 82 247 GO:0016491

Feature Viewer

pLDDT pTM Quality
80.86 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map