F467431
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 595 | 275 | 595 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100458872|Ga0075428_1004588721 |
| Length | 367 |
| Sequence | LQCECLLLTQSGHRHPPLPLQADWLRQYDGRPDASGEAMRRREFILLLGCAVAASPVSARAQQAEQMRRIGVLLNTASDDPDGQAGVAAFNQALQQLGWGVGGQVRIDTRWGQNDEDLDRKYAAELVALGPDVFLASGSLSVAALKRVTRTVPVVFVNVADPVGGGFVDSLARPGGNVTGFMLYEYSFSGKWLELLKEIVPHLARVAVLRDSGNRAGIGQFAAIQSVAPSLGVELRPVDTSDGGEIERTLAAFARSPNVGLVVTPSAAVAARRHAIVTLAARYKLPAVYGFRPPIVAGGLISYGPNRIDPFRRAAEYVDRILKGEKPNDMPVQAPTKYELVVNLKTAKALGLTMPPAVLARADEVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 155 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 156 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 160 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 167 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 10.25 |
| Rhizosphere | 88.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c000794 | 3300000043 | Unclassified | 3823 |
| 2 | ARSoilOldRDRAFT_c000065 | 3300000044 | Bacteria | 20923 |
| 3 | Ga0070658_10013344 | 3300005327 | Bacteria | 6594 |
| 4 | Ga0070683_100032525 | 3300005329 | Bacteria | 4750 |
| 5 | Ga0070683_100215701 | 3300005329 | Bacteria | 1823 |
| 6 | Ga0070690_100031526 | 3300005330 | Bacteria | 3303 |
| 7 | Ga0070670_100073248 | 3300005331 | Bacteria | 2942 |
| 8 | Ga0070670_100174214 | 3300005331 | Bacteria | 1867 |
| 9 | Ga0068869_100171182 | 3300005334 | Bacteria | 1696 |
| 10 | Ga0070666_10008838 | 3300005335 | Bacteria | 6262 |
| 11 | Ga0070680_100012153 | 3300005336 | Bacteria | 6686 |
| 12 | Ga0070680_100406427 | 3300005336 | Bacteria | 1161 |
| 13 | Ga0070682_100029483 | 3300005337 | Bacteria | 3304 |
| 14 | Ga0068868_100035011 | 3300005338 | Bacteria | 3880 |
| 15 | Ga0068868_100071224 | 3300005338 | Bacteria | 2772 |
| 16 | Ga0068868_100194829 | 3300005338 | Unclassified | 1687 |
| 17 | Ga0070660_100067773 | 3300005339 | Unclassified | 2781 |
| 18 | Ga0070660_100194610 | 3300005339 | Unclassified | 1643 |
| 19 | Ga0070691_10013368 | 3300005341 | Bacteria | 3760 |
| 20 | Ga0070691_10061188 | 3300005341 | Bacteria | 1811 |
| 21 | Ga0070687_100014213 | 3300005343 | Bacteria | 3571 |
| 22 | Ga0070661_100026196 | 3300005344 | Bacteria | 4192 |
| 23 | Ga0070692_10076185 | 3300005345 | Bacteria | 1797 |
| 24 | Ga0070668_100041834 | 3300005347 | Bacteria | 3511 |
| 25 | Ga0070669_100317490 | 3300005353 | Unclassified | 1257 |
| 26 | Ga0070675_100029877 | 3300005354 | Bacteria | 4397 |
| 27 | Ga0070671_100017927 | 3300005355 | Bacteria | 5743 |
| 28 | Ga0070671_100107551 | 3300005355 | Bacteria | 2342 |
| 29 | Ga0070674_100223071 | 3300005356 | Unclassified | 1467 |
| 30 | Ga0070673_100313614 | 3300005364 | Bacteria | 1384 |
| 31 | Ga0070688_100013038 | 3300005365 | Bacteria | 4678 |
| 32 | Ga0070659_100247923 | 3300005366 | Unclassified | 1475 |
| 33 | Ga0070667_100027719 | 3300005367 | Bacteria | 4713 |
| 34 | Ga0070667_100355732 | 3300005367 | Bacteria | 1326 |
| 35 | Ga0070709_10003774 | 3300005434 | Bacteria | 8144 |
| 36 | Ga0070709_10247378 | 3300005434 | Unclassified | 1283 |
| 37 | Ga0070714_100055028 | 3300005435 | Bacteria | 3400 |
| 38 | Ga0070714_100075294 | 3300005435 | Bacteria | 2928 |
| 39 | Ga0070714_100139858 | 3300005435 | Bacteria | 2172 |
| 40 | Ga0070713_100000923 | 3300005436 | Bacteria | 18738 |
| 41 | Ga0070713_100034040 | 3300005436 | Bacteria | 4088 |
| 42 | Ga0070713_100114274 | 3300005436 | Bacteria | 2358 |
| 43 | Ga0070710_10001800 | 3300005437 | Bacteria | 10137 |
| 44 | Ga0070710_10043525 | 3300005437 | Unclassified | 2487 |
| 45 | Ga0070710_10136407 | 3300005437 | Unclassified | 1500 |
| 46 | Ga0070710_10190217 | 3300005437 | Bacteria | 1290 |
| 47 | Ga0070710_10223251 | 3300005437 | Bacteria | 1199 |
| 48 | Ga0070701_10091121 | 3300005438 | Unclassified | 1670 |
| 49 | Ga0070701_10185759 | 3300005438 | Bacteria | 1220 |
| 50 | Ga0070711_100020052 | 3300005439 | Bacteria | 4301 |
| 51 | Ga0070711_100089950 | 3300005439 | Unclassified | 2210 |
| 52 | Ga0070711_100447851 | 3300005439 | Bacteria | 1056 |
| 53 | Ga0070705_100081312 | 3300005440 | Unclassified | 1990 |
| 54 | Ga0070700_100228287 | 3300005441 | Unclassified | 1323 |
| 55 | Ga0070694_100055482 | 3300005444 | Bacteria | 2687 |
| 56 | Ga0070663_100012044 | 3300005455 | Bacteria | 5456 |
| 57 | Ga0070663_100034499 | 3300005455 | Bacteria | 3505 |
| 58 | Ga0070663_100094641 | 3300005455 | Unclassified | 2219 |
| 59 | Ga0070662_100043615 | 3300005457 | Bacteria | 3210 |
| 60 | Ga0070681_10004462 | 3300005458 | Bacteria | 13334 |
| 61 | Ga0070681_10032029 | 3300005458 | Bacteria | 5277 |
| 62 | Ga0068867_100019732 | 3300005459 | Bacteria | 4802 |
| 63 | Ga0070685_10019636 | 3300005466 | Bacteria | 3649 |
| 64 | Ga0070706_100055278 | 3300005467 | Bacteria | 3664 |
| 65 | Ga0070706_100120354 | 3300005467 | Bacteria | 2447 |
| 66 | Ga0070679_100021543 | 3300005530 | Bacteria | 6294 |
| 67 | Ga0070679_100107410 | 3300005530 | Bacteria | 2777 |
| 68 | Ga0070679_100152190 | 3300005530 | Bacteria | 2290 |
| 69 | Ga0070684_100137545 | 3300005535 | Bacteria | 2207 |
| 70 | Ga0070684_100243053 | 3300005535 | Bacteria | 1645 |
| 71 | Ga0068853_100461751 | 3300005539 | Bacteria | 1195 |
| 72 | Ga0070686_100013188 | 3300005544 | Bacteria | 4723 |
| 73 | Ga0070695_100068494 | 3300005545 | Bacteria | 2317 |
| 74 | Ga0070696_100109237 | 3300005546 | Bacteria | 1990 |
| 75 | Ga0070693_100044105 | 3300005547 | Bacteria | 2521 |
| 76 | Ga0070665_100385802 | 3300005548 | Unclassified | 1408 |
| 77 | Ga0070704_100205824 | 3300005549 | Unclassified | 1591 |
| 78 | Ga0068855_100017760 | 3300005563 | Bacteria | 8551 |
| 79 | Ga0070664_100089868 | 3300005564 | Unclassified | 2658 |
| 80 | Ga0070664_100103957 | 3300005564 | Bacteria | 2473 |
| 81 | Ga0068856_100310923 | 3300005614 | Bacteria | 1593 |
| 82 | Ga0070702_100005470 | 3300005615 | Bacteria | 5920 |
| 83 | Ga0070702_100024201 | 3300005615 | Bacteria | 3236 |
| 84 | Ga0068859_100032057 | 3300005617 | Bacteria | 5279 |
| 85 | Ga0068866_10061197 | 3300005718 | Bacteria | 1954 |
| 86 | Ga0068861_100066615 | 3300005719 | Bacteria | 2777 |
| 87 | Ga0068863_100015305 | 3300005841 | Bacteria | 7372 |
| 88 | Ga0068863_100062596 | 3300005841 | Bacteria | 3518 |
| 89 | Ga0068858_100066971 | 3300005842 | Bacteria | 3325 |
| 90 | Ga0068858_100352348 | 3300005842 | Bacteria | 1410 |
| 91 | Ga0068860_100032446 | 3300005843 | Bacteria | 5018 |
| 92 | Ga0068860_100042471 | 3300005843 | Bacteria | 4341 |
| 93 | Ga0068860_100128312 | 3300005843 | Bacteria | 2432 |
| 94 | Ga0081455_10001955 | 3300005937 | Bacteria | 24750 |
| 95 | Ga0081455_10005468 | 3300005937 | Bacteria | 13924 |
| 96 | Ga0081455_10024203 | 3300005937 | Bacteria | 5630 |
| 97 | Ga0081455_10100522 | 3300005937 | Bacteria | 2323 |
| 98 | Ga0081455_10156660 | 3300005937 | Bacteria | 1750 |
| 99 | Ga0070717_10004425 | 3300006028 | Bacteria | 10144 |
| 100 | Ga0070717_10007219 | 3300006028 | Bacteria | 8242 |
| 101 | Ga0075365_10034651 | 3300006038 | Bacteria | 3261 |
| 102 | Ga0075364_10029649 | 3300006051 | Bacteria | 3510 |
| 103 | Ga0075432_10031978 | 3300006058 | Bacteria | 1822 |
| 104 | Ga0070715_10015983 | 3300006163 | Bacteria | 2810 |
| 105 | Ga0070715_10045606 | 3300006163 | Bacteria | 1859 |
| 106 | Ga0070716_100004152 | 3300006173 | Bacteria | 6879 |
| 107 | Ga0070716_100097712 | 3300006173 | Bacteria | 1793 |
| 108 | Ga0070712_100000152 | 3300006175 | Bacteria | 36965 |
| 109 | Ga0070712_100001612 | 3300006175 | Bacteria | 13801 |
| 110 | Ga0070712_100005090 | 3300006175 | Bacteria | 8139 |
| 111 | Ga0070712_100006051 | 3300006175 | Bacteria | 7492 |
| 112 | Ga0070712_100007463 | 3300006175 | Bacteria | 6826 |
| 113 | Ga0070712_100017046 | 3300006175 | Bacteria | 4696 |
| 114 | Ga0070712_100048364 | 3300006175 | Bacteria | 2948 |
| 115 | Ga0070712_100085934 | 3300006175 | Bacteria | 2291 |
| 116 | Ga0070712_100107234 | 3300006175 | Bacteria | 2078 |
| 117 | Ga0070712_100311454 | 3300006175 | Bacteria | 1277 |
| 118 | Ga0075427_10008290 | 3300006194 | Bacteria | 1538 |
| 119 | Ga0097621_100044921 | 3300006237 | Bacteria | 3566 |
| 120 | Ga0097621_100049306 | 3300006237 | Bacteria | 3420 |
| 121 | Ga0097621_100079195 | 3300006237 | Bacteria | 2731 |
| 122 | Ga0068871_100006454 | 3300006358 | Bacteria | 8299 |
| 123 | Ga0075428_100046328 | 3300006844 | Unclassified | 4776 |
| 124 | Ga0075428_100067941 | 3300006844 | Bacteria | 3900 |
| 125 | Ga0075428_100075063 | 3300006844 | Bacteria | 3693 |
| 126 | Ga0075428_100207343 | 3300006844 | Bacteria | 2118 |
| 127 | Ga0075428_100246885 | 3300006844 | Archaea | 1924 |
| 128 | Ga0075428_100458872 | 3300006844 | Unclassified | 1364 |
| 129 | Ga0075430_100103543 | 3300006846 | Bacteria | 2376 |
| 130 | Ga0075430_100238655 | 3300006846 | Bacteria | 1506 |
| 131 | Ga0075430_100239586 | 3300006846 | Archaea | 1503 |
| 132 | Ga0075431_100078296 | 3300006847 | Bacteria | 3412 |
| 133 | Ga0075431_100194443 | 3300006847 | Bacteria | 2077 |
| 134 | Ga0075431_100237436 | 3300006847 | Bacteria | 1855 |
| 135 | Ga0075431_100342876 | 3300006847 | Archaea | 1503 |
| 136 | Ga0075433_10025033 | 3300006852 | Bacteria | 5044 |
| 137 | Ga0075433_10035167 | 3300006852 | Bacteria | 4306 |
| 138 | Ga0075433_10157415 | 3300006852 | Bacteria | 2021 |
| 139 | Ga0075434_100020106 | 3300006871 | Bacteria | 6470 |
| 140 | Ga0075434_100048599 | 3300006871 | Bacteria | 4209 |
| 141 | Ga0075434_100263797 | 3300006871 | Unclassified | 1742 |
| 142 | Ga0075434_100292979 | 3300006871 | Archaea | 1647 |
| 143 | Ga0075434_100322650 | 3300006871 | Bacteria | 1565 |
| 144 | Ga0075434_100382915 | 3300006871 | Bacteria | 1427 |
| 145 | Ga0075429_100003840 | 3300006880 | Bacteria | 12830 |
| 146 | Ga0075429_100056429 | 3300006880 | Bacteria | 3418 |
| 147 | Ga0075429_100126461 | 3300006880 | Bacteria | 2235 |
| 148 | Ga0075429_100142591 | 3300006880 | Archaea | 2097 |
| 149 | Ga0075429_100216177 | 3300006880 | Bacteria | 1679 |
| 150 | Ga0075429_100247926 | 3300006880 | Bacteria | 1559 |
| 151 | Ga0075429_100371792 | 3300006880 | Bacteria | 1251 |
| 152 | Ga0068865_100010590 | 3300006881 | Bacteria | 5746 |
| 153 | Ga0097620_100032057 | 3300006931 | Bacteria | 5279 |
| 154 | Ga0075435_100014492 | 3300007076 | Bacteria | 5894 |
| 155 | Ga0099794_10011522 | 3300007265 | Unclassified | 3788 |
| 156 | Ga0099794_10068857 | 3300007265 | Bacteria | 1731 |
| 157 | Ga0099795_10056721 | 3300007788 | Bacteria | 1442 |
| 158 | Ga0105240_10061524 | 3300009093 | Bacteria | 4679 |
| 159 | Ga0111539_10015907 | 3300009094 | Bacteria | 9343 |
| 160 | Ga0111539_10016150 | 3300009094 | Bacteria | 9262 |
| 161 | Ga0111539_10025469 | 3300009094 | Bacteria | 7254 |
| 162 | Ga0111539_10065075 | 3300009094 | Bacteria | 4311 |
| 163 | Ga0111539_10333719 | 3300009094 | Archaea | 1765 |
| 164 | Ga0111539_10480413 | 3300009094 | Unclassified | 1447 |
| 165 | Ga0105245_10005433 | 3300009098 | Bacteria | 11193 |
| 166 | Ga0105245_10055899 | 3300009098 | Bacteria | 3546 |
| 167 | Ga0105245_10402658 | 3300009098 | Unclassified | 1368 |
| 168 | Ga0105247_10049357 | 3300009101 | Unclassified | 2587 |
| 169 | Ga0114129_10068290 | 3300009147 | Bacteria | 4956 |
| 170 | Ga0114129_10160321 | 3300009147 | Bacteria | 3073 |
| 171 | Ga0114129_10388360 | 3300009147 | Bacteria | 1842 |
| 172 | Ga0114129_10547328 | 3300009147 | Archaea | 1506 |
| 173 | Ga0105243_10002091 | 3300009148 | Bacteria | 16915 |
| 174 | Ga0105243_10041858 | 3300009148 | Bacteria | 3583 |
| 175 | Ga0105241_10051972 | 3300009174 | Bacteria | 3127 |
| 176 | Ga0105241_10205606 | 3300009174 | Bacteria | 1647 |
| 177 | Ga0105242_10016785 | 3300009176 | Bacteria | 5698 |
| 178 | Ga0105242_10020765 | 3300009176 | Bacteria | 5151 |
| 179 | Ga0105248_10025971 | 3300009177 | Bacteria | 6514 |
| 180 | Ga0105248_10766371 | 3300009177 | Bacteria | 1089 |
| 181 | Ga0105237_10054339 | 3300009545 | Bacteria | 4012 |
| 182 | Ga0105238_10032771 | 3300009551 | Bacteria | 5288 |
| 183 | Ga0105249_10023992 | 3300009553 | Bacteria | 5478 |
| 184 | Ga0105249_10046888 | 3300009553 | Unclassified | 3935 |
| 185 | Ga0105249_10137536 | 3300009553 | Bacteria | 2340 |
| 186 | Ga0105239_10095686 | 3300010375 | Bacteria | 3280 |
| 187 | Ga0105239_10110462 | 3300010375 | Unclassified | 3048 |
| 188 | Ga0105239_10195787 | 3300010375 | Bacteria | 2263 |
| 189 | Ga0105246_10027298 | 3300011119 | Unclassified | 3739 |
| 190 | Ga0157370_10150244 | 3300013104 | Bacteria | 2168 |
| 191 | Ga0157374_10036731 | 3300013296 | Bacteria | 4490 |
| 192 | Ga0157374_10092945 | 3300013296 | Unclassified | 2879 |
| 193 | Ga0157378_10011633 | 3300013297 | Bacteria | 7705 |
| 194 | Ga0157378_10019818 | 3300013297 | Bacteria | 5914 |
| 195 | Ga0157378_10125604 | 3300013297 | Bacteria | 2369 |
| 196 | Ga0163162_10021332 | 3300013306 | Bacteria | 6378 |
| 197 | Ga0163162_10111399 | 3300013306 | Bacteria | 2834 |
| 198 | Ga0157375_10009637 | 3300013308 | Bacteria | 8487 |
| 199 | Ga0157375_10245606 | 3300013308 | Bacteria | 1950 |
| 200 | Ga0157375_10688806 | 3300013308 | Unclassified | 1176 |
| 201 | Ga0163163_10014823 | 3300014325 | Bacteria | 7178 |
| 202 | Ga0163163_10050054 | 3300014325 | Bacteria | 4114 |
| 203 | Ga0163163_10329715 | 3300014325 | Bacteria | 1581 |
| 204 | Ga0157380_10120594 | 3300014326 | Bacteria | 2221 |
| 205 | Ga0157379_10019495 | 3300014968 | Bacteria | 5992 |
| 206 | Ga0157379_10044185 | 3300014968 | Bacteria | 3977 |
| 207 | Ga0157376_10015168 | 3300014969 | Bacteria | 5812 |
| 208 | Ga0157376_10027383 | 3300014969 | Bacteria | 4517 |
| 209 | Ga0157376_10072633 | 3300014969 | Bacteria | 2927 |
| 210 | Ga0157376_10172255 | 3300014969 | Bacteria | 1972 |
| 211 | Ga0163161_10056567 | 3300017792 | Unclassified | 2849 |
| 212 | Ga0163161_10386990 | 3300017792 | Bacteria | 1119 |
| 213 | Ga0213875_10001694 | 3300021388 | Bacteria | 13874 |
| 214 | Ga0207692_10017964 | 3300025898 | Bacteria | 3165 |
| 215 | Ga0207692_10029119 | 3300025898 | Bacteria | 2621 |
| 216 | Ga0207692_10190285 | 3300025898 | Bacteria | 1201 |
| 217 | Ga0207710_10016265 | 3300025900 | Bacteria | 3147 |
| 218 | Ga0207688_10015657 | 3300025901 | Bacteria | 4113 |
| 219 | Ga0207680_10047161 | 3300025903 | Unclassified | 2551 |
| 220 | Ga0207699_10006751 | 3300025906 | Bacteria | 5573 |
| 221 | Ga0207699_10025698 | 3300025906 | Unclassified | 3236 |
| 222 | Ga0207699_10179005 | 3300025906 | Unclassified | 1424 |
| 223 | Ga0207645_10014673 | 3300025907 | Bacteria | 5232 |
| 224 | Ga0207643_10016238 | 3300025908 | Bacteria | 4061 |
| 225 | Ga0207684_10084803 | 3300025910 | Bacteria | 2698 |
| 226 | Ga0207684_10210458 | 3300025910 | Bacteria | 1677 |
| 227 | Ga0207707_10012634 | 3300025912 | Bacteria | 7339 |
| 228 | Ga0207693_10002719 | 3300025915 | Bacteria | 15332 |
| 229 | Ga0207693_10007070 | 3300025915 | Bacteria | 9265 |
| 230 | Ga0207693_10010191 | 3300025915 | Bacteria | 7634 |
| 231 | Ga0207693_10010613 | 3300025915 | Bacteria | 7472 |
| 232 | Ga0207693_10012093 | 3300025915 | Bacteria | 6978 |
| 233 | Ga0207693_10061411 | 3300025915 | Bacteria | 2943 |
| 234 | Ga0207693_10097444 | 3300025915 | Bacteria | 2306 |
| 235 | Ga0207693_10228538 | 3300025915 | Bacteria | 1461 |
| 236 | Ga0207663_10029771 | 3300025916 | Bacteria | 3211 |
| 237 | Ga0207663_10030742 | 3300025916 | Bacteria | 3170 |
| 238 | Ga0207663_10123698 | 3300025916 | Bacteria | 1776 |
| 239 | Ga0207663_10262407 | 3300025916 | Unclassified | 1276 |
| 240 | Ga0207660_10008319 | 3300025917 | Bacteria | 6705 |
| 241 | Ga0207660_10220294 | 3300025917 | Bacteria | 1489 |
| 242 | Ga0207662_10075312 | 3300025918 | Bacteria | 2050 |
| 243 | Ga0207657_10190157 | 3300025919 | Unclassified | 1656 |
| 244 | Ga0207649_10257503 | 3300025920 | Bacteria | 1260 |
| 245 | Ga0207652_10322077 | 3300025921 | Bacteria | 1395 |
| 246 | Ga0207694_10178942 | 3300025924 | Bacteria | 1719 |
| 247 | Ga0207650_10027179 | 3300025925 | Bacteria | 4093 |
| 248 | Ga0207650_10195809 | 3300025925 | Unclassified | 1616 |
| 249 | Ga0207687_10031905 | 3300025927 | Bacteria | 3564 |
| 250 | Ga0207700_10002289 | 3300025928 | Bacteria | 10987 |
| 251 | Ga0207700_10124042 | 3300025928 | Bacteria | 2098 |
| 252 | Ga0207700_10161769 | 3300025928 | Unclassified | 1860 |
| 253 | Ga0207700_10262399 | 3300025928 | Bacteria | 1480 |
| 254 | Ga0207664_10075598 | 3300025929 | Bacteria | 2724 |
| 255 | Ga0207664_10123800 | 3300025929 | Bacteria | 2168 |
| 256 | Ga0207664_10155563 | 3300025929 | Unclassified | 1946 |
| 257 | Ga0207644_10025420 | 3300025931 | Bacteria | 4072 |
| 258 | Ga0207644_10176433 | 3300025931 | Bacteria | 1672 |
| 259 | Ga0207690_10188960 | 3300025932 | Unclassified | 1557 |
| 260 | Ga0207706_10309080 | 3300025933 | Bacteria | 1377 |
| 261 | Ga0207686_10023983 | 3300025934 | Bacteria | 3528 |
| 262 | Ga0207709_10001690 | 3300025935 | Bacteria | 14840 |
| 263 | Ga0207669_10186711 | 3300025937 | Unclassified | 1491 |
| 264 | Ga0207704_10014448 | 3300025938 | Bacteria | 3986 |
| 265 | Ga0207704_10064424 | 3300025938 | Bacteria | 2290 |
| 266 | Ga0207704_10325416 | 3300025938 | Bacteria | 1187 |
| 267 | Ga0207665_10000223 | 3300025939 | Bacteria | 38647 |
| 268 | Ga0207665_10037889 | 3300025939 | Unclassified | 3209 |
| 269 | Ga0207711_10036147 | 3300025941 | Bacteria | 4190 |
| 270 | Ga0207711_10408534 | 3300025941 | Unclassified | 1262 |
| 271 | Ga0207661_10052476 | 3300025944 | Bacteria | 3258 |
| 272 | Ga0207679_10034277 | 3300025945 | Bacteria | 3580 |
| 273 | Ga0207679_10081531 | 3300025945 | Bacteria | 2474 |
| 274 | Ga0207667_10018882 | 3300025949 | Bacteria | 7713 |
| 275 | Ga0207667_10629318 | 3300025949 | Bacteria | 1080 |
| 276 | Ga0207712_10098067 | 3300025961 | Unclassified | 2173 |
| 277 | Ga0207712_10155881 | 3300025961 | Bacteria | 1769 |
| 278 | Ga0207677_10052394 | 3300026023 | Bacteria | 2772 |
| 279 | Ga0207677_10364164 | 3300026023 | Unclassified | 1215 |
| 280 | Ga0207703_10104985 | 3300026035 | Unclassified | 2401 |
| 281 | Ga0207703_10311976 | 3300026035 | Bacteria | 1438 |
| 282 | Ga0207678_10022573 | 3300026067 | Bacteria | 5511 |
| 283 | Ga0207678_10046170 | 3300026067 | Bacteria | 3767 |
| 284 | Ga0207678_10115428 | 3300026067 | Unclassified | 2291 |
| 285 | Ga0207708_10059417 | 3300026075 | Bacteria | 2918 |
| 286 | Ga0207702_10107216 | 3300026078 | Bacteria | 2477 |
| 287 | Ga0207641_10013191 | 3300026088 | Bacteria | 6775 |
| 288 | Ga0207676_10106741 | 3300026095 | Bacteria | 2334 |
| 289 | Ga0207676_10305287 | 3300026095 | Unclassified | 1454 |
| 290 | Ga0207676_10343301 | 3300026095 | Bacteria | 1378 |
| 291 | Ga0207675_100068390 | 3300026118 | Bacteria | 3319 |
| 292 | Ga0207683_10015344 | 3300026121 | Bacteria | 6524 |
| 293 | Ga0207683_10050910 | 3300026121 | Bacteria | 3628 |
| 294 | Ga0207428_10004670 | 3300027907 | Bacteria | 12979 |
| 295 | Ga0207428_10014965 | 3300027907 | Bacteria | 6722 |
| 296 | Ga0207428_10015195 | 3300027907 | Bacteria | 6663 |
| 297 | Ga0207428_10043497 | 3300027907 | Bacteria | 3627 |
| 298 | Ga0207428_10073555 | 3300027907 | Bacteria | 2681 |
| 299 | Ga0207428_10192556 | 3300027907 | Bacteria | 1537 |
| 300 | Ga0268266_10008517 | 3300028379 | Bacteria | 9112 |
| 301 | Ga0268266_10463885 | 3300028379 | Bacteria | 1205 |
| 302 | Ga0268264_10124825 | 3300028381 | Unclassified | 2273 |
| 303 | Ga0373948_0009240 | 3300034817 | Unclassified | 1697 |
| 304 | Ga0373928_0036346 | 3300035084 | Unclassified | 1113 |
| 305 | Ga0373929_0002042 | 3300035085 | Unclassified | 3754 |
| 306 | Ga0373944_0007107 | 3300035089 | Bacteria | 2993 |
| 307 | Ga0373923_0017150 | 3300035111 | Bacteria | 2765 |
| 308 | Ga0373932_0001123 | 3300035112 | Bacteria | 7728 |
| 309 | Ga0373932_0020084 | 3300035112 | Unclassified | 1748 |
| 310 | Ga0373939_0001315 | 3300035114 | Bacteria | 6034 |
| 311 | Ga0373941_0004546 | 3300035115 | Unclassified | 3214 |
| 312 | Ga0373945_0005488 | 3300035116 | Bacteria | 4059 |
| 313 | Ga0373945_0018869 | 3300035116 | Bacteria | 2350 |
| 314 | Ga0373945_0100846 | 3300035116 | Bacteria | 1129 |
| 315 | Ga0373954_0013602 | 3300035118 | Bacteria | 3627 |
| 316 | Ga0373960_0000064 | 3300035121 | Bacteria | 14939 |
| 317 | Ga0373960_0023746 | 3300035121 | Bacteria | 1653 |
| 318 | Ga0373960_0070309 | 3300035121 | Unclassified | 1081 |
| 319 | Ga0373943_0056454 | 3300035170 | Bacteria | 1948 |
| 320 | Ga0373946_0006191 | 3300035171 | Bacteria | 4333 |
| 321 | Ga0373946_0031331 | 3300035171 | Unclassified | 2128 |
| 322 | Ga0373946_0126969 | 3300035171 | Unclassified | 1170 |
| 323 | Ga0373962_0001185 | 3300035242 | Bacteria | 6095 |
| 324 | Ga0373962_0014611 | 3300035242 | Bacteria | 2003 |
| 325 | Ga0373924_0016909 | 3300035410 | Bacteria | 2790 |
| 326 | Ga0373924_0062118 | 3300035410 | Bacteria | 1564 |
| 327 | Ga0373931_0001721 | 3300035691 | Bacteria | 9491 |
| 328 | Ga0373931_0004124 | 3300035691 | Bacteria | 6593 |
| 329 | Ga0373931_0008848 | 3300035691 | Bacteria | 4793 |
| 330 | Ga0373935_0086318 | 3300035692 | Unclassified | 2047 |
| 331 | Ga0373935_0099411 | 3300035692 | Bacteria | 1915 |
| 332 | Ga0373935_0312671 | 3300035692 | Bacteria | 1113 |
| 333 | Ga0373927_0118623 | 3300035695 | Bacteria | 1726 |
| 334 | Ga0373927_0211941 | 3300035695 | Unclassified | 1272 |
| 335 | Ga0373927_0217532 | 3300035695 | Bacteria | 1255 |
| 336 | Ga0373927_0219795 | 3300035695 | Bacteria | 1248 |
| 337 | Ga0373933_0203455 | 3300035724 | Unclassified | 1267 |
| 338 | Ga0373947_0044438 | 3300035725 | Unclassified | 2655 |
| 339 | Ga0373947_0055031 | 3300035725 | Bacteria | 2402 |
| 340 | Ga0373947_0123297 | 3300035725 | Bacteria | 1648 |
| 341 | Ga0373947_0253979 | 3300035725 | Bacteria | 1163 |
| 342 | Ga0373937_0233087 | 3300036401 | Bacteria | 1734 |
| 343 | Ga0436364_1030895 | 3300037853 | Bacteria | 42604 |
| 344 | Ga0495592_0020257 | 3300046454 | Bacteria | 5060 |
| 345 | Ga0495592_0066060 | 3300046454 | Bacteria | 2647 |
| 346 | Ga0495603_0018645 | 3300046455 | Bacteria | 4198 |
| 347 | Ga0495629_0020608 | 3300046459 | Bacteria | 4709 |
| 348 | Ga0495651_0009655 | 3300046462 | Bacteria | 7419 |
| 349 | Ga0495651_0102235 | 3300046462 | Bacteria | 2132 |
| 350 | Ga0495651_0218602 | 3300046462 | Bacteria | 1320 |
| 351 | Ga0495653_0019340 | 3300046463 | Bacteria | 5524 |
| 352 | Ga0495653_0167905 | 3300046463 | Bacteria | 1517 |
| 353 | Ga0495580_0055689 | 3300046472 | Bacteria | 2786 |
| 354 | Ga0495582_0002764 | 3300046473 | Bacteria | 9790 |
| 355 | Ga0495582_0145381 | 3300046473 | Bacteria | 1345 |
| 356 | Ga0495639_0048956 | 3300046475 | Bacteria | 1917 |
| 357 | Ga0495662_0035433 | 3300046476 | Unclassified | 2408 |
| 358 | Ga0495662_0039630 | 3300046476 | Bacteria | 2276 |
| 359 | Ga0495662_0067112 | 3300046476 | Bacteria | 1736 |
| 360 | Ga0495662_0069873 | 3300046476 | Bacteria | 1701 |
| 361 | Ga0495664_0003466 | 3300046477 | Bacteria | 8587 |
| 362 | Ga0495664_0011692 | 3300046477 | Unclassified | 4954 |
| 363 | Ga0495664_0023314 | 3300046477 | Plasmid | 3592 |
| 364 | Ga0495585_0151617 | 3300046492 | Bacteria | 1208 |
| 365 | Ga0495594_0051048 | 3300046499 | Bacteria | 2276 |
| 366 | Ga0495594_0082286 | 3300046499 | Bacteria | 1798 |
| 367 | Ga0495608_0063938 | 3300046511 | Bacteria | 2413 |
| 368 | Ga0495608_0072335 | 3300046511 | Unclassified | 2249 |
| 369 | Ga0495618_0022171 | 3300046514 | Bacteria | 3921 |
| 370 | Ga0495618_0024995 | 3300046514 | Bacteria | 3706 |
| 371 | Ga0495618_0084634 | 3300046514 | Bacteria | 2026 |
| 372 | Ga0495618_0152772 | 3300046514 | Bacteria | 1474 |
| 373 | Ga0495628_0077369 | 3300046516 | Unclassified | 2588 |
| 374 | Ga0495628_0126344 | 3300046516 | Bacteria | 1959 |
| 375 | Ga0495628_0266185 | 3300046516 | Unclassified | 1276 |
| 376 | Ga0495630_0040874 | 3300046517 | Bacteria | 3464 |
| 377 | Ga0495644_0010409 | 3300046523 | Bacteria | 3584 |
| 378 | Ga0495644_0042716 | 3300046523 | Bacteria | 1707 |
| 379 | Ga0495666_0026753 | 3300046526 | Bacteria | 2841 |
| 380 | Ga0495652_0031632 | 3300046529 | Bacteria | 4633 |
| 381 | Ga0495652_0069543 | 3300046529 | Bacteria | 2947 |
| 382 | Ga0495665_0084196 | 3300046531 | Bacteria | 1671 |
| 383 | Ga0495665_0093448 | 3300046531 | Bacteria | 1580 |
| 384 | Ga0495640_0017049 | 3300046533 | Bacteria | 5421 |
| 385 | Ga0495640_0041097 | 3300046533 | Unclassified | 3233 |
| 386 | Ga0495640_0042267 | 3300046533 | Plasmid | 3182 |
| 387 | Ga0495640_0081061 | 3300046533 | Bacteria | 2157 |
| 388 | Ga0495640_0099625 | 3300046533 | Bacteria | 1909 |
| 389 | Ga0495586_0164365 | 3300046535 | Bacteria | 1252 |
| 390 | Ga0495587_0026520 | 3300046536 | Unclassified | 3533 |
| 391 | Ga0495587_0044014 | 3300046536 | Bacteria | 2656 |
| 392 | Ga0495645_0111108 | 3300046543 | Bacteria | 1939 |
| 393 | Ga0495667_0004013 | 3300046559 | Bacteria | 9889 |
| 394 | Ga0495667_0052295 | 3300046559 | Unclassified | 2691 |
| 395 | Ga0495656_0030836 | 3300046615 | Bacteria | 2170 |
| 396 | Ga0495634_0024631 | 3300046642 | Bacteria | 4219 |
| 397 | Ga0495634_0032131 | 3300046642 | Unclassified | 3611 |
| 398 | Ga0495634_0041018 | 3300046642 | Bacteria | 3145 |
| 399 | Ga0495634_0050879 | 3300046642 | Bacteria | 2780 |
| 400 | Ga0495634_0152320 | 3300046642 | Unclassified | 1462 |
| 401 | Ga0495634_0233586 | 3300046642 | Unclassified | 1130 |
| 402 | Ga0495635_0009786 | 3300046663 | Bacteria | 6702 |
| 403 | Ga0495635_0034221 | 3300046663 | Bacteria | 3524 |
| 404 | Ga0495635_0053526 | 3300046663 | Plasmid | 2781 |
| 405 | Ga0495635_0095729 | 3300046663 | Bacteria | 2029 |
| 406 | Ga0495588_0086635 | 3300046674 | Bacteria | 1638 |
| 407 | Ga0495657_0017257 | 3300046675 | Bacteria | 5244 |
| 408 | Ga0495646_0069519 | 3300046680 | Unclassified | 2077 |
| 409 | Ga0495647_0034188 | 3300046681 | Bacteria | 1903 |
| 410 | Ga0495658_0088135 | 3300046683 | Bacteria | 1833 |
| 411 | Ga0495658_0192908 | 3300046683 | Bacteria | 1267 |
| 412 | Ga0495613_0079701 | 3300046689 | Bacteria | 2381 |
| 413 | Ga0495613_0248516 | 3300046689 | Bacteria | 1242 |
| 414 | Ga0495624_0026957 | 3300046690 | Bacteria | 3764 |
| 415 | Ga0495624_0076173 | 3300046690 | Bacteria | 2082 |
| 416 | Ga0495600_0047376 | 3300046809 | Bacteria | 2803 |
| 417 | Ga0495600_0087424 | 3300046809 | Unclassified | 2033 |
| 418 | Ga0495581_0058903 | 3300047315 | Bacteria | 2218 |
| 419 | Ga0495604_0104267 | 3300047317 | Unclassified | 2078 |
| 420 | Ga0495674_0001877 | 3300047319 | Bacteria | 20678 |
| 421 | Ga0495674_0005000 | 3300047319 | Bacteria | 12756 |
| 422 | Ga0495674_0008643 | 3300047319 | Bacteria | 9682 |
| 423 | Ga0495674_0031831 | 3300047319 | Bacteria | 4786 |
| 424 | Ga0495676_0097020 | 3300047321 | Unclassified | 2190 |
| 425 | Ga0495676_0100272 | 3300047321 | Bacteria | 2144 |
| 426 | Ga0495676_0188924 | 3300047321 | Bacteria | 1438 |
| 427 | Ga0495680_0015575 | 3300047322 | Bacteria | 6558 |
| 428 | Ga0495680_0134535 | 3300047322 | Unclassified | 1813 |
| 429 | Ga0495680_0150848 | 3300047322 | Bacteria | 1695 |
| 430 | Ga0495680_0213292 | 3300047322 | Unclassified | 1381 |
| 431 | Ga0495675_0025056 | 3300047444 | Unclassified | 3804 |
| 432 | Ga0495684_0023821 | 3300047471 | Bacteria | 4707 |
| 433 | Ga0495684_0042879 | 3300047471 | Bacteria | 3464 |
| 434 | Ga0495684_0049472 | 3300047471 | Bacteria | 3211 |
| 435 | Ga0495684_0093406 | 3300047471 | Unclassified | 2278 |
| 436 | Ga0495684_0131754 | 3300047471 | Bacteria | 1877 |
| 437 | Ga0495684_0203340 | 3300047471 | Bacteria | 1459 |
| 438 | Ga0495593_0004152 | 3300047673 | Bacteria | 8620 |
| 439 | Ga0495593_0045830 | 3300047673 | Unclassified | 2332 |
| 440 | Ga0495602_0048245 | 3300048088 | Bacteria | 3829 |
| 441 | Ga0495614_0006790 | 3300048089 | Bacteria | 5121 |
| 442 | Ga0496100_0015805 | 3300048903 | Bacteria | 4415 |
| 443 | Ga0496101_0017030 | 3300048904 | Bacteria | 4921 |
| 444 | Ga0496101_0049766 | 3300048904 | Bacteria | 3015 |
| 445 | Ga0496101_0132060 | 3300048904 | Bacteria | 1897 |
| 446 | Ga0496102_0019575 | 3300048905 | Bacteria | 5962 |
| 447 | Ga0496102_0024115 | 3300048905 | Bacteria | 5406 |
| 448 | Ga0496102_0111189 | 3300048905 | Bacteria | 2554 |
| 449 | Ga0496102_0288895 | 3300048905 | Unclassified | 1545 |
| 450 | Ga0496104_0001724 | 3300048907 | Bacteria | 18886 |
| 451 | Ga0496104_0004332 | 3300048907 | Bacteria | 12345 |
| 452 | Ga0496104_0009159 | 3300048907 | Bacteria | 8804 |
| 453 | Ga0496104_0009515 | 3300048907 | Bacteria | 8651 |
| 454 | Ga0496104_0036875 | 3300048907 | Bacteria | 4571 |
| 455 | Ga0496104_0088807 | 3300048907 | Bacteria | 2953 |
| 456 | Ga0496104_0096179 | 3300048907 | Unclassified | 2833 |
| 457 | Ga0496104_0298133 | 3300048907 | Bacteria | 1524 |
| 458 | Ga0496104_0395429 | 3300048907 | Unclassified | 1294 |
| 459 | Ga0496104_0471638 | 3300048907 | Unclassified | 1166 |
| 460 | Ga0496105_0015982 | 3300048908 | Bacteria | 5986 |
| 461 | Ga0496105_0030253 | 3300048908 | Bacteria | 4438 |
| 462 | Ga0496105_0037882 | 3300048908 | Bacteria | 3972 |
| 463 | Ga0496105_0039513 | 3300048908 | Bacteria | 3889 |
| 464 | Ga0496106_0004487 | 3300048909 | Bacteria | 10355 |
| 465 | Ga0496106_0010963 | 3300048909 | Bacteria | 6702 |
| 466 | Ga0496106_0062967 | 3300048909 | Bacteria | 2818 |
| 467 | Ga0496106_0086904 | 3300048909 | Bacteria | 2409 |
| 468 | Ga0496107_0003431 | 3300048910 | Bacteria | 10597 |
| 469 | Ga0496107_0010967 | 3300048910 | Bacteria | 6305 |
| 470 | Ga0496107_0018111 | 3300048910 | Bacteria | 4955 |
| 471 | Ga0496108_0003735 | 3300048911 | Bacteria | 12211 |
| 472 | Ga0496108_0005575 | 3300048911 | Bacteria | 10182 |
| 473 | Ga0496108_0232738 | 3300048911 | Bacteria | 1602 |
| 474 | Ga0496108_0287654 | 3300048911 | Bacteria | 1431 |
| 475 | Ga0496108_0334455 | 3300048911 | Unclassified | 1321 |
| 476 | Ga0496108_0420934 | 3300048911 | Unclassified | 1166 |
| 477 | Ga0496108_0572872 | 3300048911 | Bacteria | 984 |
| 478 | Ga0496109_0007668 | 3300048912 | Bacteria | 9150 |
| 479 | Ga0496109_0009387 | 3300048912 | Bacteria | 8335 |
| 480 | Ga0496109_0011242 | 3300048912 | Bacteria | 7687 |
| 481 | Ga0496109_0014298 | 3300048912 | Bacteria | 6906 |
| 482 | Ga0496109_0104222 | 3300048912 | Bacteria | 2633 |
| 483 | Ga0496110_0006575 | 3300048913 | Bacteria | 9231 |
| 484 | Ga0496110_0007902 | 3300048913 | Bacteria | 8520 |
| 485 | Ga0496110_0044048 | 3300048913 | Bacteria | 3896 |
| 486 | Ga0496110_0400401 | 3300048913 | Bacteria | 1251 |
| 487 | Ga0496111_0022467 | 3300048914 | Bacteria | 4417 |
| 488 | Ga0496111_0029133 | 3300048914 | Bacteria | 3919 |
| 489 | Ga0496112_0014731 | 3300048915 | Bacteria | 7270 |
| 490 | Ga0496112_0095576 | 3300048915 | Bacteria | 2942 |
| 491 | Ga0496113_0001073 | 3300048916 | Bacteria | 14794 |
| 492 | Ga0496113_0145229 | 3300048916 | Bacteria | 1868 |
| 493 | Ga0496113_0315195 | 3300048916 | Unclassified | 1253 |
| 494 | Ga0496114_0012875 | 3300048917 | Bacteria | 6699 |
| 495 | Ga0496114_0194213 | 3300048917 | Bacteria | 1776 |
| 496 | Ga0496115_0001125 | 3300048918 | Bacteria | 19279 |
| 497 | Ga0496115_0004469 | 3300048918 | Bacteria | 10129 |
| 498 | Ga0496115_0009006 | 3300048918 | Bacteria | 7404 |
| 499 | Ga0496115_0041379 | 3300048918 | Bacteria | 3667 |
| 500 | Ga0496115_0055996 | 3300048918 | Bacteria | 3169 |
| 501 | Ga0496115_0087575 | 3300048918 | Bacteria | 2541 |
| 502 | Ga0496115_0502397 | 3300048918 | Bacteria | 974 |
| 503 | Ga0496126_0007361 | 3300048929 | Bacteria | 12078 |
| 504 | Ga0501033_0029098 | 3300049570 | Bacteria | 4151 |
| 505 | Ga0501036_0001307 | 3300049572 | Bacteria | 19098 |
| 506 | Ga0501038_0017354 | 3300049574 | Bacteria | 6506 |
| 507 | Ga0501040_0000025 | 3300049576 | Bacteria | 67931 |
| 508 | Ga0501041_0000622 | 3300049577 | Bacteria | 18491 |
| 509 | Ga0501042_0000557 | 3300049578 | Bacteria | 19690 |
| 510 | Ga0501043_0069071 | 3300049579 | Bacteria | 2775 |
| 511 | Ga0501046_0002146 | 3300049580 | Bacteria | 18616 |
| 512 | Ga0501048_0001229 | 3300049582 | Bacteria | 19404 |
| 513 | Ga0501068_0000699 | 3300049584 | Bacteria | 17212 |
| 514 | Ga0501070_0011156 | 3300049586 | Bacteria | 7584 |
| 515 | Ga0501071_0000002 | 3300049587 | Bacteria | 101947 |
| 516 | Ga0501072_0000096 | 3300049588 | Bacteria | 64956 |
| 517 | Ga0501074_0008514 | 3300049590 | Bacteria | 7432 |
| 518 | Ga0501075_0000013 | 3300049591 | Bacteria | 80672 |
| 519 | Ga0501076_0000026 | 3300049592 | Bacteria | 78198 |
| 520 | Ga0501077_0000057 | 3300049593 | Bacteria | 56829 |
| 521 | Ga0501079_0000049 | 3300049741 | Bacteria | 51742 |
| 522 | Ga0501080_0008256 | 3300049742 | Bacteria | 9431 |
| 523 | Ga0501081_0000018 | 3300049743 | Bacteria | 56676 |
| 524 | Ga0501035_0046236 | 3300049822 | Bacteria | 3915 |
| 525 | Ga0501045_0000108 | 3300049824 | Bacteria | 41575 |
| 526 | nmdc:mga00v17_65664_c1 | 3300050491 | Bacteria | 2239 |
| 527 | nmdc:mga05p37_19687_c1 | 3300050507 | Bacteria | 8165 |
| 528 | nmdc:mga05p37_29436_c1 | 3300050507 | Bacteria | 6702 |
| 529 | nmdc:mga05p37_324014_c1 | 3300050507 | Bacteria | 1823 |
| 530 | nmdc:mga05p37_441213_c1 | 3300050507 | Archaea | 1510 |
| 531 | nmdc:mga05p37_496712_c1 | 3300050507 | Bacteria | 1402 |
| 532 | nmdc:mga05p37_511744_c1 | 3300050507 | Bacteria | 1375 |
| 533 | nmdc:mga05p37_715781_c1 | 3300050507 | Bacteria | 1110 |
| 534 | nmdc:mga09592_19502_c1 | 3300050508 | Bacteria | 5570 |
| 535 | nmdc:mga09592_239344_c1 | 3300050508 | Bacteria | 1573 |
| 536 | nmdc:mga09592_345589_c1 | 3300050508 | Bacteria | 1288 |
| 537 | nmdc:mga09592_38643_c1 | 3300050508 | Bacteria | 4007 |
| 538 | nmdc:mga09592_48942_c1 | 3300050508 | Bacteria | 3564 |
| 539 | nmdc:mga09592_574999_c1 | 3300050508 | Unclassified | 967 |
| 540 | nmdc:mga09592_60476_c1 | 3300050508 | Unclassified | 3203 |
| 541 | nmdc:mga0qj67_175563_c1 | 3300050509 | Archaea | 1740 |
| 542 | nmdc:mga0qj67_264993_c1 | 3300050509 | Bacteria | 1394 |
| 543 | nmdc:mga0qj67_41289_c1 | 3300050509 | Bacteria | 3628 |
| 544 | nmdc:mga0qj67_58391_c1 | 3300050509 | Bacteria | 3059 |
| 545 | nmdc:mga0qj67_60060_c1 | 3300050509 | Bacteria | 3016 |
| 546 | nmdc:mga06r32_103597_c1 | 3300050510 | Bacteria | 2794 |
| 547 | nmdc:mga06r32_103963_c1 | 3300050510 | Bacteria | 2789 |
| 548 | nmdc:mga06r32_106000_c1 | 3300050510 | Unclassified | 2762 |
| 549 | nmdc:mga06r32_204444_c1 | 3300050510 | Bacteria | 1963 |
| 550 | nmdc:mga06r32_407973_c1 | 3300050510 | Unclassified | 1341 |
| 551 | nmdc:mga06r32_43682_c1 | 3300050510 | Bacteria | 4266 |
| 552 | nmdc:mga06r32_59289_c1 | 3300050510 | Bacteria | 3681 |
| 553 | nmdc:mga08y16_103085_c1 | 3300050511 | Bacteria | 2971 |
| 554 | nmdc:mga08y16_152866_c1 | 3300050511 | Bacteria | 2399 |
| 555 | nmdc:mga08y16_168471_c1 | 3300050511 | Archaea | 2276 |
| 556 | nmdc:mga08y16_22646_c1 | 3300050511 | Bacteria | 6633 |
| 557 | nmdc:mga08y16_30043_c1 | 3300050511 | Bacteria | 5723 |
| 558 | nmdc:mga08y16_42275_c1 | 3300050511 | Bacteria | 4774 |
| 559 | nmdc:mga08y16_562563_c1 | 3300050511 | Unclassified | 1153 |
| 560 | nmdc:mga08y16_5773_c1 | 3300050511 | Bacteria | 12961 |
| 561 | nmdc:mga08y16_8288_c1 | 3300050511 | Bacteria | 10874 |
| 562 | nmdc:mga0n895_17696_c1 | 3300050512 | Bacteria | 6576 |
| 563 | nmdc:mga0n895_39498_c1 | 3300050512 | Unclassified | 4579 |
| 564 | nmdc:mga0n895_43228_c1 | 3300050512 | Bacteria | 4390 |
| 565 | nmdc:mga0n895_71398_c1 | 3300050512 | Bacteria | 3443 |
| 566 | nmdc:mga0rr50_196703_c1 | 3300050513 | Bacteria | 1655 |
| 567 | nmdc:mga0rr50_248596_c1 | 3300050513 | Unclassified | 1476 |
| 568 | nmdc:mga0rr50_271799_c1 | 3300050513 | Bacteria | 1413 |
| 569 | nmdc:mga0a205_221424_c1 | 3300050515 | Unclassified | 1778 |
| 570 | nmdc:mga0a205_24136_c1 | 3300050515 | Bacteria | 5776 |
| 571 | nmdc:mga0a205_33865_c1 | 3300050515 | Bacteria | 4899 |
| 572 | Ga0495601_0000849 | 3300053077 | Bacteria | 16630 |
| 573 | Ga0495601_0001607 | 3300053077 | Bacteria | 12444 |
| 574 | Ga0495601_0003182 | 3300053077 | Bacteria | 9394 |
| 575 | Ga0495601_0022880 | 3300053077 | Unclassified | 3839 |
| 576 | Ga0495601_0030335 | 3300053077 | Bacteria | 3357 |
| 577 | Ga0495601_0092344 | 3300053077 | Bacteria | 1950 |
| 578 | Ga0495601_0100860 | 3300053077 | Unclassified | 1864 |
| 579 | Ga0495601_0179755 | 3300053077 | Bacteria | 1383 |
| 580 | Ga0495601_0305370 | 3300053077 | Bacteria | 1036 |
| 581 | Ga0495612_0001357 | 3300053078 | Bacteria | 10079 |
| 582 | Ga0495612_0027772 | 3300053078 | Bacteria | 2276 |
| 583 | Ga0495655_0021161 | 3300053083 | Bacteria | 1469 |
| 584 | Ga0495595_0037282 | 3300053084 | Unclassified | 2209 |
| 585 | Ga0495619_0000128 | 3300053085 | Bacteria | 55938 |
| 586 | Ga0495619_0002432 | 3300053085 | Bacteria | 12218 |
| 587 | Ga0495619_0003256 | 3300053085 | Bacteria | 10508 |
| 588 | Ga0495619_0015771 | 3300053085 | Bacteria | 4783 |
| 589 | Ga0495619_0074594 | 3300053085 | Unclassified | 2275 |
| 590 | Ga0495619_0163192 | 3300053085 | Bacteria | 1539 |
| 591 | Ga0495619_0167390 | 3300053085 | Bacteria | 1519 |
| 592 | Ga0495619_0262968 | 3300053085 | Bacteria | 1196 |
| 593 | Ga0501084_0000191 | 3300054114 | Bacteria | 47780 |
| 594 | Ga0501082_0000683 | 3300060353 | Bacteria | 29900 |
| 595 | Ga0530510_0008485 | 3300061734 | Bacteria | 7163 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_10120594 | Ga0157380_101205941 | 257 |
| 2 | 3300014325 | Ga0163163_10329715 | Ga0163163_103297151 | 268 |
| 3 | 3300035695 | Ga0373927_0217532 | Ga0373927_0217532_154_975 | 268 |
| 4 | 3300047321 | Ga0495676_0188924 | Ga0495676_0188924_521_1342 | 268 |
| 5 | 3300026023 | Ga0207677_10052394 | Ga0207677_100523944 | 276 |
| 6 | 3300025906 | Ga0207699_10025698 | Ga0207699_100256983 | 284 |
| 7 | 3300025929 | Ga0207664_10155563 | Ga0207664_101555632 | 284 |
| 8 | 3300009148 | Ga0105243_10002091 | Ga0105243_1000209119 | 285 |
| 9 | 3300005334 | Ga0068869_100171182 | Ga0068869_1001711822 | 286 |
| 10 | 3300005341 | Ga0070691_10013368 | Ga0070691_100133682 | 286 |
| 11 | 3300005345 | Ga0070692_10076185 | Ga0070692_100761852 | 286 |
| 12 | 3300005438 | Ga0070701_10091121 | Ga0070701_100911212 | 286 |
| 13 | 3300005440 | Ga0070705_100081312 | Ga0070705_1000813122 | 286 |
| 14 | 3300005441 | Ga0070700_100228287 | Ga0070700_1002282872 | 286 |
| 15 | 3300005444 | Ga0070694_100055482 | Ga0070694_1000554823 | 286 |
| 16 | 3300005459 | Ga0068867_100019732 | Ga0068867_1000197323 | 286 |
| 17 | 3300005545 | Ga0070695_100068494 | Ga0070695_1000684942 | 286 |
| 18 | 3300005546 | Ga0070696_100109237 | Ga0070696_1001092372 | 286 |
| 19 | 3300005549 | Ga0070704_100205824 | Ga0070704_1002058242 | 286 |
| 20 | 3300005843 | Ga0068860_100128312 | Ga0068860_1001283123 | 286 |
| 21 | 3300009094 | Ga0111539_10016150 | Ga0111539_1001615012 | 286 |
| 22 | 3300025935 | Ga0207709_10001690 | Ga0207709_1000169016 | 286 |
| 23 | 3300027907 | Ga0207428_10014965 | Ga0207428_100149651 | 286 |
| 24 | 3300034817 | Ga0373948_0009240 | Ga0373948_0009240_650_1555 | 286 |
| 25 | 3300035121 | Ga0373960_0023746 | Ga0373960_0023746_192_1097 | 286 |
| 26 | 3300035691 | Ga0373931_0008848 | Ga0373931_0008848_2429_3334 | 286 |
| 27 | 3300049742 | Ga0501080_0008256 | Ga0501080_0008256_8516_9376 | 286 |
| 28 | 3300049743 | Ga0501081_0000018 | Ga0501081_0000018_39928_40788 | 286 |
| 29 | 3300050511 | nmdc:mga08y16_152866_c1 | nmdc:mga08y16_152866_c1_523_1428 | 286 |
| 30 | 3300006844 | Ga0075428_100046328 | Ga0075428_1000463281 | 290 |
| 31 | 3300006880 | Ga0075429_100003840 | Ga0075429_10000384013 | 290 |
| 32 | 3300009094 | Ga0111539_10015907 | Ga0111539_100159072 | 290 |
| 33 | 3300027907 | Ga0207428_10073555 | Ga0207428_100735552 | 290 |
| 34 | 3300050511 | nmdc:mga08y16_8288_c1 | nmdc:mga08y16_8288_c1_3607_4578 | 290 |
| 35 | 3300048911 | Ga0496108_0232738 | Ga0496108_0232738_219_1202 | 291 |
| 36 | 3300005338 | Ga0068868_100194829 | Ga0068868_1001948291 | 294 |
| 37 | 3300005455 | Ga0070663_100034499 | Ga0070663_1000344993 | 294 |
| 38 | 3300006237 | Ga0097621_100079195 | Ga0097621_1000791952 | 294 |
| 39 | 3300035692 | Ga0373935_0099411 | Ga0373935_0099411_1010_1894 | 294 |
| 40 | 3300046476 | Ga0495662_0039630 | Ga0495662_0039630_320_1282 | 294 |
| 41 | 3300050507 | nmdc:mga05p37_324014_c1 | nmdc:mga05p37_324014_c1_369_1253 | 294 |
| 42 | 3300050508 | nmdc:mga09592_574999_c1 | nmdc:mga09592_574999_c1_59_943 | 294 |
| 43 | 3300005434 | Ga0070709_10247378 | Ga0070709_102473781 | 295 |
| 44 | 3300025906 | Ga0207699_10179005 | Ga0207699_101790051 | 295 |
| 45 | 3300005327 | Ga0070658_10013344 | Ga0070658_100133448 | 296 |
| 46 | 3300005336 | Ga0070680_100012153 | Ga0070680_1000121534 | 296 |
| 47 | 3300005339 | Ga0070660_100194610 | Ga0070660_1001946102 | 296 |
| 48 | 3300005458 | Ga0070681_10004462 | Ga0070681_100044624 | 296 |
| 49 | 3300005530 | Ga0070679_100021543 | Ga0070679_1000215432 | 296 |
| 50 | 3300005563 | Ga0068855_100017760 | Ga0068855_1000177605 | 296 |
| 51 | 3300006844 | Ga0075428_100246885 | Ga0075428_1002468852 | 296 |
| 52 | 3300006846 | Ga0075430_100239586 | Ga0075430_1002395862 | 296 |
| 53 | 3300006847 | Ga0075431_100342876 | Ga0075431_1003428761 | 296 |
| 54 | 3300006852 | Ga0075433_10035167 | Ga0075433_100351674 | 296 |
| 55 | 3300006871 | Ga0075434_100292979 | Ga0075434_1002929792 | 296 |
| 56 | 3300006880 | Ga0075429_100142591 | Ga0075429_1001425912 | 296 |
| 57 | 3300009093 | Ga0105240_10061524 | Ga0105240_100615243 | 296 |
| 58 | 3300009094 | Ga0111539_10333719 | Ga0111539_103337191 | 296 |
| 59 | 3300009147 | Ga0114129_10547328 | Ga0114129_105473282 | 296 |
| 60 | 3300021388 | Ga0213875_10001694 | Ga0213875_1000169413 | 296 |
| 61 | 3300025917 | Ga0207660_10008319 | Ga0207660_100083192 | 296 |
| 62 | 3300025919 | Ga0207657_10190157 | Ga0207657_101901571 | 296 |
| 63 | 3300025949 | Ga0207667_10018882 | Ga0207667_100188824 | 296 |
| 64 | 3300027907 | Ga0207428_10043497 | Ga0207428_100434972 | 296 |
| 65 | 3300037853 | Ga0436364_1030895 | Ga0436364_1030895_38384_39328 | 296 |
| 66 | 3300050507 | nmdc:mga05p37_441213_c1 | nmdc:mga05p37_441213_c1_84_1070 | 296 |
| 67 | 3300050508 | nmdc:mga09592_60476_c1 | nmdc:mga09592_60476_c1_1488_2474 | 296 |
| 68 | 3300050509 | nmdc:mga0qj67_175563_c1 | nmdc:mga0qj67_175563_c1_84_1070 | 296 |
| 69 | 3300050510 | nmdc:mga06r32_106000_c1 | nmdc:mga06r32_106000_c1_1693_2679 | 296 |
| 70 | 3300050511 | nmdc:mga08y16_168471_c1 | nmdc:mga08y16_168471_c1_332_1318 | 296 |
| 71 | 3300050512 | nmdc:mga0n895_71398_c1 | nmdc:mga0n895_71398_c1_397_1383 | 296 |
| 72 | 3300050515 | nmdc:mga0a205_221424_c1 | nmdc:mga0a205_221424_c1_264_1250 | 296 |
| 73 | 3300005435 | Ga0070714_100055028 | Ga0070714_1000550281 | 297 |
| 74 | 3300048907 | Ga0496104_0001724 | Ga0496104_0001724_1302_2318 | 297 |
| 75 | 3300048908 | Ga0496105_0039513 | Ga0496105_0039513_2427_3443 | 297 |
| 76 | 3300048909 | Ga0496106_0086904 | Ga0496106_0086904_1042_2058 | 297 |
| 77 | 3300048911 | Ga0496108_0287654 | Ga0496108_0287654_434_1414 | 297 |
| 78 | 3300049570 | Ga0501033_0029098 | Ga0501033_0029098_102_1076 | 297 |
| 79 | 3300049572 | Ga0501036_0001307 | Ga0501036_0001307_4522_5496 | 297 |
| 80 | 3300049574 | Ga0501038_0017354 | Ga0501038_0017354_1319_2293 | 297 |
| 81 | 3300049576 | Ga0501040_0000025 | Ga0501040_0000025_49141_50115 | 297 |
| 82 | 3300049577 | Ga0501041_0000622 | Ga0501041_0000622_3621_4595 | 297 |
| 83 | 3300049578 | Ga0501042_0000557 | Ga0501042_0000557_13474_14448 | 297 |
| 84 | 3300049579 | Ga0501043_0069071 | Ga0501043_0069071_1251_2225 | 297 |
| 85 | 3300049580 | Ga0501046_0002146 | Ga0501046_0002146_3748_4722 | 297 |
| 86 | 3300049582 | Ga0501048_0001229 | Ga0501048_0001229_2388_3362 | 297 |
| 87 | 3300049584 | Ga0501068_0000699 | Ga0501068_0000699_13506_14480 | 297 |
| 88 | 3300049586 | Ga0501070_0011156 | Ga0501070_0011156_672_1646 | 297 |
| 89 | 3300049587 | Ga0501071_0000002 | Ga0501071_0000002_19785_20759 | 297 |
| 90 | 3300049588 | Ga0501072_0000096 | Ga0501072_0000096_54356_55330 | 297 |
| 91 | 3300049590 | Ga0501074_0008514 | Ga0501074_0008514_1050_2024 | 297 |
| 92 | 3300049591 | Ga0501075_0000013 | Ga0501075_0000013_4342_5316 | 297 |
| 93 | 3300049592 | Ga0501076_0000026 | Ga0501076_0000026_3243_4217 | 297 |
| 94 | 3300049593 | Ga0501077_0000057 | Ga0501077_0000057_39800_40774 | 297 |
| 95 | 3300049741 | Ga0501079_0000049 | Ga0501079_0000049_37137_38111 | 297 |
| 96 | 3300049822 | Ga0501035_0046236 | Ga0501035_0046236_117_1091 | 297 |
| 97 | 3300049824 | Ga0501045_0000108 | Ga0501045_0000108_27127_28101 | 297 |
| 98 | 3300054114 | Ga0501084_0000191 | Ga0501084_0000191_33332_34306 | 297 |
| 99 | 3300060353 | Ga0501082_0000683 | Ga0501082_0000683_14903_15877 | 297 |
| 100 | 3300061734 | Ga0530510_0008485 | Ga0530510_0008485_4342_5316 | 297 |
| 101 | 3300005467 | Ga0070706_100055278 | Ga0070706_1000552783 | 298 |
| 102 | 3300025910 | Ga0207684_10084803 | Ga0207684_100848033 | 298 |
| 103 | 3300048907 | Ga0496104_0298133 | Ga0496104_0298133_163_1143 | 298 |
| 104 | 3300048918 | Ga0496115_0055996 | Ga0496115_0055996_1116_2096 | 298 |
| 105 | 3300005336 | Ga0070680_100406427 | Ga0070680_1004064271 | 299 |
| 106 | 3300005341 | Ga0070691_10061188 | Ga0070691_100611881 | 299 |
| 107 | 3300005457 | Ga0070662_100043615 | Ga0070662_1000436154 | 299 |
| 108 | 3300005458 | Ga0070681_10032029 | Ga0070681_100320294 | 299 |
| 109 | 3300005530 | Ga0070679_100152190 | Ga0070679_1001521902 | 299 |
| 110 | 3300005539 | Ga0068853_100461751 | Ga0068853_1004617511 | 299 |
| 111 | 3300005547 | Ga0070693_100044105 | Ga0070693_1000441053 | 299 |
| 112 | 3300005937 | Ga0081455_10005468 | Ga0081455_1000546811 | 299 |
| 113 | 3300006846 | Ga0075430_100238655 | Ga0075430_1002386551 | 299 |
| 114 | 3300006847 | Ga0075431_100078296 | Ga0075431_1000782963 | 299 |
| 115 | 3300006852 | Ga0075433_10025033 | Ga0075433_100250333 | 299 |
| 116 | 3300006871 | Ga0075434_100048599 | Ga0075434_1000485992 | 299 |
| 117 | 3300006880 | Ga0075429_100056429 | Ga0075429_1000564292 | 299 |
| 118 | 3300007788 | Ga0099795_10056721 | Ga0099795_100567211 | 299 |
| 119 | 3300013297 | Ga0157378_10011633 | Ga0157378_100116336 | 299 |
| 120 | 3300014969 | Ga0157376_10172255 | Ga0157376_101722551 | 299 |
| 121 | 3300025912 | Ga0207707_10012634 | Ga0207707_100126347 | 299 |
| 122 | 3300025917 | Ga0207660_10220294 | Ga0207660_102202942 | 299 |
| 123 | 3300025921 | Ga0207652_10322077 | Ga0207652_103220771 | 299 |
| 124 | 3300025938 | Ga0207704_10325416 | Ga0207704_103254161 | 299 |
| 125 | 3300025941 | Ga0207711_10408534 | Ga0207711_104085341 | 299 |
| 126 | 3300026121 | Ga0207683_10050910 | Ga0207683_100509102 | 299 |
| 127 | 3300027907 | Ga0207428_10015195 | Ga0207428_100151955 | 299 |
| 128 | 3300028381 | Ga0268264_10124825 | Ga0268264_101248251 | 299 |
| 129 | 3300035116 | Ga0373945_0005488 | Ga0373945_0005488_2820_3797 | 299 |
| 130 | 3300035695 | Ga0373927_0118623 | Ga0373927_0118623_411_1388 | 299 |
| 131 | 3300035725 | Ga0373947_0055031 | Ga0373947_0055031_203_1180 | 299 |
| 132 | 3300046455 | Ga0495603_0018645 | Ga0495603_0018645_915_1895 | 299 |
| 133 | 3300046462 | Ga0495651_0102235 | Ga0495651_0102235_579_1556 | 299 |
| 134 | 3300046472 | Ga0495580_0055689 | Ga0495580_0055689_1293_2273 | 299 |
| 135 | 3300046473 | Ga0495582_0145381 | Ga0495582_0145381_311_1288 | 299 |
| 136 | 3300046476 | Ga0495662_0067112 | Ga0495662_0067112_481_1458 | 299 |
| 137 | 3300046477 | Ga0495664_0003466 | Ga0495664_0003466_5967_6944 | 299 |
| 138 | 3300046499 | Ga0495594_0051048 | Ga0495594_0051048_1031_2008 | 299 |
| 139 | 3300046514 | Ga0495618_0152772 | Ga0495618_0152772_194_1177 | 299 |
| 140 | 3300046523 | Ga0495644_0010409 | Ga0495644_0010409_371_1351 | 299 |
| 141 | 3300046529 | Ga0495652_0031632 | Ga0495652_0031632_3116_4093 | 299 |
| 142 | 3300046531 | Ga0495665_0093448 | Ga0495665_0093448_432_1415 | 299 |
| 143 | 3300046543 | Ga0495645_0111108 | Ga0495645_0111108_864_1841 | 299 |
| 144 | 3300046642 | Ga0495634_0050879 | Ga0495634_0050879_1204_2187 | 299 |
| 145 | 3300046689 | Ga0495613_0248516 | Ga0495613_0248516_93_1070 | 299 |
| 146 | 3300047315 | Ga0495581_0058903 | Ga0495581_0058903_437_1420 | 299 |
| 147 | 3300047321 | Ga0495676_0100272 | Ga0495676_0100272_281_1258 | 299 |
| 148 | 3300047471 | Ga0495684_0131754 | Ga0495684_0131754_676_1659 | 299 |
| 149 | 3300048907 | Ga0496104_0395429 | Ga0496104_0395429_315_1283 | 299 |
| 150 | 3300048909 | Ga0496106_0062967 | Ga0496106_0062967_1546_2523 | 299 |
| 151 | 3300048911 | Ga0496108_0334455 | Ga0496108_0334455_115_1098 | 299 |
| 152 | 3300048918 | Ga0496115_0041379 | Ga0496115_0041379_686_1663 | 299 |
| 153 | 3300050507 | nmdc:mga05p37_496712_c1 | nmdc:mga05p37_496712_c1_113_1093 | 299 |
| 154 | 3300050508 | nmdc:mga09592_38643_c1 | nmdc:mga09592_38643_c1_2772_3752 | 299 |
| 155 | 3300050509 | nmdc:mga0qj67_60060_c1 | nmdc:mga0qj67_60060_c1_344_1324 | 299 |
| 156 | 3300050510 | nmdc:mga06r32_59289_c1 | nmdc:mga06r32_59289_c1_616_1596 | 299 |
| 157 | 3300050511 | nmdc:mga08y16_30043_c1 | nmdc:mga08y16_30043_c1_113_1093 | 299 |
| 158 | 3300050512 | nmdc:mga0n895_43228_c1 | nmdc:mga0n895_43228_c1_310_1290 | 299 |
| 159 | 3300050513 | nmdc:mga0rr50_196703_c1 | nmdc:mga0rr50_196703_c1_431_1408 | 299 |
| 160 | 3300050515 | nmdc:mga0a205_24136_c1 | nmdc:mga0a205_24136_c1_2711_3691 | 299 |
| 161 | 3300053077 | Ga0495601_0001607 | Ga0495601_0001607_703_1680 | 299 |
| 162 | 3300053085 | Ga0495619_0167390 | Ga0495619_0167390_424_1407 | 299 |
| 163 | 3300005329 | Ga0070683_100215701 | Ga0070683_1002157012 | 300 |
| 164 | 3300005338 | Ga0068868_100071224 | Ga0068868_1000712242 | 300 |
| 165 | 3300005347 | Ga0070668_100041834 | Ga0070668_1000418343 | 300 |
| 166 | 3300005354 | Ga0070675_100029877 | Ga0070675_1000298772 | 300 |
| 167 | 3300005355 | Ga0070671_100107551 | Ga0070671_1001075512 | 300 |
| 168 | 3300005364 | Ga0070673_100313614 | Ga0070673_1003136141 | 300 |
| 169 | 3300005367 | Ga0070667_100355732 | Ga0070667_1003557321 | 300 |
| 170 | 3300005437 | Ga0070710_10043525 | Ga0070710_100435251 | 300 |
| 171 | 3300005437 | Ga0070710_10223251 | Ga0070710_102232511 | 300 |
| 172 | 3300005438 | Ga0070701_10185759 | Ga0070701_101857592 | 300 |
| 173 | 3300005455 | Ga0070663_100012044 | Ga0070663_1000120444 | 300 |
| 174 | 3300005564 | Ga0070664_100103957 | Ga0070664_1001039572 | 300 |
| 175 | 3300005615 | Ga0070702_100005470 | Ga0070702_1000054704 | 300 |
| 176 | 3300005718 | Ga0068866_10061197 | Ga0068866_100611972 | 300 |
| 177 | 3300005719 | Ga0068861_100066615 | Ga0068861_1000666152 | 300 |
| 178 | 3300005841 | Ga0068863_100062596 | Ga0068863_1000625962 | 300 |
| 179 | 3300005842 | Ga0068858_100066971 | Ga0068858_1000669715 | 300 |
| 180 | 3300005843 | Ga0068860_100042471 | Ga0068860_1000424713 | 300 |
| 181 | 3300005937 | Ga0081455_10100522 | Ga0081455_101005222 | 300 |
| 182 | 3300006038 | Ga0075365_10034651 | Ga0075365_100346512 | 300 |
| 183 | 3300006051 | Ga0075364_10029649 | Ga0075364_100296492 | 300 |
| 184 | 3300006175 | Ga0070712_100000152 | Ga0070712_10000015230 | 300 |
| 185 | 3300006175 | Ga0070712_100005090 | Ga0070712_1000050904 | 300 |
| 186 | 3300006175 | Ga0070712_100085934 | Ga0070712_1000859342 | 300 |
| 187 | 3300006844 | Ga0075428_100067941 | Ga0075428_1000679414 | 300 |
| 188 | 3300006844 | Ga0075428_100207343 | Ga0075428_1002073433 | 300 |
| 189 | 3300006881 | Ga0068865_100010590 | Ga0068865_1000105903 | 300 |
| 190 | 3300009098 | Ga0105245_10055899 | Ga0105245_100558992 | 300 |
| 191 | 3300009147 | Ga0114129_10388360 | Ga0114129_103883602 | 300 |
| 192 | 3300009148 | Ga0105243_10041858 | Ga0105243_100418583 | 300 |
| 193 | 3300009174 | Ga0105241_10205606 | Ga0105241_102056061 | 300 |
| 194 | 3300009177 | Ga0105248_10766371 | Ga0105248_107663712 | 300 |
| 195 | 3300009553 | Ga0105249_10023992 | Ga0105249_100239923 | 300 |
| 196 | 3300010375 | Ga0105239_10195787 | Ga0105239_101957872 | 300 |
| 197 | 3300013296 | Ga0157374_10036731 | Ga0157374_100367315 | 300 |
| 198 | 3300013297 | Ga0157378_10125604 | Ga0157378_101256043 | 300 |
| 199 | 3300013306 | Ga0163162_10021332 | Ga0163162_100213324 | 300 |
| 200 | 3300013308 | Ga0157375_10009637 | Ga0157375_100096378 | 300 |
| 201 | 3300014968 | Ga0157379_10044185 | Ga0157379_100441852 | 300 |
| 202 | 3300025901 | Ga0207688_10015657 | Ga0207688_100156574 | 300 |
| 203 | 3300025908 | Ga0207643_10016238 | Ga0207643_100162384 | 300 |
| 204 | 3300025915 | Ga0207693_10002719 | Ga0207693_1000271912 | 300 |
| 205 | 3300025915 | Ga0207693_10007070 | Ga0207693_100070705 | 300 |
| 206 | 3300025915 | Ga0207693_10097444 | Ga0207693_100974442 | 300 |
| 207 | 3300025916 | Ga0207663_10123698 | Ga0207663_101236982 | 300 |
| 208 | 3300025918 | Ga0207662_10075312 | Ga0207662_100753122 | 300 |
| 209 | 3300025920 | Ga0207649_10257503 | Ga0207649_102575032 | 300 |
| 210 | 3300025928 | Ga0207700_10262399 | Ga0207700_102623992 | 300 |
| 211 | 3300025938 | Ga0207704_10014448 | Ga0207704_100144482 | 300 |
| 212 | 3300025945 | Ga0207679_10081531 | Ga0207679_100815312 | 300 |
| 213 | 3300025949 | Ga0207667_10629318 | Ga0207667_106293181 | 300 |
| 214 | 3300026067 | Ga0207678_10022573 | Ga0207678_100225733 | 300 |
| 215 | 3300026075 | Ga0207708_10059417 | Ga0207708_100594171 | 300 |
| 216 | 3300026095 | Ga0207676_10343301 | Ga0207676_103433012 | 300 |
| 217 | 3300026118 | Ga0207675_100068390 | Ga0207675_1000683902 | 300 |
| 218 | 3300028379 | Ga0268266_10463885 | Ga0268266_104638852 | 300 |
| 219 | 3300035118 | Ga0373954_0013602 | Ga0373954_0013602_458_1360 | 300 |
| 220 | 3300035410 | Ga0373924_0016909 | Ga0373924_0016909_379_1281 | 300 |
| 221 | 3300035724 | Ga0373933_0203455 | Ga0373933_0203455_323_1225 | 300 |
| 222 | 3300036401 | Ga0373937_0233087 | Ga0373937_0233087_547_1560 | 300 |
| 223 | 3300046454 | Ga0495592_0066060 | Ga0495592_0066060_789_1691 | 300 |
| 224 | 3300046462 | Ga0495651_0218602 | Ga0495651_0218602_64_966 | 300 |
| 225 | 3300046476 | Ga0495662_0035433 | Ga0495662_0035433_150_1133 | 300 |
| 226 | 3300046511 | Ga0495608_0072335 | Ga0495608_0072335_519_1421 | 300 |
| 227 | 3300046514 | Ga0495618_0022171 | Ga0495618_0022171_1474_2376 | 300 |
| 228 | 3300046516 | Ga0495628_0077369 | Ga0495628_0077369_1319_2302 | 300 |
| 229 | 3300046533 | Ga0495640_0041097 | Ga0495640_0041097_2155_3057 | 300 |
| 230 | 3300046536 | Ga0495587_0026520 | Ga0495587_0026520_1525_2427 | 300 |
| 231 | 3300046559 | Ga0495667_0052295 | Ga0495667_0052295_471_1373 | 300 |
| 232 | 3300046615 | Ga0495656_0030836 | Ga0495656_0030836_218_1207 | 300 |
| 233 | 3300046642 | Ga0495634_0032131 | Ga0495634_0032131_1151_2053 | 300 |
| 234 | 3300046663 | Ga0495635_0009786 | Ga0495635_0009786_4536_5438 | 300 |
| 235 | 3300046675 | Ga0495657_0017257 | Ga0495657_0017257_571_1473 | 300 |
| 236 | 3300046680 | Ga0495646_0069519 | Ga0495646_0069519_513_1415 | 300 |
| 237 | 3300046690 | Ga0495624_0076173 | Ga0495624_0076173_101_1117 | 300 |
| 238 | 3300046809 | Ga0495600_0087424 | Ga0495600_0087424_32_934 | 300 |
| 239 | 3300047317 | Ga0495604_0104267 | Ga0495604_0104267_961_1944 | 300 |
| 240 | 3300047319 | Ga0495674_0031831 | Ga0495674_0031831_1521_2423 | 300 |
| 241 | 3300047322 | Ga0495680_0134535 | Ga0495680_0134535_859_1761 | 300 |
| 242 | 3300047444 | Ga0495675_0025056 | Ga0495675_0025056_1818_2720 | 300 |
| 243 | 3300047471 | Ga0495684_0042879 | Ga0495684_0042879_1774_2790 | 300 |
| 244 | 3300047471 | Ga0495684_0093406 | Ga0495684_0093406_1143_2045 | 300 |
| 245 | 3300048088 | Ga0495602_0048245 | Ga0495602_0048245_870_1772 | 300 |
| 246 | 3300048904 | Ga0496101_0049766 | Ga0496101_0049766_1139_2122 | 300 |
| 247 | 3300048905 | Ga0496102_0019575 | Ga0496102_0019575_3122_4105 | 300 |
| 248 | 3300048907 | Ga0496104_0009159 | Ga0496104_0009159_5990_6973 | 300 |
| 249 | 3300048907 | Ga0496104_0036875 | Ga0496104_0036875_812_1804 | 300 |
| 250 | 3300048908 | Ga0496105_0015982 | Ga0496105_0015982_1859_2842 | 300 |
| 251 | 3300048908 | Ga0496105_0030253 | Ga0496105_0030253_2020_3012 | 300 |
| 252 | 3300048909 | Ga0496106_0004487 | Ga0496106_0004487_1925_2908 | 300 |
| 253 | 3300048910 | Ga0496107_0010967 | Ga0496107_0010967_1887_2870 | 300 |
| 254 | 3300048911 | Ga0496108_0005575 | Ga0496108_0005575_7341_8324 | 300 |
| 255 | 3300048911 | Ga0496108_0572872 | Ga0496108_0572872_27_929 | 300 |
| 256 | 3300048912 | Ga0496109_0007668 | Ga0496109_0007668_1831_2814 | 300 |
| 257 | 3300048913 | Ga0496110_0006575 | Ga0496110_0006575_6340_7323 | 300 |
| 258 | 3300048913 | Ga0496110_0400401 | Ga0496110_0400401_183_1175 | 300 |
| 259 | 3300048916 | Ga0496113_0145229 | Ga0496113_0145229_676_1668 | 300 |
| 260 | 3300048917 | Ga0496114_0194213 | Ga0496114_0194213_52_1035 | 300 |
| 261 | 3300048918 | Ga0496115_0001125 | Ga0496115_0001125_1925_2908 | 300 |
| 262 | 3300050491 | nmdc:mga00v17_65664_c1 | nmdc:mga00v17_65664_c1_1064_2053 | 300 |
| 263 | 3300050509 | nmdc:mga0qj67_41289_c1 | nmdc:mga0qj67_41289_c1_2114_3097 | 300 |
| 264 | 3300050510 | nmdc:mga06r32_103597_c1 | nmdc:mga06r32_103597_c1_183_1172 | 300 |
| 265 | 3300050510 | nmdc:mga06r32_103963_c1 | nmdc:mga06r32_103963_c1_620_1603 | 300 |
| 266 | 3300053077 | Ga0495601_0022880 | Ga0495601_0022880_1013_1996 | 300 |
| 267 | 3300053077 | Ga0495601_0092344 | Ga0495601_0092344_801_1814 | 300 |
| 268 | 3300053084 | Ga0495595_0037282 | Ga0495595_0037282_1097_1999 | 300 |
| 269 | 3300000043 | ARcpr5yngRDRAFT_c000794 | ARcpr5yngRDRAFT_0007941 | 301 |
| 270 | 3300000044 | ARSoilOldRDRAFT_c000065 | ARSoilOldRDRAFT_00006527 | 301 |
| 271 | 3300005329 | Ga0070683_100032525 | Ga0070683_1000325254 | 301 |
| 272 | 3300005330 | Ga0070690_100031526 | Ga0070690_1000315261 | 301 |
| 273 | 3300005331 | Ga0070670_100073248 | Ga0070670_1000732481 | 301 |
| 274 | 3300005331 | Ga0070670_100174214 | Ga0070670_1001742142 | 301 |
| 275 | 3300005335 | Ga0070666_10008838 | Ga0070666_100088384 | 301 |
| 276 | 3300005337 | Ga0070682_100029483 | Ga0070682_1000294833 | 301 |
| 277 | 3300005338 | Ga0068868_100035011 | Ga0068868_1000350114 | 301 |
| 278 | 3300005339 | Ga0070660_100067773 | Ga0070660_1000677733 | 301 |
| 279 | 3300005343 | Ga0070687_100014213 | Ga0070687_1000142133 | 301 |
| 280 | 3300005344 | Ga0070661_100026196 | Ga0070661_1000261963 | 301 |
| 281 | 3300005353 | Ga0070669_100317490 | Ga0070669_1003174901 | 301 |
| 282 | 3300005355 | Ga0070671_100017927 | Ga0070671_1000179274 | 301 |
| 283 | 3300005356 | Ga0070674_100223071 | Ga0070674_1002230712 | 301 |
| 284 | 3300005365 | Ga0070688_100013038 | Ga0070688_1000130383 | 301 |
| 285 | 3300005366 | Ga0070659_100247923 | Ga0070659_1002479232 | 301 |
| 286 | 3300005367 | Ga0070667_100027719 | Ga0070667_1000277193 | 301 |
| 287 | 3300005434 | Ga0070709_10003774 | Ga0070709_100037745 | 301 |
| 288 | 3300005435 | Ga0070714_100075294 | Ga0070714_1000752942 | 301 |
| 289 | 3300005435 | Ga0070714_100139858 | Ga0070714_1001398582 | 301 |
| 290 | 3300005436 | Ga0070713_100000923 | Ga0070713_1000009235 | 301 |
| 291 | 3300005436 | Ga0070713_100034040 | Ga0070713_1000340403 | 301 |
| 292 | 3300005436 | Ga0070713_100114274 | Ga0070713_1001142743 | 301 |
| 293 | 3300005437 | Ga0070710_10001800 | Ga0070710_1000180010 | 301 |
| 294 | 3300005437 | Ga0070710_10136407 | Ga0070710_101364072 | 301 |
| 295 | 3300005437 | Ga0070710_10190217 | Ga0070710_101902171 | 301 |
| 296 | 3300005439 | Ga0070711_100020052 | Ga0070711_1000200525 | 301 |
| 297 | 3300005439 | Ga0070711_100089950 | Ga0070711_1000899501 | 301 |
| 298 | 3300005439 | Ga0070711_100447851 | Ga0070711_1004478511 | 301 |
| 299 | 3300005455 | Ga0070663_100094641 | Ga0070663_1000946413 | 301 |
| 300 | 3300005466 | Ga0070685_10019636 | Ga0070685_100196365 | 301 |
| 301 | 3300005467 | Ga0070706_100120354 | Ga0070706_1001203545 | 301 |
| 302 | 3300005530 | Ga0070679_100107410 | Ga0070679_1001074102 | 301 |
| 303 | 3300005535 | Ga0070684_100137545 | Ga0070684_1001375452 | 301 |
| 304 | 3300005535 | Ga0070684_100243053 | Ga0070684_1002430531 | 301 |
| 305 | 3300005544 | Ga0070686_100013188 | Ga0070686_1000131884 | 301 |
| 306 | 3300005548 | Ga0070665_100385802 | Ga0070665_1003858022 | 301 |
| 307 | 3300005564 | Ga0070664_100089868 | Ga0070664_1000898681 | 301 |
| 308 | 3300005614 | Ga0068856_100310923 | Ga0068856_1003109231 | 301 |
| 309 | 3300005615 | Ga0070702_100024201 | Ga0070702_1000242014 | 301 |
| 310 | 3300005617 | Ga0068859_100032057 | Ga0068859_1000320575 | 301 |
| 311 | 3300005841 | Ga0068863_100015305 | Ga0068863_1000153058 | 301 |
| 312 | 3300005842 | Ga0068858_100352348 | Ga0068858_1003523482 | 301 |
| 313 | 3300005843 | Ga0068860_100032446 | Ga0068860_1000324464 | 301 |
| 314 | 3300005937 | Ga0081455_10001955 | Ga0081455_1000195530 | 301 |
| 315 | 3300005937 | Ga0081455_10024203 | Ga0081455_100242033 | 301 |
| 316 | 3300005937 | Ga0081455_10156660 | Ga0081455_101566602 | 301 |
| 317 | 3300006028 | Ga0070717_10004425 | Ga0070717_1000442510 | 301 |
| 318 | 3300006028 | Ga0070717_10007219 | Ga0070717_100072199 | 301 |
| 319 | 3300006058 | Ga0075432_10031978 | Ga0075432_100319783 | 301 |
| 320 | 3300006163 | Ga0070715_10015983 | Ga0070715_100159833 | 301 |
| 321 | 3300006163 | Ga0070715_10045606 | Ga0070715_100456061 | 301 |
| 322 | 3300006173 | Ga0070716_100004152 | Ga0070716_1000041529 | 301 |
| 323 | 3300006173 | Ga0070716_100097712 | Ga0070716_1000977123 | 301 |
| 324 | 3300006175 | Ga0070712_100001612 | Ga0070712_1000016122 | 301 |
| 325 | 3300006175 | Ga0070712_100006051 | Ga0070712_1000060514 | 301 |
| 326 | 3300006175 | Ga0070712_100007463 | Ga0070712_10000746310 | 301 |
| 327 | 3300006175 | Ga0070712_100017046 | Ga0070712_1000170463 | 301 |
| 328 | 3300006175 | Ga0070712_100048364 | Ga0070712_1000483642 | 301 |
| 329 | 3300006175 | Ga0070712_100107234 | Ga0070712_1001072342 | 301 |
| 330 | 3300006175 | Ga0070712_100311454 | Ga0070712_1003114541 | 301 |
| 331 | 3300006194 | Ga0075427_10008290 | Ga0075427_100082902 | 301 |
| 332 | 3300006237 | Ga0097621_100044921 | Ga0097621_1000449212 | 301 |
| 333 | 3300006237 | Ga0097621_100049306 | Ga0097621_1000493063 | 301 |
| 334 | 3300006358 | Ga0068871_100006454 | Ga0068871_1000064548 | 301 |
| 335 | 3300006844 | Ga0075428_100075063 | Ga0075428_1000750632 | 301 |
| 336 | 3300006844 | Ga0075428_100458872 | Ga0075428_1004588721 | 301 |
| 337 | 3300006846 | Ga0075430_100103543 | Ga0075430_1001035431 | 301 |
| 338 | 3300006847 | Ga0075431_100194443 | Ga0075431_1001944431 | 301 |
| 339 | 3300006847 | Ga0075431_100237436 | Ga0075431_1002374362 | 301 |
| 340 | 3300006852 | Ga0075433_10157415 | Ga0075433_101574153 | 301 |
| 341 | 3300006871 | Ga0075434_100020106 | Ga0075434_1000201065 | 301 |
| 342 | 3300006871 | Ga0075434_100263797 | Ga0075434_1002637972 | 301 |
| 343 | 3300006871 | Ga0075434_100322650 | Ga0075434_1003226502 | 301 |
| 344 | 3300006871 | Ga0075434_100382915 | Ga0075434_1003829152 | 301 |
| 345 | 3300006880 | Ga0075429_100126461 | Ga0075429_1001264612 | 301 |
| 346 | 3300006880 | Ga0075429_100216177 | Ga0075429_1002161772 | 301 |
| 347 | 3300006880 | Ga0075429_100247926 | Ga0075429_1002479262 | 301 |
| 348 | 3300006880 | Ga0075429_100371792 | Ga0075429_1003717921 | 301 |
| 349 | 3300006931 | Ga0097620_100032057 | Ga0097620_1000320573 | 301 |
| 350 | 3300007076 | Ga0075435_100014492 | Ga0075435_1000144924 | 301 |
| 351 | 3300007265 | Ga0099794_10011522 | Ga0099794_100115222 | 301 |
| 352 | 3300007265 | Ga0099794_10068857 | Ga0099794_100688571 | 301 |
| 353 | 3300009094 | Ga0111539_10025469 | Ga0111539_1002546911 | 301 |
| 354 | 3300009094 | Ga0111539_10065075 | Ga0111539_100650752 | 301 |
| 355 | 3300009094 | Ga0111539_10480413 | Ga0111539_104804131 | 301 |
| 356 | 3300009098 | Ga0105245_10005433 | Ga0105245_100054332 | 301 |
| 357 | 3300009098 | Ga0105245_10402658 | Ga0105245_104026581 | 301 |
| 358 | 3300009101 | Ga0105247_10049357 | Ga0105247_100493573 | 301 |
| 359 | 3300009147 | Ga0114129_10068290 | Ga0114129_100682905 | 301 |
| 360 | 3300009147 | Ga0114129_10160321 | Ga0114129_101603211 | 301 |
| 361 | 3300009174 | Ga0105241_10051972 | Ga0105241_100519723 | 301 |
| 362 | 3300009176 | Ga0105242_10016785 | Ga0105242_100167855 | 301 |
| 363 | 3300009176 | Ga0105242_10020765 | Ga0105242_100207651 | 301 |
| 364 | 3300009177 | Ga0105248_10025971 | Ga0105248_100259714 | 301 |
| 365 | 3300009545 | Ga0105237_10054339 | Ga0105237_100543392 | 301 |
| 366 | 3300009551 | Ga0105238_10032771 | Ga0105238_100327713 | 301 |
| 367 | 3300009553 | Ga0105249_10046888 | Ga0105249_100468883 | 301 |
| 368 | 3300009553 | Ga0105249_10137536 | Ga0105249_101375361 | 301 |
| 369 | 3300010375 | Ga0105239_10095686 | Ga0105239_100956861 | 301 |
| 370 | 3300010375 | Ga0105239_10110462 | Ga0105239_101104623 | 301 |
| 371 | 3300011119 | Ga0105246_10027298 | Ga0105246_100272983 | 301 |
| 372 | 3300013104 | Ga0157370_10150244 | Ga0157370_101502442 | 301 |
| 373 | 3300013296 | Ga0157374_10092945 | Ga0157374_100929452 | 301 |
| 374 | 3300013297 | Ga0157378_10019818 | Ga0157378_100198182 | 301 |
| 375 | 3300013306 | Ga0163162_10111399 | Ga0163162_101113992 | 301 |
| 376 | 3300013308 | Ga0157375_10245606 | Ga0157375_102456061 | 301 |
| 377 | 3300013308 | Ga0157375_10688806 | Ga0157375_106888062 | 301 |
| 378 | 3300014325 | Ga0163163_10014823 | Ga0163163_100148238 | 301 |
| 379 | 3300014325 | Ga0163163_10050054 | Ga0163163_100500543 | 301 |
| 380 | 3300014968 | Ga0157379_10019495 | Ga0157379_100194954 | 301 |
| 381 | 3300014969 | Ga0157376_10015168 | Ga0157376_100151683 | 301 |
| 382 | 3300014969 | Ga0157376_10027383 | Ga0157376_100273837 | 301 |
| 383 | 3300014969 | Ga0157376_10072633 | Ga0157376_100726334 | 301 |
| 384 | 3300017792 | Ga0163161_10056567 | Ga0163161_100565673 | 301 |
| 385 | 3300017792 | Ga0163161_10386990 | Ga0163161_103869901 | 301 |
| 386 | 3300025898 | Ga0207692_10017964 | Ga0207692_100179643 | 301 |
| 387 | 3300025898 | Ga0207692_10029119 | Ga0207692_100291191 | 301 |
| 388 | 3300025898 | Ga0207692_10190285 | Ga0207692_101902851 | 301 |
| 389 | 3300025900 | Ga0207710_10016265 | Ga0207710_100162652 | 301 |
| 390 | 3300025903 | Ga0207680_10047161 | Ga0207680_100471613 | 301 |
| 391 | 3300025906 | Ga0207699_10006751 | Ga0207699_100067514 | 301 |
| 392 | 3300025907 | Ga0207645_10014673 | Ga0207645_100146733 | 301 |
| 393 | 3300025910 | Ga0207684_10210458 | Ga0207684_102104582 | 301 |
| 394 | 3300025915 | Ga0207693_10010191 | Ga0207693_100101912 | 301 |
| 395 | 3300025915 | Ga0207693_10010613 | Ga0207693_100106138 | 301 |
| 396 | 3300025915 | Ga0207693_10012093 | Ga0207693_100120938 | 301 |
| 397 | 3300025915 | Ga0207693_10061411 | Ga0207693_100614112 | 301 |
| 398 | 3300025915 | Ga0207693_10228538 | Ga0207693_102285382 | 301 |
| 399 | 3300025916 | Ga0207663_10029771 | Ga0207663_100297713 | 301 |
| 400 | 3300025916 | Ga0207663_10030742 | Ga0207663_100307423 | 301 |
| 401 | 3300025916 | Ga0207663_10262407 | Ga0207663_102624072 | 301 |
| 402 | 3300025924 | Ga0207694_10178942 | Ga0207694_101789421 | 301 |
| 403 | 3300025925 | Ga0207650_10027179 | Ga0207650_100271794 | 301 |
| 404 | 3300025925 | Ga0207650_10195809 | Ga0207650_101958093 | 301 |
| 405 | 3300025927 | Ga0207687_10031905 | Ga0207687_100319052 | 301 |
| 406 | 3300025928 | Ga0207700_10002289 | Ga0207700_100022895 | 301 |
| 407 | 3300025928 | Ga0207700_10124042 | Ga0207700_101240423 | 301 |
| 408 | 3300025928 | Ga0207700_10161769 | Ga0207700_101617692 | 301 |
| 409 | 3300025929 | Ga0207664_10075598 | Ga0207664_100755983 | 301 |
| 410 | 3300025929 | Ga0207664_10123800 | Ga0207664_101238002 | 301 |
| 411 | 3300025931 | Ga0207644_10025420 | Ga0207644_100254203 | 301 |
| 412 | 3300025931 | Ga0207644_10176433 | Ga0207644_101764331 | 301 |
| 413 | 3300025932 | Ga0207690_10188960 | Ga0207690_101889602 | 301 |
| 414 | 3300025933 | Ga0207706_10309080 | Ga0207706_103090801 | 301 |
| 415 | 3300025934 | Ga0207686_10023983 | Ga0207686_100239835 | 301 |
| 416 | 3300025937 | Ga0207669_10186711 | Ga0207669_101867112 | 301 |
| 417 | 3300025938 | Ga0207704_10064424 | Ga0207704_100644242 | 301 |
| 418 | 3300025939 | Ga0207665_10000223 | Ga0207665_1000022340 | 301 |
| 419 | 3300025939 | Ga0207665_10037889 | Ga0207665_100378892 | 301 |
| 420 | 3300025941 | Ga0207711_10036147 | Ga0207711_100361473 | 301 |
| 421 | 3300025944 | Ga0207661_10052476 | Ga0207661_100524763 | 301 |
| 422 | 3300025945 | Ga0207679_10034277 | Ga0207679_100342773 | 301 |
| 423 | 3300025961 | Ga0207712_10098067 | Ga0207712_100980671 | 301 |
| 424 | 3300025961 | Ga0207712_10155881 | Ga0207712_101558812 | 301 |
| 425 | 3300026023 | Ga0207677_10364164 | Ga0207677_103641641 | 301 |
| 426 | 3300026035 | Ga0207703_10104985 | Ga0207703_101049853 | 301 |
| 427 | 3300026035 | Ga0207703_10311976 | Ga0207703_103119761 | 301 |
| 428 | 3300026067 | Ga0207678_10046170 | Ga0207678_100461703 | 301 |
| 429 | 3300026067 | Ga0207678_10115428 | Ga0207678_101154283 | 301 |
| 430 | 3300026078 | Ga0207702_10107216 | Ga0207702_101072163 | 301 |
| 431 | 3300026088 | Ga0207641_10013191 | Ga0207641_100131916 | 301 |
| 432 | 3300026095 | Ga0207676_10106741 | Ga0207676_101067411 | 301 |
| 433 | 3300026095 | Ga0207676_10305287 | Ga0207676_103052871 | 301 |
| 434 | 3300026121 | Ga0207683_10015344 | Ga0207683_100153442 | 301 |
| 435 | 3300027907 | Ga0207428_10004670 | Ga0207428_1000467018 | 301 |
| 436 | 3300027907 | Ga0207428_10192556 | Ga0207428_101925561 | 301 |
| 437 | 3300028379 | Ga0268266_10008517 | Ga0268266_100085174 | 301 |
| 438 | 3300035084 | Ga0373928_0036346 | Ga0373928_0036346_100_1089 | 301 |
| 439 | 3300035085 | Ga0373929_0002042 | Ga0373929_0002042_2290_3195 | 301 |
| 440 | 3300035089 | Ga0373944_0007107 | Ga0373944_0007107_13_1002 | 301 |
| 441 | 3300035111 | Ga0373923_0017150 | Ga0373923_0017150_1259_2245 | 301 |
| 442 | 3300035112 | Ga0373932_0001123 | Ga0373932_0001123_4208_5113 | 301 |
| 443 | 3300035112 | Ga0373932_0020084 | Ga0373932_0020084_624_1613 | 301 |
| 444 | 3300035114 | Ga0373939_0001315 | Ga0373939_0001315_4107_5012 | 301 |
| 445 | 3300035115 | Ga0373941_0004546 | Ga0373941_0004546_358_1263 | 301 |
| 446 | 3300035116 | Ga0373945_0018869 | Ga0373945_0018869_588_1577 | 301 |
| 447 | 3300035116 | Ga0373945_0100846 | Ga0373945_0100846_87_1073 | 301 |
| 448 | 3300035121 | Ga0373960_0000064 | Ga0373960_0000064_13718_14623 | 301 |
| 449 | 3300035121 | Ga0373960_0070309 | Ga0373960_0070309_12_998 | 301 |
| 450 | 3300035170 | Ga0373943_0056454 | Ga0373943_0056454_183_1169 | 301 |
| 451 | 3300035171 | Ga0373946_0006191 | Ga0373946_0006191_1852_2841 | 301 |
| 452 | 3300035171 | Ga0373946_0031331 | Ga0373946_0031331_961_1947 | 301 |
| 453 | 3300035171 | Ga0373946_0126969 | Ga0373946_0126969_212_1117 | 301 |
| 454 | 3300035242 | Ga0373962_0001185 | Ga0373962_0001185_2246_3151 | 301 |
| 455 | 3300035242 | Ga0373962_0014611 | Ga0373962_0014611_486_1475 | 301 |
| 456 | 3300035410 | Ga0373924_0062118 | Ga0373924_0062118_105_1094 | 301 |
| 457 | 3300035691 | Ga0373931_0001721 | Ga0373931_0001721_5921_6826 | 301 |
| 458 | 3300035691 | Ga0373931_0004124 | Ga0373931_0004124_5488_6477 | 301 |
| 459 | 3300035692 | Ga0373935_0086318 | Ga0373935_0086318_292_1278 | 301 |
| 460 | 3300035692 | Ga0373935_0312671 | Ga0373935_0312671_91_1077 | 301 |
| 461 | 3300035695 | Ga0373927_0211941 | Ga0373927_0211941_238_1227 | 301 |
| 462 | 3300035695 | Ga0373927_0219795 | Ga0373927_0219795_306_1211 | 301 |
| 463 | 3300035725 | Ga0373947_0044438 | Ga0373947_0044438_1436_2422 | 301 |
| 464 | 3300035725 | Ga0373947_0123297 | Ga0373947_0123297_382_1371 | 301 |
| 465 | 3300035725 | Ga0373947_0253979 | Ga0373947_0253979_66_1052 | 301 |
| 466 | 3300046454 | Ga0495592_0020257 | Ga0495592_0020257_2853_3842 | 301 |
| 467 | 3300046459 | Ga0495629_0020608 | Ga0495629_0020608_2116_3102 | 301 |
| 468 | 3300046462 | Ga0495651_0009655 | Ga0495651_0009655_5169_6158 | 301 |
| 469 | 3300046463 | Ga0495653_0019340 | Ga0495653_0019340_4419_5405 | 301 |
| 470 | 3300046463 | Ga0495653_0167905 | Ga0495653_0167905_473_1462 | 301 |
| 471 | 3300046473 | Ga0495582_0002764 | Ga0495582_0002764_808_1797 | 301 |
| 472 | 3300046475 | Ga0495639_0048956 | Ga0495639_0048956_236_1225 | 301 |
| 473 | 3300046476 | Ga0495662_0069873 | Ga0495662_0069873_473_1462 | 301 |
| 474 | 3300046477 | Ga0495664_0011692 | Ga0495664_0011692_2648_3634 | 301 |
| 475 | 3300046477 | Ga0495664_0023314 | Ga0495664_0023314_1854_2903 | 301 |
| 476 | 3300046492 | Ga0495585_0151617 | Ga0495585_0151617_80_1069 | 301 |
| 477 | 3300046499 | Ga0495594_0082286 | Ga0495594_0082286_574_1563 | 301 |
| 478 | 3300046511 | Ga0495608_0063938 | Ga0495608_0063938_1179_2168 | 301 |
| 479 | 3300046514 | Ga0495618_0024995 | Ga0495618_0024995_1169_2158 | 301 |
| 480 | 3300046514 | Ga0495618_0084634 | Ga0495618_0084634_805_1791 | 301 |
| 481 | 3300046516 | Ga0495628_0126344 | Ga0495628_0126344_588_1577 | 301 |
| 482 | 3300046516 | Ga0495628_0266185 | Ga0495628_0266185_267_1253 | 301 |
| 483 | 3300046517 | Ga0495630_0040874 | Ga0495630_0040874_1542_2531 | 301 |
| 484 | 3300046523 | Ga0495644_0042716 | Ga0495644_0042716_52_1041 | 301 |
| 485 | 3300046526 | Ga0495666_0026753 | Ga0495666_0026753_997_1986 | 301 |
| 486 | 3300046529 | Ga0495652_0069543 | Ga0495652_0069543_1854_2843 | 301 |
| 487 | 3300046531 | Ga0495665_0084196 | Ga0495665_0084196_603_1592 | 301 |
| 488 | 3300046533 | Ga0495640_0017049 | Ga0495640_0017049_3673_4659 | 301 |
| 489 | 3300046533 | Ga0495640_0042267 | Ga0495640_0042267_1529_2578 | 301 |
| 490 | 3300046533 | Ga0495640_0081061 | Ga0495640_0081061_993_1982 | 301 |
| 491 | 3300046533 | Ga0495640_0099625 | Ga0495640_0099625_903_1889 | 301 |
| 492 | 3300046535 | Ga0495586_0164365 | Ga0495586_0164365_50_1036 | 301 |
| 493 | 3300046536 | Ga0495587_0044014 | Ga0495587_0044014_1009_1998 | 301 |
| 494 | 3300046559 | Ga0495667_0004013 | Ga0495667_0004013_7103_8092 | 301 |
| 495 | 3300046642 | Ga0495634_0024631 | Ga0495634_0024631_2792_3778 | 301 |
| 496 | 3300046642 | Ga0495634_0041018 | Ga0495634_0041018_658_1644 | 301 |
| 497 | 3300046642 | Ga0495634_0152320 | Ga0495634_0152320_260_1249 | 301 |
| 498 | 3300046642 | Ga0495634_0233586 | Ga0495634_0233586_128_1117 | 301 |
| 499 | 3300046663 | Ga0495635_0034221 | Ga0495635_0034221_1565_2551 | 301 |
| 500 | 3300046663 | Ga0495635_0053526 | Ga0495635_0053526_650_1699 | 301 |
| 501 | 3300046663 | Ga0495635_0095729 | Ga0495635_0095729_344_1333 | 301 |
| 502 | 3300046674 | Ga0495588_0086635 | Ga0495588_0086635_550_1536 | 301 |
| 503 | 3300046681 | Ga0495647_0034188 | Ga0495647_0034188_331_1317 | 301 |
| 504 | 3300046683 | Ga0495658_0088135 | Ga0495658_0088135_832_1821 | 301 |
| 505 | 3300046683 | Ga0495658_0192908 | Ga0495658_0192908_221_1207 | 301 |
| 506 | 3300046689 | Ga0495613_0079701 | Ga0495613_0079701_991_1980 | 301 |
| 507 | 3300046690 | Ga0495624_0026957 | Ga0495624_0026957_2715_3701 | 301 |
| 508 | 3300046809 | Ga0495600_0047376 | Ga0495600_0047376_905_1894 | 301 |
| 509 | 3300047319 | Ga0495674_0001877 | Ga0495674_0001877_8784_9770 | 301 |
| 510 | 3300047319 | Ga0495674_0005000 | Ga0495674_0005000_8399_9388 | 301 |
| 511 | 3300047319 | Ga0495674_0008643 | Ga0495674_0008643_2901_3950 | 301 |
| 512 | 3300047321 | Ga0495676_0097020 | Ga0495676_0097020_1260_2165 | 301 |
| 513 | 3300047322 | Ga0495680_0015575 | Ga0495680_0015575_4118_5107 | 301 |
| 514 | 3300047322 | Ga0495680_0150848 | Ga0495680_0150848_12_998 | 301 |
| 515 | 3300047322 | Ga0495680_0213292 | Ga0495680_0213292_16_1002 | 301 |
| 516 | 3300047471 | Ga0495684_0023821 | Ga0495684_0023821_2708_3697 | 301 |
| 517 | 3300047471 | Ga0495684_0049472 | Ga0495684_0049472_922_1908 | 301 |
| 518 | 3300047471 | Ga0495684_0203340 | Ga0495684_0203340_22_957 | 301 |
| 519 | 3300047673 | Ga0495593_0004152 | Ga0495593_0004152_1695_2684 | 301 |
| 520 | 3300047673 | Ga0495593_0045830 | Ga0495593_0045830_342_1328 | 301 |
| 521 | 3300048089 | Ga0495614_0006790 | Ga0495614_0006790_3660_4649 | 301 |
| 522 | 3300048903 | Ga0496100_0015805 | Ga0496100_0015805_2212_3198 | 301 |
| 523 | 3300048904 | Ga0496101_0017030 | Ga0496101_0017030_657_1643 | 301 |
| 524 | 3300048904 | Ga0496101_0132060 | Ga0496101_0132060_70_1062 | 301 |
| 525 | 3300048905 | Ga0496102_0024115 | Ga0496102_0024115_549_1535 | 301 |
| 526 | 3300048905 | Ga0496102_0111189 | Ga0496102_0111189_1561_2466 | 301 |
| 527 | 3300048905 | Ga0496102_0288895 | Ga0496102_0288895_219_1208 | 301 |
| 528 | 3300048907 | Ga0496104_0004332 | Ga0496104_0004332_8252_9238 | 301 |
| 529 | 3300048907 | Ga0496104_0009515 | Ga0496104_0009515_1633_2538 | 301 |
| 530 | 3300048907 | Ga0496104_0088807 | Ga0496104_0088807_661_1650 | 301 |
| 531 | 3300048907 | Ga0496104_0096179 | Ga0496104_0096179_1404_2390 | 301 |
| 532 | 3300048907 | Ga0496104_0471638 | Ga0496104_0471638_125_1114 | 301 |
| 533 | 3300048908 | Ga0496105_0037882 | Ga0496105_0037882_1492_2397 | 301 |
| 534 | 3300048909 | Ga0496106_0010963 | Ga0496106_0010963_2487_3488 | 301 |
| 535 | 3300048910 | Ga0496107_0003431 | Ga0496107_0003431_7690_8691 | 301 |
| 536 | 3300048910 | Ga0496107_0018111 | Ga0496107_0018111_3877_4863 | 301 |
| 537 | 3300048911 | Ga0496108_0003735 | Ga0496108_0003735_3060_3965 | 301 |
| 538 | 3300048911 | Ga0496108_0420934 | Ga0496108_0420934_53_1042 | 301 |
| 539 | 3300048912 | Ga0496109_0009387 | Ga0496109_0009387_1639_2544 | 301 |
| 540 | 3300048912 | Ga0496109_0011242 | Ga0496109_0011242_592_1578 | 301 |
| 541 | 3300048912 | Ga0496109_0014298 | Ga0496109_0014298_5753_6754 | 301 |
| 542 | 3300048912 | Ga0496109_0104222 | Ga0496109_0104222_200_1189 | 301 |
| 543 | 3300048913 | Ga0496110_0007902 | Ga0496110_0007902_6025_6930 | 301 |
| 544 | 3300048913 | Ga0496110_0044048 | Ga0496110_0044048_2855_3844 | 301 |
| 545 | 3300048914 | Ga0496111_0022467 | Ga0496111_0022467_2589_3578 | 301 |
| 546 | 3300048914 | Ga0496111_0029133 | Ga0496111_0029133_2413_3414 | 301 |
| 547 | 3300048915 | Ga0496112_0014731 | Ga0496112_0014731_1633_2538 | 301 |
| 548 | 3300048915 | Ga0496112_0095576 | Ga0496112_0095576_361_1350 | 301 |
| 549 | 3300048916 | Ga0496113_0001073 | Ga0496113_0001073_12251_13156 | 301 |
| 550 | 3300048916 | Ga0496113_0315195 | Ga0496113_0315195_226_1227 | 301 |
| 551 | 3300048917 | Ga0496114_0012875 | Ga0496114_0012875_5136_6125 | 301 |
| 552 | 3300048918 | Ga0496115_0004469 | Ga0496115_0004469_1316_2302 | 301 |
| 553 | 3300048918 | Ga0496115_0009006 | Ga0496115_0009006_4051_5052 | 301 |
| 554 | 3300048918 | Ga0496115_0087575 | Ga0496115_0087575_245_1234 | 301 |
| 555 | 3300048918 | Ga0496115_0502397 | Ga0496115_0502397_27_932 | 301 |
| 556 | 3300048929 | Ga0496126_0007361 | Ga0496126_0007361_6655_7644 | 301 |
| 557 | 3300050507 | nmdc:mga05p37_19687_c1 | nmdc:mga05p37_19687_c1_1123_2112 | 301 |
| 558 | 3300050507 | nmdc:mga05p37_29436_c1 | nmdc:mga05p37_29436_c1_5525_6514 | 301 |
| 559 | 3300050507 | nmdc:mga05p37_511744_c1 | nmdc:mga05p37_511744_c1_183_1181 | 301 |
| 560 | 3300050507 | nmdc:mga05p37_715781_c1 | nmdc:mga05p37_715781_c1_31_1020 | 301 |
| 561 | 3300050508 | nmdc:mga09592_19502_c1 | nmdc:mga09592_19502_c1_158_1147 | 301 |
| 562 | 3300050508 | nmdc:mga09592_239344_c1 | nmdc:mga09592_239344_c1_201_1190 | 301 |
| 563 | 3300050508 | nmdc:mga09592_345589_c1 | nmdc:mga09592_345589_c1_208_1209 | 301 |
| 564 | 3300050508 | nmdc:mga09592_48942_c1 | nmdc:mga09592_48942_c1_463_1452 | 301 |
| 565 | 3300050509 | nmdc:mga0qj67_264993_c1 | nmdc:mga0qj67_264993_c1_166_1155 | 301 |
| 566 | 3300050509 | nmdc:mga0qj67_58391_c1 | nmdc:mga0qj67_58391_c1_219_1220 | 301 |
| 567 | 3300050510 | nmdc:mga06r32_204444_c1 | nmdc:mga06r32_204444_c1_258_1247 | 301 |
| 568 | 3300050510 | nmdc:mga06r32_407973_c1 | nmdc:mga06r32_407973_c1_173_1162 | 301 |
| 569 | 3300050510 | nmdc:mga06r32_43682_c1 | nmdc:mga06r32_43682_c1_383_1372 | 301 |
| 570 | 3300050511 | nmdc:mga08y16_103085_c1 | nmdc:mga08y16_103085_c1_1795_2784 | 301 |
| 571 | 3300050511 | nmdc:mga08y16_22646_c1 | nmdc:mga08y16_22646_c1_1740_2729 | 301 |
| 572 | 3300050511 | nmdc:mga08y16_42275_c1 | nmdc:mga08y16_42275_c1_3695_4684 | 301 |
| 573 | 3300050511 | nmdc:mga08y16_562563_c1 | nmdc:mga08y16_562563_c1_28_1017 | 301 |
| 574 | 3300050511 | nmdc:mga08y16_5773_c1 | nmdc:mga08y16_5773_c1_565_1470 | 301 |
| 575 | 3300050512 | nmdc:mga0n895_17696_c1 | nmdc:mga0n895_17696_c1_1080_2069 | 301 |
| 576 | 3300050512 | nmdc:mga0n895_39498_c1 | nmdc:mga0n895_39498_c1_3540_4529 | 301 |
| 577 | 3300050513 | nmdc:mga0rr50_248596_c1 | nmdc:mga0rr50_248596_c1_75_1061 | 301 |
| 578 | 3300050513 | nmdc:mga0rr50_271799_c1 | nmdc:mga0rr50_271799_c1_178_1167 | 301 |
| 579 | 3300050515 | nmdc:mga0a205_33865_c1 | nmdc:mga0a205_33865_c1_3579_4568 | 301 |
| 580 | 3300053077 | Ga0495601_0000849 | Ga0495601_0000849_4506_5492 | 301 |
| 581 | 3300053077 | Ga0495601_0003182 | Ga0495601_0003182_2613_3662 | 301 |
| 582 | 3300053077 | Ga0495601_0030335 | Ga0495601_0030335_1319_2308 | 301 |
| 583 | 3300053077 | Ga0495601_0100860 | Ga0495601_0100860_249_1238 | 301 |
| 584 | 3300053077 | Ga0495601_0179755 | Ga0495601_0179755_117_1103 | 301 |
| 585 | 3300053077 | Ga0495601_0305370 | Ga0495601_0305370_37_984 | 301 |
| 586 | 3300053078 | Ga0495612_0001357 | Ga0495612_0001357_3135_4184 | 301 |
| 587 | 3300053078 | Ga0495612_0027772 | Ga0495612_0027772_534_1520 | 301 |
| 588 | 3300053083 | Ga0495655_0021161 | Ga0495655_0021161_164_1156 | 301 |
| 589 | 3300053085 | Ga0495619_0000128 | Ga0495619_0000128_3281_4330 | 301 |
| 590 | 3300053085 | Ga0495619_0002432 | Ga0495619_0002432_1049_2035 | 301 |
| 591 | 3300053085 | Ga0495619_0003256 | Ga0495619_0003256_4253_5242 | 301 |
| 592 | 3300053085 | Ga0495619_0015771 | Ga0495619_0015771_3405_4394 | 301 |
| 593 | 3300053085 | Ga0495619_0074594 | Ga0495619_0074594_1202_2188 | 301 |
| 594 | 3300053085 | Ga0495619_0163192 | Ga0495619_0163192_134_1120 | 301 |
| 595 | 3300053085 | Ga0495619_0262968 | Ga0495619_0262968_23_970 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lft-assembly1.cif.gz_A | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9192 | 2 | 300 |
| 3lkv-assembly1.cif.gz_A-2 | crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 | 0.9154 | 2 | 299 |
| 3lft-assembly1.cif.gz_A | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9104 | 2 | 300 |
| 3lft-assembly2.cif.gz_B | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9063 | 4 | 300 |
| 3lkv-assembly1.cif.gz_A-2 | crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 | 0.9037 | 2 | 299 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lftA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8659 | 123 | 300 | 3.40.50.2300 |
| 3lkvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8657 | 123 | 299 | 3.40.50.2300 |
| 3lftA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8495 | 123 | 300 | 3.40.50.2300 |
| 3lkvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8435 | 123 | 299 | 3.40.50.2300 |
| 3e61A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8369 | 4 | 91 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537RBB7-F1-model_v4 | ABC transporter substrate-binding protein | 0.9831 | 1 | 87 |
|
| AF-A0A537SGS6-F1-model_v4 | ABC transporter substrate-binding protein | 0.9821 | 1 | 301 |
|
| AF-A0A7V9HTZ8-F1-model_v4 | ABC transporter substrate-binding protein | 0.9808 | 195 | 301 |
|
| AF-A0A537SGS6-F1-model_v4 | ABC transporter substrate-binding protein | 0.9789 | 1 | 301 |
|
| AF-A0A537H7S6-F1-model_v4 | ABC transporter substrate-binding protein | 0.9785 | 194 | 301 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar