F467431

General Info

Members Datasets Scaffolds Average Seq Length
595 275 595 325

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100458872|Ga0075428_1004588721
Length 367
Sequence LQCECLLLTQSGHRHPPLPLQADWLRQYDGRPDASGEAMRRREFILLLGCAVAASPVSARAQQAEQMRRIGVLLNTASDDPDGQAGVAAFNQALQQLGWGVGGQVRIDTRWGQNDEDLDRKYAAELVALGPDVFLASGSLSVAALKRVTRTVPVVFVNVADPVGGGFVDSLARPGGNVTGFMLYEYSFSGKWLELLKEIVPHLARVAVLRDSGNRAGIGQFAAIQSVAPSLGVELRPVDTSDGGEIERTLAAFARSPNVGLVVTPSAAVAARRHAIVTLAARYKLPAVYGFRPPIVAGGLISYGPNRIDPFRRAAEYVDRILKGEKPNDMPVQAPTKYELVVNLKTAKALGLTMPPAVLARADEVIE

Samples

Sample ID Description Type Environment
1 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 10.25
Rhizosphere 88.74
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c000794 3300000043 Unclassified 3823
2 ARSoilOldRDRAFT_c000065 3300000044 Bacteria 20923
3 Ga0070658_10013344 3300005327 Bacteria 6594
4 Ga0070683_100032525 3300005329 Bacteria 4750
5 Ga0070683_100215701 3300005329 Bacteria 1823
6 Ga0070690_100031526 3300005330 Bacteria 3303
7 Ga0070670_100073248 3300005331 Bacteria 2942
8 Ga0070670_100174214 3300005331 Bacteria 1867
9 Ga0068869_100171182 3300005334 Bacteria 1696
10 Ga0070666_10008838 3300005335 Bacteria 6262
11 Ga0070680_100012153 3300005336 Bacteria 6686
12 Ga0070680_100406427 3300005336 Bacteria 1161
13 Ga0070682_100029483 3300005337 Bacteria 3304
14 Ga0068868_100035011 3300005338 Bacteria 3880
15 Ga0068868_100071224 3300005338 Bacteria 2772
16 Ga0068868_100194829 3300005338 Unclassified 1687
17 Ga0070660_100067773 3300005339 Unclassified 2781
18 Ga0070660_100194610 3300005339 Unclassified 1643
19 Ga0070691_10013368 3300005341 Bacteria 3760
20 Ga0070691_10061188 3300005341 Bacteria 1811
21 Ga0070687_100014213 3300005343 Bacteria 3571
22 Ga0070661_100026196 3300005344 Bacteria 4192
23 Ga0070692_10076185 3300005345 Bacteria 1797
24 Ga0070668_100041834 3300005347 Bacteria 3511
25 Ga0070669_100317490 3300005353 Unclassified 1257
26 Ga0070675_100029877 3300005354 Bacteria 4397
27 Ga0070671_100017927 3300005355 Bacteria 5743
28 Ga0070671_100107551 3300005355 Bacteria 2342
29 Ga0070674_100223071 3300005356 Unclassified 1467
30 Ga0070673_100313614 3300005364 Bacteria 1384
31 Ga0070688_100013038 3300005365 Bacteria 4678
32 Ga0070659_100247923 3300005366 Unclassified 1475
33 Ga0070667_100027719 3300005367 Bacteria 4713
34 Ga0070667_100355732 3300005367 Bacteria 1326
35 Ga0070709_10003774 3300005434 Bacteria 8144
36 Ga0070709_10247378 3300005434 Unclassified 1283
37 Ga0070714_100055028 3300005435 Bacteria 3400
38 Ga0070714_100075294 3300005435 Bacteria 2928
39 Ga0070714_100139858 3300005435 Bacteria 2172
40 Ga0070713_100000923 3300005436 Bacteria 18738
41 Ga0070713_100034040 3300005436 Bacteria 4088
42 Ga0070713_100114274 3300005436 Bacteria 2358
43 Ga0070710_10001800 3300005437 Bacteria 10137
44 Ga0070710_10043525 3300005437 Unclassified 2487
45 Ga0070710_10136407 3300005437 Unclassified 1500
46 Ga0070710_10190217 3300005437 Bacteria 1290
47 Ga0070710_10223251 3300005437 Bacteria 1199
48 Ga0070701_10091121 3300005438 Unclassified 1670
49 Ga0070701_10185759 3300005438 Bacteria 1220
50 Ga0070711_100020052 3300005439 Bacteria 4301
51 Ga0070711_100089950 3300005439 Unclassified 2210
52 Ga0070711_100447851 3300005439 Bacteria 1056
53 Ga0070705_100081312 3300005440 Unclassified 1990
54 Ga0070700_100228287 3300005441 Unclassified 1323
55 Ga0070694_100055482 3300005444 Bacteria 2687
56 Ga0070663_100012044 3300005455 Bacteria 5456
57 Ga0070663_100034499 3300005455 Bacteria 3505
58 Ga0070663_100094641 3300005455 Unclassified 2219
59 Ga0070662_100043615 3300005457 Bacteria 3210
60 Ga0070681_10004462 3300005458 Bacteria 13334
61 Ga0070681_10032029 3300005458 Bacteria 5277
62 Ga0068867_100019732 3300005459 Bacteria 4802
63 Ga0070685_10019636 3300005466 Bacteria 3649
64 Ga0070706_100055278 3300005467 Bacteria 3664
65 Ga0070706_100120354 3300005467 Bacteria 2447
66 Ga0070679_100021543 3300005530 Bacteria 6294
67 Ga0070679_100107410 3300005530 Bacteria 2777
68 Ga0070679_100152190 3300005530 Bacteria 2290
69 Ga0070684_100137545 3300005535 Bacteria 2207
70 Ga0070684_100243053 3300005535 Bacteria 1645
71 Ga0068853_100461751 3300005539 Bacteria 1195
72 Ga0070686_100013188 3300005544 Bacteria 4723
73 Ga0070695_100068494 3300005545 Bacteria 2317
74 Ga0070696_100109237 3300005546 Bacteria 1990
75 Ga0070693_100044105 3300005547 Bacteria 2521
76 Ga0070665_100385802 3300005548 Unclassified 1408
77 Ga0070704_100205824 3300005549 Unclassified 1591
78 Ga0068855_100017760 3300005563 Bacteria 8551
79 Ga0070664_100089868 3300005564 Unclassified 2658
80 Ga0070664_100103957 3300005564 Bacteria 2473
81 Ga0068856_100310923 3300005614 Bacteria 1593
82 Ga0070702_100005470 3300005615 Bacteria 5920
83 Ga0070702_100024201 3300005615 Bacteria 3236
84 Ga0068859_100032057 3300005617 Bacteria 5279
85 Ga0068866_10061197 3300005718 Bacteria 1954
86 Ga0068861_100066615 3300005719 Bacteria 2777
87 Ga0068863_100015305 3300005841 Bacteria 7372
88 Ga0068863_100062596 3300005841 Bacteria 3518
89 Ga0068858_100066971 3300005842 Bacteria 3325
90 Ga0068858_100352348 3300005842 Bacteria 1410
91 Ga0068860_100032446 3300005843 Bacteria 5018
92 Ga0068860_100042471 3300005843 Bacteria 4341
93 Ga0068860_100128312 3300005843 Bacteria 2432
94 Ga0081455_10001955 3300005937 Bacteria 24750
95 Ga0081455_10005468 3300005937 Bacteria 13924
96 Ga0081455_10024203 3300005937 Bacteria 5630
97 Ga0081455_10100522 3300005937 Bacteria 2323
98 Ga0081455_10156660 3300005937 Bacteria 1750
99 Ga0070717_10004425 3300006028 Bacteria 10144
100 Ga0070717_10007219 3300006028 Bacteria 8242
101 Ga0075365_10034651 3300006038 Bacteria 3261
102 Ga0075364_10029649 3300006051 Bacteria 3510
103 Ga0075432_10031978 3300006058 Bacteria 1822
104 Ga0070715_10015983 3300006163 Bacteria 2810
105 Ga0070715_10045606 3300006163 Bacteria 1859
106 Ga0070716_100004152 3300006173 Bacteria 6879
107 Ga0070716_100097712 3300006173 Bacteria 1793
108 Ga0070712_100000152 3300006175 Bacteria 36965
109 Ga0070712_100001612 3300006175 Bacteria 13801
110 Ga0070712_100005090 3300006175 Bacteria 8139
111 Ga0070712_100006051 3300006175 Bacteria 7492
112 Ga0070712_100007463 3300006175 Bacteria 6826
113 Ga0070712_100017046 3300006175 Bacteria 4696
114 Ga0070712_100048364 3300006175 Bacteria 2948
115 Ga0070712_100085934 3300006175 Bacteria 2291
116 Ga0070712_100107234 3300006175 Bacteria 2078
117 Ga0070712_100311454 3300006175 Bacteria 1277
118 Ga0075427_10008290 3300006194 Bacteria 1538
119 Ga0097621_100044921 3300006237 Bacteria 3566
120 Ga0097621_100049306 3300006237 Bacteria 3420
121 Ga0097621_100079195 3300006237 Bacteria 2731
122 Ga0068871_100006454 3300006358 Bacteria 8299
123 Ga0075428_100046328 3300006844 Unclassified 4776
124 Ga0075428_100067941 3300006844 Bacteria 3900
125 Ga0075428_100075063 3300006844 Bacteria 3693
126 Ga0075428_100207343 3300006844 Bacteria 2118
127 Ga0075428_100246885 3300006844 Archaea 1924
128 Ga0075428_100458872 3300006844 Unclassified 1364
129 Ga0075430_100103543 3300006846 Bacteria 2376
130 Ga0075430_100238655 3300006846 Bacteria 1506
131 Ga0075430_100239586 3300006846 Archaea 1503
132 Ga0075431_100078296 3300006847 Bacteria 3412
133 Ga0075431_100194443 3300006847 Bacteria 2077
134 Ga0075431_100237436 3300006847 Bacteria 1855
135 Ga0075431_100342876 3300006847 Archaea 1503
136 Ga0075433_10025033 3300006852 Bacteria 5044
137 Ga0075433_10035167 3300006852 Bacteria 4306
138 Ga0075433_10157415 3300006852 Bacteria 2021
139 Ga0075434_100020106 3300006871 Bacteria 6470
140 Ga0075434_100048599 3300006871 Bacteria 4209
141 Ga0075434_100263797 3300006871 Unclassified 1742
142 Ga0075434_100292979 3300006871 Archaea 1647
143 Ga0075434_100322650 3300006871 Bacteria 1565
144 Ga0075434_100382915 3300006871 Bacteria 1427
145 Ga0075429_100003840 3300006880 Bacteria 12830
146 Ga0075429_100056429 3300006880 Bacteria 3418
147 Ga0075429_100126461 3300006880 Bacteria 2235
148 Ga0075429_100142591 3300006880 Archaea 2097
149 Ga0075429_100216177 3300006880 Bacteria 1679
150 Ga0075429_100247926 3300006880 Bacteria 1559
151 Ga0075429_100371792 3300006880 Bacteria 1251
152 Ga0068865_100010590 3300006881 Bacteria 5746
153 Ga0097620_100032057 3300006931 Bacteria 5279
154 Ga0075435_100014492 3300007076 Bacteria 5894
155 Ga0099794_10011522 3300007265 Unclassified 3788
156 Ga0099794_10068857 3300007265 Bacteria 1731
157 Ga0099795_10056721 3300007788 Bacteria 1442
158 Ga0105240_10061524 3300009093 Bacteria 4679
159 Ga0111539_10015907 3300009094 Bacteria 9343
160 Ga0111539_10016150 3300009094 Bacteria 9262
161 Ga0111539_10025469 3300009094 Bacteria 7254
162 Ga0111539_10065075 3300009094 Bacteria 4311
163 Ga0111539_10333719 3300009094 Archaea 1765
164 Ga0111539_10480413 3300009094 Unclassified 1447
165 Ga0105245_10005433 3300009098 Bacteria 11193
166 Ga0105245_10055899 3300009098 Bacteria 3546
167 Ga0105245_10402658 3300009098 Unclassified 1368
168 Ga0105247_10049357 3300009101 Unclassified 2587
169 Ga0114129_10068290 3300009147 Bacteria 4956
170 Ga0114129_10160321 3300009147 Bacteria 3073
171 Ga0114129_10388360 3300009147 Bacteria 1842
172 Ga0114129_10547328 3300009147 Archaea 1506
173 Ga0105243_10002091 3300009148 Bacteria 16915
174 Ga0105243_10041858 3300009148 Bacteria 3583
175 Ga0105241_10051972 3300009174 Bacteria 3127
176 Ga0105241_10205606 3300009174 Bacteria 1647
177 Ga0105242_10016785 3300009176 Bacteria 5698
178 Ga0105242_10020765 3300009176 Bacteria 5151
179 Ga0105248_10025971 3300009177 Bacteria 6514
180 Ga0105248_10766371 3300009177 Bacteria 1089
181 Ga0105237_10054339 3300009545 Bacteria 4012
182 Ga0105238_10032771 3300009551 Bacteria 5288
183 Ga0105249_10023992 3300009553 Bacteria 5478
184 Ga0105249_10046888 3300009553 Unclassified 3935
185 Ga0105249_10137536 3300009553 Bacteria 2340
186 Ga0105239_10095686 3300010375 Bacteria 3280
187 Ga0105239_10110462 3300010375 Unclassified 3048
188 Ga0105239_10195787 3300010375 Bacteria 2263
189 Ga0105246_10027298 3300011119 Unclassified 3739
190 Ga0157370_10150244 3300013104 Bacteria 2168
191 Ga0157374_10036731 3300013296 Bacteria 4490
192 Ga0157374_10092945 3300013296 Unclassified 2879
193 Ga0157378_10011633 3300013297 Bacteria 7705
194 Ga0157378_10019818 3300013297 Bacteria 5914
195 Ga0157378_10125604 3300013297 Bacteria 2369
196 Ga0163162_10021332 3300013306 Bacteria 6378
197 Ga0163162_10111399 3300013306 Bacteria 2834
198 Ga0157375_10009637 3300013308 Bacteria 8487
199 Ga0157375_10245606 3300013308 Bacteria 1950
200 Ga0157375_10688806 3300013308 Unclassified 1176
201 Ga0163163_10014823 3300014325 Bacteria 7178
202 Ga0163163_10050054 3300014325 Bacteria 4114
203 Ga0163163_10329715 3300014325 Bacteria 1581
204 Ga0157380_10120594 3300014326 Bacteria 2221
205 Ga0157379_10019495 3300014968 Bacteria 5992
206 Ga0157379_10044185 3300014968 Bacteria 3977
207 Ga0157376_10015168 3300014969 Bacteria 5812
208 Ga0157376_10027383 3300014969 Bacteria 4517
209 Ga0157376_10072633 3300014969 Bacteria 2927
210 Ga0157376_10172255 3300014969 Bacteria 1972
211 Ga0163161_10056567 3300017792 Unclassified 2849
212 Ga0163161_10386990 3300017792 Bacteria 1119
213 Ga0213875_10001694 3300021388 Bacteria 13874
214 Ga0207692_10017964 3300025898 Bacteria 3165
215 Ga0207692_10029119 3300025898 Bacteria 2621
216 Ga0207692_10190285 3300025898 Bacteria 1201
217 Ga0207710_10016265 3300025900 Bacteria 3147
218 Ga0207688_10015657 3300025901 Bacteria 4113
219 Ga0207680_10047161 3300025903 Unclassified 2551
220 Ga0207699_10006751 3300025906 Bacteria 5573
221 Ga0207699_10025698 3300025906 Unclassified 3236
222 Ga0207699_10179005 3300025906 Unclassified 1424
223 Ga0207645_10014673 3300025907 Bacteria 5232
224 Ga0207643_10016238 3300025908 Bacteria 4061
225 Ga0207684_10084803 3300025910 Bacteria 2698
226 Ga0207684_10210458 3300025910 Bacteria 1677
227 Ga0207707_10012634 3300025912 Bacteria 7339
228 Ga0207693_10002719 3300025915 Bacteria 15332
229 Ga0207693_10007070 3300025915 Bacteria 9265
230 Ga0207693_10010191 3300025915 Bacteria 7634
231 Ga0207693_10010613 3300025915 Bacteria 7472
232 Ga0207693_10012093 3300025915 Bacteria 6978
233 Ga0207693_10061411 3300025915 Bacteria 2943
234 Ga0207693_10097444 3300025915 Bacteria 2306
235 Ga0207693_10228538 3300025915 Bacteria 1461
236 Ga0207663_10029771 3300025916 Bacteria 3211
237 Ga0207663_10030742 3300025916 Bacteria 3170
238 Ga0207663_10123698 3300025916 Bacteria 1776
239 Ga0207663_10262407 3300025916 Unclassified 1276
240 Ga0207660_10008319 3300025917 Bacteria 6705
241 Ga0207660_10220294 3300025917 Bacteria 1489
242 Ga0207662_10075312 3300025918 Bacteria 2050
243 Ga0207657_10190157 3300025919 Unclassified 1656
244 Ga0207649_10257503 3300025920 Bacteria 1260
245 Ga0207652_10322077 3300025921 Bacteria 1395
246 Ga0207694_10178942 3300025924 Bacteria 1719
247 Ga0207650_10027179 3300025925 Bacteria 4093
248 Ga0207650_10195809 3300025925 Unclassified 1616
249 Ga0207687_10031905 3300025927 Bacteria 3564
250 Ga0207700_10002289 3300025928 Bacteria 10987
251 Ga0207700_10124042 3300025928 Bacteria 2098
252 Ga0207700_10161769 3300025928 Unclassified 1860
253 Ga0207700_10262399 3300025928 Bacteria 1480
254 Ga0207664_10075598 3300025929 Bacteria 2724
255 Ga0207664_10123800 3300025929 Bacteria 2168
256 Ga0207664_10155563 3300025929 Unclassified 1946
257 Ga0207644_10025420 3300025931 Bacteria 4072
258 Ga0207644_10176433 3300025931 Bacteria 1672
259 Ga0207690_10188960 3300025932 Unclassified 1557
260 Ga0207706_10309080 3300025933 Bacteria 1377
261 Ga0207686_10023983 3300025934 Bacteria 3528
262 Ga0207709_10001690 3300025935 Bacteria 14840
263 Ga0207669_10186711 3300025937 Unclassified 1491
264 Ga0207704_10014448 3300025938 Bacteria 3986
265 Ga0207704_10064424 3300025938 Bacteria 2290
266 Ga0207704_10325416 3300025938 Bacteria 1187
267 Ga0207665_10000223 3300025939 Bacteria 38647
268 Ga0207665_10037889 3300025939 Unclassified 3209
269 Ga0207711_10036147 3300025941 Bacteria 4190
270 Ga0207711_10408534 3300025941 Unclassified 1262
271 Ga0207661_10052476 3300025944 Bacteria 3258
272 Ga0207679_10034277 3300025945 Bacteria 3580
273 Ga0207679_10081531 3300025945 Bacteria 2474
274 Ga0207667_10018882 3300025949 Bacteria 7713
275 Ga0207667_10629318 3300025949 Bacteria 1080
276 Ga0207712_10098067 3300025961 Unclassified 2173
277 Ga0207712_10155881 3300025961 Bacteria 1769
278 Ga0207677_10052394 3300026023 Bacteria 2772
279 Ga0207677_10364164 3300026023 Unclassified 1215
280 Ga0207703_10104985 3300026035 Unclassified 2401
281 Ga0207703_10311976 3300026035 Bacteria 1438
282 Ga0207678_10022573 3300026067 Bacteria 5511
283 Ga0207678_10046170 3300026067 Bacteria 3767
284 Ga0207678_10115428 3300026067 Unclassified 2291
285 Ga0207708_10059417 3300026075 Bacteria 2918
286 Ga0207702_10107216 3300026078 Bacteria 2477
287 Ga0207641_10013191 3300026088 Bacteria 6775
288 Ga0207676_10106741 3300026095 Bacteria 2334
289 Ga0207676_10305287 3300026095 Unclassified 1454
290 Ga0207676_10343301 3300026095 Bacteria 1378
291 Ga0207675_100068390 3300026118 Bacteria 3319
292 Ga0207683_10015344 3300026121 Bacteria 6524
293 Ga0207683_10050910 3300026121 Bacteria 3628
294 Ga0207428_10004670 3300027907 Bacteria 12979
295 Ga0207428_10014965 3300027907 Bacteria 6722
296 Ga0207428_10015195 3300027907 Bacteria 6663
297 Ga0207428_10043497 3300027907 Bacteria 3627
298 Ga0207428_10073555 3300027907 Bacteria 2681
299 Ga0207428_10192556 3300027907 Bacteria 1537
300 Ga0268266_10008517 3300028379 Bacteria 9112
301 Ga0268266_10463885 3300028379 Bacteria 1205
302 Ga0268264_10124825 3300028381 Unclassified 2273
303 Ga0373948_0009240 3300034817 Unclassified 1697
304 Ga0373928_0036346 3300035084 Unclassified 1113
305 Ga0373929_0002042 3300035085 Unclassified 3754
306 Ga0373944_0007107 3300035089 Bacteria 2993
307 Ga0373923_0017150 3300035111 Bacteria 2765
308 Ga0373932_0001123 3300035112 Bacteria 7728
309 Ga0373932_0020084 3300035112 Unclassified 1748
310 Ga0373939_0001315 3300035114 Bacteria 6034
311 Ga0373941_0004546 3300035115 Unclassified 3214
312 Ga0373945_0005488 3300035116 Bacteria 4059
313 Ga0373945_0018869 3300035116 Bacteria 2350
314 Ga0373945_0100846 3300035116 Bacteria 1129
315 Ga0373954_0013602 3300035118 Bacteria 3627
316 Ga0373960_0000064 3300035121 Bacteria 14939
317 Ga0373960_0023746 3300035121 Bacteria 1653
318 Ga0373960_0070309 3300035121 Unclassified 1081
319 Ga0373943_0056454 3300035170 Bacteria 1948
320 Ga0373946_0006191 3300035171 Bacteria 4333
321 Ga0373946_0031331 3300035171 Unclassified 2128
322 Ga0373946_0126969 3300035171 Unclassified 1170
323 Ga0373962_0001185 3300035242 Bacteria 6095
324 Ga0373962_0014611 3300035242 Bacteria 2003
325 Ga0373924_0016909 3300035410 Bacteria 2790
326 Ga0373924_0062118 3300035410 Bacteria 1564
327 Ga0373931_0001721 3300035691 Bacteria 9491
328 Ga0373931_0004124 3300035691 Bacteria 6593
329 Ga0373931_0008848 3300035691 Bacteria 4793
330 Ga0373935_0086318 3300035692 Unclassified 2047
331 Ga0373935_0099411 3300035692 Bacteria 1915
332 Ga0373935_0312671 3300035692 Bacteria 1113
333 Ga0373927_0118623 3300035695 Bacteria 1726
334 Ga0373927_0211941 3300035695 Unclassified 1272
335 Ga0373927_0217532 3300035695 Bacteria 1255
336 Ga0373927_0219795 3300035695 Bacteria 1248
337 Ga0373933_0203455 3300035724 Unclassified 1267
338 Ga0373947_0044438 3300035725 Unclassified 2655
339 Ga0373947_0055031 3300035725 Bacteria 2402
340 Ga0373947_0123297 3300035725 Bacteria 1648
341 Ga0373947_0253979 3300035725 Bacteria 1163
342 Ga0373937_0233087 3300036401 Bacteria 1734
343 Ga0436364_1030895 3300037853 Bacteria 42604
344 Ga0495592_0020257 3300046454 Bacteria 5060
345 Ga0495592_0066060 3300046454 Bacteria 2647
346 Ga0495603_0018645 3300046455 Bacteria 4198
347 Ga0495629_0020608 3300046459 Bacteria 4709
348 Ga0495651_0009655 3300046462 Bacteria 7419
349 Ga0495651_0102235 3300046462 Bacteria 2132
350 Ga0495651_0218602 3300046462 Bacteria 1320
351 Ga0495653_0019340 3300046463 Bacteria 5524
352 Ga0495653_0167905 3300046463 Bacteria 1517
353 Ga0495580_0055689 3300046472 Bacteria 2786
354 Ga0495582_0002764 3300046473 Bacteria 9790
355 Ga0495582_0145381 3300046473 Bacteria 1345
356 Ga0495639_0048956 3300046475 Bacteria 1917
357 Ga0495662_0035433 3300046476 Unclassified 2408
358 Ga0495662_0039630 3300046476 Bacteria 2276
359 Ga0495662_0067112 3300046476 Bacteria 1736
360 Ga0495662_0069873 3300046476 Bacteria 1701
361 Ga0495664_0003466 3300046477 Bacteria 8587
362 Ga0495664_0011692 3300046477 Unclassified 4954
363 Ga0495664_0023314 3300046477 Plasmid 3592
364 Ga0495585_0151617 3300046492 Bacteria 1208
365 Ga0495594_0051048 3300046499 Bacteria 2276
366 Ga0495594_0082286 3300046499 Bacteria 1798
367 Ga0495608_0063938 3300046511 Bacteria 2413
368 Ga0495608_0072335 3300046511 Unclassified 2249
369 Ga0495618_0022171 3300046514 Bacteria 3921
370 Ga0495618_0024995 3300046514 Bacteria 3706
371 Ga0495618_0084634 3300046514 Bacteria 2026
372 Ga0495618_0152772 3300046514 Bacteria 1474
373 Ga0495628_0077369 3300046516 Unclassified 2588
374 Ga0495628_0126344 3300046516 Bacteria 1959
375 Ga0495628_0266185 3300046516 Unclassified 1276
376 Ga0495630_0040874 3300046517 Bacteria 3464
377 Ga0495644_0010409 3300046523 Bacteria 3584
378 Ga0495644_0042716 3300046523 Bacteria 1707
379 Ga0495666_0026753 3300046526 Bacteria 2841
380 Ga0495652_0031632 3300046529 Bacteria 4633
381 Ga0495652_0069543 3300046529 Bacteria 2947
382 Ga0495665_0084196 3300046531 Bacteria 1671
383 Ga0495665_0093448 3300046531 Bacteria 1580
384 Ga0495640_0017049 3300046533 Bacteria 5421
385 Ga0495640_0041097 3300046533 Unclassified 3233
386 Ga0495640_0042267 3300046533 Plasmid 3182
387 Ga0495640_0081061 3300046533 Bacteria 2157
388 Ga0495640_0099625 3300046533 Bacteria 1909
389 Ga0495586_0164365 3300046535 Bacteria 1252
390 Ga0495587_0026520 3300046536 Unclassified 3533
391 Ga0495587_0044014 3300046536 Bacteria 2656
392 Ga0495645_0111108 3300046543 Bacteria 1939
393 Ga0495667_0004013 3300046559 Bacteria 9889
394 Ga0495667_0052295 3300046559 Unclassified 2691
395 Ga0495656_0030836 3300046615 Bacteria 2170
396 Ga0495634_0024631 3300046642 Bacteria 4219
397 Ga0495634_0032131 3300046642 Unclassified 3611
398 Ga0495634_0041018 3300046642 Bacteria 3145
399 Ga0495634_0050879 3300046642 Bacteria 2780
400 Ga0495634_0152320 3300046642 Unclassified 1462
401 Ga0495634_0233586 3300046642 Unclassified 1130
402 Ga0495635_0009786 3300046663 Bacteria 6702
403 Ga0495635_0034221 3300046663 Bacteria 3524
404 Ga0495635_0053526 3300046663 Plasmid 2781
405 Ga0495635_0095729 3300046663 Bacteria 2029
406 Ga0495588_0086635 3300046674 Bacteria 1638
407 Ga0495657_0017257 3300046675 Bacteria 5244
408 Ga0495646_0069519 3300046680 Unclassified 2077
409 Ga0495647_0034188 3300046681 Bacteria 1903
410 Ga0495658_0088135 3300046683 Bacteria 1833
411 Ga0495658_0192908 3300046683 Bacteria 1267
412 Ga0495613_0079701 3300046689 Bacteria 2381
413 Ga0495613_0248516 3300046689 Bacteria 1242
414 Ga0495624_0026957 3300046690 Bacteria 3764
415 Ga0495624_0076173 3300046690 Bacteria 2082
416 Ga0495600_0047376 3300046809 Bacteria 2803
417 Ga0495600_0087424 3300046809 Unclassified 2033
418 Ga0495581_0058903 3300047315 Bacteria 2218
419 Ga0495604_0104267 3300047317 Unclassified 2078
420 Ga0495674_0001877 3300047319 Bacteria 20678
421 Ga0495674_0005000 3300047319 Bacteria 12756
422 Ga0495674_0008643 3300047319 Bacteria 9682
423 Ga0495674_0031831 3300047319 Bacteria 4786
424 Ga0495676_0097020 3300047321 Unclassified 2190
425 Ga0495676_0100272 3300047321 Bacteria 2144
426 Ga0495676_0188924 3300047321 Bacteria 1438
427 Ga0495680_0015575 3300047322 Bacteria 6558
428 Ga0495680_0134535 3300047322 Unclassified 1813
429 Ga0495680_0150848 3300047322 Bacteria 1695
430 Ga0495680_0213292 3300047322 Unclassified 1381
431 Ga0495675_0025056 3300047444 Unclassified 3804
432 Ga0495684_0023821 3300047471 Bacteria 4707
433 Ga0495684_0042879 3300047471 Bacteria 3464
434 Ga0495684_0049472 3300047471 Bacteria 3211
435 Ga0495684_0093406 3300047471 Unclassified 2278
436 Ga0495684_0131754 3300047471 Bacteria 1877
437 Ga0495684_0203340 3300047471 Bacteria 1459
438 Ga0495593_0004152 3300047673 Bacteria 8620
439 Ga0495593_0045830 3300047673 Unclassified 2332
440 Ga0495602_0048245 3300048088 Bacteria 3829
441 Ga0495614_0006790 3300048089 Bacteria 5121
442 Ga0496100_0015805 3300048903 Bacteria 4415
443 Ga0496101_0017030 3300048904 Bacteria 4921
444 Ga0496101_0049766 3300048904 Bacteria 3015
445 Ga0496101_0132060 3300048904 Bacteria 1897
446 Ga0496102_0019575 3300048905 Bacteria 5962
447 Ga0496102_0024115 3300048905 Bacteria 5406
448 Ga0496102_0111189 3300048905 Bacteria 2554
449 Ga0496102_0288895 3300048905 Unclassified 1545
450 Ga0496104_0001724 3300048907 Bacteria 18886
451 Ga0496104_0004332 3300048907 Bacteria 12345
452 Ga0496104_0009159 3300048907 Bacteria 8804
453 Ga0496104_0009515 3300048907 Bacteria 8651
454 Ga0496104_0036875 3300048907 Bacteria 4571
455 Ga0496104_0088807 3300048907 Bacteria 2953
456 Ga0496104_0096179 3300048907 Unclassified 2833
457 Ga0496104_0298133 3300048907 Bacteria 1524
458 Ga0496104_0395429 3300048907 Unclassified 1294
459 Ga0496104_0471638 3300048907 Unclassified 1166
460 Ga0496105_0015982 3300048908 Bacteria 5986
461 Ga0496105_0030253 3300048908 Bacteria 4438
462 Ga0496105_0037882 3300048908 Bacteria 3972
463 Ga0496105_0039513 3300048908 Bacteria 3889
464 Ga0496106_0004487 3300048909 Bacteria 10355
465 Ga0496106_0010963 3300048909 Bacteria 6702
466 Ga0496106_0062967 3300048909 Bacteria 2818
467 Ga0496106_0086904 3300048909 Bacteria 2409
468 Ga0496107_0003431 3300048910 Bacteria 10597
469 Ga0496107_0010967 3300048910 Bacteria 6305
470 Ga0496107_0018111 3300048910 Bacteria 4955
471 Ga0496108_0003735 3300048911 Bacteria 12211
472 Ga0496108_0005575 3300048911 Bacteria 10182
473 Ga0496108_0232738 3300048911 Bacteria 1602
474 Ga0496108_0287654 3300048911 Bacteria 1431
475 Ga0496108_0334455 3300048911 Unclassified 1321
476 Ga0496108_0420934 3300048911 Unclassified 1166
477 Ga0496108_0572872 3300048911 Bacteria 984
478 Ga0496109_0007668 3300048912 Bacteria 9150
479 Ga0496109_0009387 3300048912 Bacteria 8335
480 Ga0496109_0011242 3300048912 Bacteria 7687
481 Ga0496109_0014298 3300048912 Bacteria 6906
482 Ga0496109_0104222 3300048912 Bacteria 2633
483 Ga0496110_0006575 3300048913 Bacteria 9231
484 Ga0496110_0007902 3300048913 Bacteria 8520
485 Ga0496110_0044048 3300048913 Bacteria 3896
486 Ga0496110_0400401 3300048913 Bacteria 1251
487 Ga0496111_0022467 3300048914 Bacteria 4417
488 Ga0496111_0029133 3300048914 Bacteria 3919
489 Ga0496112_0014731 3300048915 Bacteria 7270
490 Ga0496112_0095576 3300048915 Bacteria 2942
491 Ga0496113_0001073 3300048916 Bacteria 14794
492 Ga0496113_0145229 3300048916 Bacteria 1868
493 Ga0496113_0315195 3300048916 Unclassified 1253
494 Ga0496114_0012875 3300048917 Bacteria 6699
495 Ga0496114_0194213 3300048917 Bacteria 1776
496 Ga0496115_0001125 3300048918 Bacteria 19279
497 Ga0496115_0004469 3300048918 Bacteria 10129
498 Ga0496115_0009006 3300048918 Bacteria 7404
499 Ga0496115_0041379 3300048918 Bacteria 3667
500 Ga0496115_0055996 3300048918 Bacteria 3169
501 Ga0496115_0087575 3300048918 Bacteria 2541
502 Ga0496115_0502397 3300048918 Bacteria 974
503 Ga0496126_0007361 3300048929 Bacteria 12078
504 Ga0501033_0029098 3300049570 Bacteria 4151
505 Ga0501036_0001307 3300049572 Bacteria 19098
506 Ga0501038_0017354 3300049574 Bacteria 6506
507 Ga0501040_0000025 3300049576 Bacteria 67931
508 Ga0501041_0000622 3300049577 Bacteria 18491
509 Ga0501042_0000557 3300049578 Bacteria 19690
510 Ga0501043_0069071 3300049579 Bacteria 2775
511 Ga0501046_0002146 3300049580 Bacteria 18616
512 Ga0501048_0001229 3300049582 Bacteria 19404
513 Ga0501068_0000699 3300049584 Bacteria 17212
514 Ga0501070_0011156 3300049586 Bacteria 7584
515 Ga0501071_0000002 3300049587 Bacteria 101947
516 Ga0501072_0000096 3300049588 Bacteria 64956
517 Ga0501074_0008514 3300049590 Bacteria 7432
518 Ga0501075_0000013 3300049591 Bacteria 80672
519 Ga0501076_0000026 3300049592 Bacteria 78198
520 Ga0501077_0000057 3300049593 Bacteria 56829
521 Ga0501079_0000049 3300049741 Bacteria 51742
522 Ga0501080_0008256 3300049742 Bacteria 9431
523 Ga0501081_0000018 3300049743 Bacteria 56676
524 Ga0501035_0046236 3300049822 Bacteria 3915
525 Ga0501045_0000108 3300049824 Bacteria 41575
526 nmdc:mga00v17_65664_c1 3300050491 Bacteria 2239
527 nmdc:mga05p37_19687_c1 3300050507 Bacteria 8165
528 nmdc:mga05p37_29436_c1 3300050507 Bacteria 6702
529 nmdc:mga05p37_324014_c1 3300050507 Bacteria 1823
530 nmdc:mga05p37_441213_c1 3300050507 Archaea 1510
531 nmdc:mga05p37_496712_c1 3300050507 Bacteria 1402
532 nmdc:mga05p37_511744_c1 3300050507 Bacteria 1375
533 nmdc:mga05p37_715781_c1 3300050507 Bacteria 1110
534 nmdc:mga09592_19502_c1 3300050508 Bacteria 5570
535 nmdc:mga09592_239344_c1 3300050508 Bacteria 1573
536 nmdc:mga09592_345589_c1 3300050508 Bacteria 1288
537 nmdc:mga09592_38643_c1 3300050508 Bacteria 4007
538 nmdc:mga09592_48942_c1 3300050508 Bacteria 3564
539 nmdc:mga09592_574999_c1 3300050508 Unclassified 967
540 nmdc:mga09592_60476_c1 3300050508 Unclassified 3203
541 nmdc:mga0qj67_175563_c1 3300050509 Archaea 1740
542 nmdc:mga0qj67_264993_c1 3300050509 Bacteria 1394
543 nmdc:mga0qj67_41289_c1 3300050509 Bacteria 3628
544 nmdc:mga0qj67_58391_c1 3300050509 Bacteria 3059
545 nmdc:mga0qj67_60060_c1 3300050509 Bacteria 3016
546 nmdc:mga06r32_103597_c1 3300050510 Bacteria 2794
547 nmdc:mga06r32_103963_c1 3300050510 Bacteria 2789
548 nmdc:mga06r32_106000_c1 3300050510 Unclassified 2762
549 nmdc:mga06r32_204444_c1 3300050510 Bacteria 1963
550 nmdc:mga06r32_407973_c1 3300050510 Unclassified 1341
551 nmdc:mga06r32_43682_c1 3300050510 Bacteria 4266
552 nmdc:mga06r32_59289_c1 3300050510 Bacteria 3681
553 nmdc:mga08y16_103085_c1 3300050511 Bacteria 2971
554 nmdc:mga08y16_152866_c1 3300050511 Bacteria 2399
555 nmdc:mga08y16_168471_c1 3300050511 Archaea 2276
556 nmdc:mga08y16_22646_c1 3300050511 Bacteria 6633
557 nmdc:mga08y16_30043_c1 3300050511 Bacteria 5723
558 nmdc:mga08y16_42275_c1 3300050511 Bacteria 4774
559 nmdc:mga08y16_562563_c1 3300050511 Unclassified 1153
560 nmdc:mga08y16_5773_c1 3300050511 Bacteria 12961
561 nmdc:mga08y16_8288_c1 3300050511 Bacteria 10874
562 nmdc:mga0n895_17696_c1 3300050512 Bacteria 6576
563 nmdc:mga0n895_39498_c1 3300050512 Unclassified 4579
564 nmdc:mga0n895_43228_c1 3300050512 Bacteria 4390
565 nmdc:mga0n895_71398_c1 3300050512 Bacteria 3443
566 nmdc:mga0rr50_196703_c1 3300050513 Bacteria 1655
567 nmdc:mga0rr50_248596_c1 3300050513 Unclassified 1476
568 nmdc:mga0rr50_271799_c1 3300050513 Bacteria 1413
569 nmdc:mga0a205_221424_c1 3300050515 Unclassified 1778
570 nmdc:mga0a205_24136_c1 3300050515 Bacteria 5776
571 nmdc:mga0a205_33865_c1 3300050515 Bacteria 4899
572 Ga0495601_0000849 3300053077 Bacteria 16630
573 Ga0495601_0001607 3300053077 Bacteria 12444
574 Ga0495601_0003182 3300053077 Bacteria 9394
575 Ga0495601_0022880 3300053077 Unclassified 3839
576 Ga0495601_0030335 3300053077 Bacteria 3357
577 Ga0495601_0092344 3300053077 Bacteria 1950
578 Ga0495601_0100860 3300053077 Unclassified 1864
579 Ga0495601_0179755 3300053077 Bacteria 1383
580 Ga0495601_0305370 3300053077 Bacteria 1036
581 Ga0495612_0001357 3300053078 Bacteria 10079
582 Ga0495612_0027772 3300053078 Bacteria 2276
583 Ga0495655_0021161 3300053083 Bacteria 1469
584 Ga0495595_0037282 3300053084 Unclassified 2209
585 Ga0495619_0000128 3300053085 Bacteria 55938
586 Ga0495619_0002432 3300053085 Bacteria 12218
587 Ga0495619_0003256 3300053085 Bacteria 10508
588 Ga0495619_0015771 3300053085 Bacteria 4783
589 Ga0495619_0074594 3300053085 Unclassified 2275
590 Ga0495619_0163192 3300053085 Bacteria 1539
591 Ga0495619_0167390 3300053085 Bacteria 1519
592 Ga0495619_0262968 3300053085 Bacteria 1196
593 Ga0501084_0000191 3300054114 Bacteria 47780
594 Ga0501082_0000683 3300060353 Bacteria 29900
595 Ga0530510_0008485 3300061734 Bacteria 7163

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10120594 Ga0157380_101205941 257
2 3300014325 Ga0163163_10329715 Ga0163163_103297151 268
3 3300035695 Ga0373927_0217532 Ga0373927_0217532_154_975 268
4 3300047321 Ga0495676_0188924 Ga0495676_0188924_521_1342 268
5 3300026023 Ga0207677_10052394 Ga0207677_100523944 276
6 3300025906 Ga0207699_10025698 Ga0207699_100256983 284
7 3300025929 Ga0207664_10155563 Ga0207664_101555632 284
8 3300009148 Ga0105243_10002091 Ga0105243_1000209119 285
9 3300005334 Ga0068869_100171182 Ga0068869_1001711822 286
10 3300005341 Ga0070691_10013368 Ga0070691_100133682 286
11 3300005345 Ga0070692_10076185 Ga0070692_100761852 286
12 3300005438 Ga0070701_10091121 Ga0070701_100911212 286
13 3300005440 Ga0070705_100081312 Ga0070705_1000813122 286
14 3300005441 Ga0070700_100228287 Ga0070700_1002282872 286
15 3300005444 Ga0070694_100055482 Ga0070694_1000554823 286
16 3300005459 Ga0068867_100019732 Ga0068867_1000197323 286
17 3300005545 Ga0070695_100068494 Ga0070695_1000684942 286
18 3300005546 Ga0070696_100109237 Ga0070696_1001092372 286
19 3300005549 Ga0070704_100205824 Ga0070704_1002058242 286
20 3300005843 Ga0068860_100128312 Ga0068860_1001283123 286
21 3300009094 Ga0111539_10016150 Ga0111539_1001615012 286
22 3300025935 Ga0207709_10001690 Ga0207709_1000169016 286
23 3300027907 Ga0207428_10014965 Ga0207428_100149651 286
24 3300034817 Ga0373948_0009240 Ga0373948_0009240_650_1555 286
25 3300035121 Ga0373960_0023746 Ga0373960_0023746_192_1097 286
26 3300035691 Ga0373931_0008848 Ga0373931_0008848_2429_3334 286
27 3300049742 Ga0501080_0008256 Ga0501080_0008256_8516_9376 286
28 3300049743 Ga0501081_0000018 Ga0501081_0000018_39928_40788 286
29 3300050511 nmdc:mga08y16_152866_c1 nmdc:mga08y16_152866_c1_523_1428 286
30 3300006844 Ga0075428_100046328 Ga0075428_1000463281 290
31 3300006880 Ga0075429_100003840 Ga0075429_10000384013 290
32 3300009094 Ga0111539_10015907 Ga0111539_100159072 290
33 3300027907 Ga0207428_10073555 Ga0207428_100735552 290
34 3300050511 nmdc:mga08y16_8288_c1 nmdc:mga08y16_8288_c1_3607_4578 290
35 3300048911 Ga0496108_0232738 Ga0496108_0232738_219_1202 291
36 3300005338 Ga0068868_100194829 Ga0068868_1001948291 294
37 3300005455 Ga0070663_100034499 Ga0070663_1000344993 294
38 3300006237 Ga0097621_100079195 Ga0097621_1000791952 294
39 3300035692 Ga0373935_0099411 Ga0373935_0099411_1010_1894 294
40 3300046476 Ga0495662_0039630 Ga0495662_0039630_320_1282 294
41 3300050507 nmdc:mga05p37_324014_c1 nmdc:mga05p37_324014_c1_369_1253 294
42 3300050508 nmdc:mga09592_574999_c1 nmdc:mga09592_574999_c1_59_943 294
43 3300005434 Ga0070709_10247378 Ga0070709_102473781 295
44 3300025906 Ga0207699_10179005 Ga0207699_101790051 295
45 3300005327 Ga0070658_10013344 Ga0070658_100133448 296
46 3300005336 Ga0070680_100012153 Ga0070680_1000121534 296
47 3300005339 Ga0070660_100194610 Ga0070660_1001946102 296
48 3300005458 Ga0070681_10004462 Ga0070681_100044624 296
49 3300005530 Ga0070679_100021543 Ga0070679_1000215432 296
50 3300005563 Ga0068855_100017760 Ga0068855_1000177605 296
51 3300006844 Ga0075428_100246885 Ga0075428_1002468852 296
52 3300006846 Ga0075430_100239586 Ga0075430_1002395862 296
53 3300006847 Ga0075431_100342876 Ga0075431_1003428761 296
54 3300006852 Ga0075433_10035167 Ga0075433_100351674 296
55 3300006871 Ga0075434_100292979 Ga0075434_1002929792 296
56 3300006880 Ga0075429_100142591 Ga0075429_1001425912 296
57 3300009093 Ga0105240_10061524 Ga0105240_100615243 296
58 3300009094 Ga0111539_10333719 Ga0111539_103337191 296
59 3300009147 Ga0114129_10547328 Ga0114129_105473282 296
60 3300021388 Ga0213875_10001694 Ga0213875_1000169413 296
61 3300025917 Ga0207660_10008319 Ga0207660_100083192 296
62 3300025919 Ga0207657_10190157 Ga0207657_101901571 296
63 3300025949 Ga0207667_10018882 Ga0207667_100188824 296
64 3300027907 Ga0207428_10043497 Ga0207428_100434972 296
65 3300037853 Ga0436364_1030895 Ga0436364_1030895_38384_39328 296
66 3300050507 nmdc:mga05p37_441213_c1 nmdc:mga05p37_441213_c1_84_1070 296
67 3300050508 nmdc:mga09592_60476_c1 nmdc:mga09592_60476_c1_1488_2474 296
68 3300050509 nmdc:mga0qj67_175563_c1 nmdc:mga0qj67_175563_c1_84_1070 296
69 3300050510 nmdc:mga06r32_106000_c1 nmdc:mga06r32_106000_c1_1693_2679 296
70 3300050511 nmdc:mga08y16_168471_c1 nmdc:mga08y16_168471_c1_332_1318 296
71 3300050512 nmdc:mga0n895_71398_c1 nmdc:mga0n895_71398_c1_397_1383 296
72 3300050515 nmdc:mga0a205_221424_c1 nmdc:mga0a205_221424_c1_264_1250 296
73 3300005435 Ga0070714_100055028 Ga0070714_1000550281 297
74 3300048907 Ga0496104_0001724 Ga0496104_0001724_1302_2318 297
75 3300048908 Ga0496105_0039513 Ga0496105_0039513_2427_3443 297
76 3300048909 Ga0496106_0086904 Ga0496106_0086904_1042_2058 297
77 3300048911 Ga0496108_0287654 Ga0496108_0287654_434_1414 297
78 3300049570 Ga0501033_0029098 Ga0501033_0029098_102_1076 297
79 3300049572 Ga0501036_0001307 Ga0501036_0001307_4522_5496 297
80 3300049574 Ga0501038_0017354 Ga0501038_0017354_1319_2293 297
81 3300049576 Ga0501040_0000025 Ga0501040_0000025_49141_50115 297
82 3300049577 Ga0501041_0000622 Ga0501041_0000622_3621_4595 297
83 3300049578 Ga0501042_0000557 Ga0501042_0000557_13474_14448 297
84 3300049579 Ga0501043_0069071 Ga0501043_0069071_1251_2225 297
85 3300049580 Ga0501046_0002146 Ga0501046_0002146_3748_4722 297
86 3300049582 Ga0501048_0001229 Ga0501048_0001229_2388_3362 297
87 3300049584 Ga0501068_0000699 Ga0501068_0000699_13506_14480 297
88 3300049586 Ga0501070_0011156 Ga0501070_0011156_672_1646 297
89 3300049587 Ga0501071_0000002 Ga0501071_0000002_19785_20759 297
90 3300049588 Ga0501072_0000096 Ga0501072_0000096_54356_55330 297
91 3300049590 Ga0501074_0008514 Ga0501074_0008514_1050_2024 297
92 3300049591 Ga0501075_0000013 Ga0501075_0000013_4342_5316 297
93 3300049592 Ga0501076_0000026 Ga0501076_0000026_3243_4217 297
94 3300049593 Ga0501077_0000057 Ga0501077_0000057_39800_40774 297
95 3300049741 Ga0501079_0000049 Ga0501079_0000049_37137_38111 297
96 3300049822 Ga0501035_0046236 Ga0501035_0046236_117_1091 297
97 3300049824 Ga0501045_0000108 Ga0501045_0000108_27127_28101 297
98 3300054114 Ga0501084_0000191 Ga0501084_0000191_33332_34306 297
99 3300060353 Ga0501082_0000683 Ga0501082_0000683_14903_15877 297
100 3300061734 Ga0530510_0008485 Ga0530510_0008485_4342_5316 297
101 3300005467 Ga0070706_100055278 Ga0070706_1000552783 298
102 3300025910 Ga0207684_10084803 Ga0207684_100848033 298
103 3300048907 Ga0496104_0298133 Ga0496104_0298133_163_1143 298
104 3300048918 Ga0496115_0055996 Ga0496115_0055996_1116_2096 298
105 3300005336 Ga0070680_100406427 Ga0070680_1004064271 299
106 3300005341 Ga0070691_10061188 Ga0070691_100611881 299
107 3300005457 Ga0070662_100043615 Ga0070662_1000436154 299
108 3300005458 Ga0070681_10032029 Ga0070681_100320294 299
109 3300005530 Ga0070679_100152190 Ga0070679_1001521902 299
110 3300005539 Ga0068853_100461751 Ga0068853_1004617511 299
111 3300005547 Ga0070693_100044105 Ga0070693_1000441053 299
112 3300005937 Ga0081455_10005468 Ga0081455_1000546811 299
113 3300006846 Ga0075430_100238655 Ga0075430_1002386551 299
114 3300006847 Ga0075431_100078296 Ga0075431_1000782963 299
115 3300006852 Ga0075433_10025033 Ga0075433_100250333 299
116 3300006871 Ga0075434_100048599 Ga0075434_1000485992 299
117 3300006880 Ga0075429_100056429 Ga0075429_1000564292 299
118 3300007788 Ga0099795_10056721 Ga0099795_100567211 299
119 3300013297 Ga0157378_10011633 Ga0157378_100116336 299
120 3300014969 Ga0157376_10172255 Ga0157376_101722551 299
121 3300025912 Ga0207707_10012634 Ga0207707_100126347 299
122 3300025917 Ga0207660_10220294 Ga0207660_102202942 299
123 3300025921 Ga0207652_10322077 Ga0207652_103220771 299
124 3300025938 Ga0207704_10325416 Ga0207704_103254161 299
125 3300025941 Ga0207711_10408534 Ga0207711_104085341 299
126 3300026121 Ga0207683_10050910 Ga0207683_100509102 299
127 3300027907 Ga0207428_10015195 Ga0207428_100151955 299
128 3300028381 Ga0268264_10124825 Ga0268264_101248251 299
129 3300035116 Ga0373945_0005488 Ga0373945_0005488_2820_3797 299
130 3300035695 Ga0373927_0118623 Ga0373927_0118623_411_1388 299
131 3300035725 Ga0373947_0055031 Ga0373947_0055031_203_1180 299
132 3300046455 Ga0495603_0018645 Ga0495603_0018645_915_1895 299
133 3300046462 Ga0495651_0102235 Ga0495651_0102235_579_1556 299
134 3300046472 Ga0495580_0055689 Ga0495580_0055689_1293_2273 299
135 3300046473 Ga0495582_0145381 Ga0495582_0145381_311_1288 299
136 3300046476 Ga0495662_0067112 Ga0495662_0067112_481_1458 299
137 3300046477 Ga0495664_0003466 Ga0495664_0003466_5967_6944 299
138 3300046499 Ga0495594_0051048 Ga0495594_0051048_1031_2008 299
139 3300046514 Ga0495618_0152772 Ga0495618_0152772_194_1177 299
140 3300046523 Ga0495644_0010409 Ga0495644_0010409_371_1351 299
141 3300046529 Ga0495652_0031632 Ga0495652_0031632_3116_4093 299
142 3300046531 Ga0495665_0093448 Ga0495665_0093448_432_1415 299
143 3300046543 Ga0495645_0111108 Ga0495645_0111108_864_1841 299
144 3300046642 Ga0495634_0050879 Ga0495634_0050879_1204_2187 299
145 3300046689 Ga0495613_0248516 Ga0495613_0248516_93_1070 299
146 3300047315 Ga0495581_0058903 Ga0495581_0058903_437_1420 299
147 3300047321 Ga0495676_0100272 Ga0495676_0100272_281_1258 299
148 3300047471 Ga0495684_0131754 Ga0495684_0131754_676_1659 299
149 3300048907 Ga0496104_0395429 Ga0496104_0395429_315_1283 299
150 3300048909 Ga0496106_0062967 Ga0496106_0062967_1546_2523 299
151 3300048911 Ga0496108_0334455 Ga0496108_0334455_115_1098 299
152 3300048918 Ga0496115_0041379 Ga0496115_0041379_686_1663 299
153 3300050507 nmdc:mga05p37_496712_c1 nmdc:mga05p37_496712_c1_113_1093 299
154 3300050508 nmdc:mga09592_38643_c1 nmdc:mga09592_38643_c1_2772_3752 299
155 3300050509 nmdc:mga0qj67_60060_c1 nmdc:mga0qj67_60060_c1_344_1324 299
156 3300050510 nmdc:mga06r32_59289_c1 nmdc:mga06r32_59289_c1_616_1596 299
157 3300050511 nmdc:mga08y16_30043_c1 nmdc:mga08y16_30043_c1_113_1093 299
158 3300050512 nmdc:mga0n895_43228_c1 nmdc:mga0n895_43228_c1_310_1290 299
159 3300050513 nmdc:mga0rr50_196703_c1 nmdc:mga0rr50_196703_c1_431_1408 299
160 3300050515 nmdc:mga0a205_24136_c1 nmdc:mga0a205_24136_c1_2711_3691 299
161 3300053077 Ga0495601_0001607 Ga0495601_0001607_703_1680 299
162 3300053085 Ga0495619_0167390 Ga0495619_0167390_424_1407 299
163 3300005329 Ga0070683_100215701 Ga0070683_1002157012 300
164 3300005338 Ga0068868_100071224 Ga0068868_1000712242 300
165 3300005347 Ga0070668_100041834 Ga0070668_1000418343 300
166 3300005354 Ga0070675_100029877 Ga0070675_1000298772 300
167 3300005355 Ga0070671_100107551 Ga0070671_1001075512 300
168 3300005364 Ga0070673_100313614 Ga0070673_1003136141 300
169 3300005367 Ga0070667_100355732 Ga0070667_1003557321 300
170 3300005437 Ga0070710_10043525 Ga0070710_100435251 300
171 3300005437 Ga0070710_10223251 Ga0070710_102232511 300
172 3300005438 Ga0070701_10185759 Ga0070701_101857592 300
173 3300005455 Ga0070663_100012044 Ga0070663_1000120444 300
174 3300005564 Ga0070664_100103957 Ga0070664_1001039572 300
175 3300005615 Ga0070702_100005470 Ga0070702_1000054704 300
176 3300005718 Ga0068866_10061197 Ga0068866_100611972 300
177 3300005719 Ga0068861_100066615 Ga0068861_1000666152 300
178 3300005841 Ga0068863_100062596 Ga0068863_1000625962 300
179 3300005842 Ga0068858_100066971 Ga0068858_1000669715 300
180 3300005843 Ga0068860_100042471 Ga0068860_1000424713 300
181 3300005937 Ga0081455_10100522 Ga0081455_101005222 300
182 3300006038 Ga0075365_10034651 Ga0075365_100346512 300
183 3300006051 Ga0075364_10029649 Ga0075364_100296492 300
184 3300006175 Ga0070712_100000152 Ga0070712_10000015230 300
185 3300006175 Ga0070712_100005090 Ga0070712_1000050904 300
186 3300006175 Ga0070712_100085934 Ga0070712_1000859342 300
187 3300006844 Ga0075428_100067941 Ga0075428_1000679414 300
188 3300006844 Ga0075428_100207343 Ga0075428_1002073433 300
189 3300006881 Ga0068865_100010590 Ga0068865_1000105903 300
190 3300009098 Ga0105245_10055899 Ga0105245_100558992 300
191 3300009147 Ga0114129_10388360 Ga0114129_103883602 300
192 3300009148 Ga0105243_10041858 Ga0105243_100418583 300
193 3300009174 Ga0105241_10205606 Ga0105241_102056061 300
194 3300009177 Ga0105248_10766371 Ga0105248_107663712 300
195 3300009553 Ga0105249_10023992 Ga0105249_100239923 300
196 3300010375 Ga0105239_10195787 Ga0105239_101957872 300
197 3300013296 Ga0157374_10036731 Ga0157374_100367315 300
198 3300013297 Ga0157378_10125604 Ga0157378_101256043 300
199 3300013306 Ga0163162_10021332 Ga0163162_100213324 300
200 3300013308 Ga0157375_10009637 Ga0157375_100096378 300
201 3300014968 Ga0157379_10044185 Ga0157379_100441852 300
202 3300025901 Ga0207688_10015657 Ga0207688_100156574 300
203 3300025908 Ga0207643_10016238 Ga0207643_100162384 300
204 3300025915 Ga0207693_10002719 Ga0207693_1000271912 300
205 3300025915 Ga0207693_10007070 Ga0207693_100070705 300
206 3300025915 Ga0207693_10097444 Ga0207693_100974442 300
207 3300025916 Ga0207663_10123698 Ga0207663_101236982 300
208 3300025918 Ga0207662_10075312 Ga0207662_100753122 300
209 3300025920 Ga0207649_10257503 Ga0207649_102575032 300
210 3300025928 Ga0207700_10262399 Ga0207700_102623992 300
211 3300025938 Ga0207704_10014448 Ga0207704_100144482 300
212 3300025945 Ga0207679_10081531 Ga0207679_100815312 300
213 3300025949 Ga0207667_10629318 Ga0207667_106293181 300
214 3300026067 Ga0207678_10022573 Ga0207678_100225733 300
215 3300026075 Ga0207708_10059417 Ga0207708_100594171 300
216 3300026095 Ga0207676_10343301 Ga0207676_103433012 300
217 3300026118 Ga0207675_100068390 Ga0207675_1000683902 300
218 3300028379 Ga0268266_10463885 Ga0268266_104638852 300
219 3300035118 Ga0373954_0013602 Ga0373954_0013602_458_1360 300
220 3300035410 Ga0373924_0016909 Ga0373924_0016909_379_1281 300
221 3300035724 Ga0373933_0203455 Ga0373933_0203455_323_1225 300
222 3300036401 Ga0373937_0233087 Ga0373937_0233087_547_1560 300
223 3300046454 Ga0495592_0066060 Ga0495592_0066060_789_1691 300
224 3300046462 Ga0495651_0218602 Ga0495651_0218602_64_966 300
225 3300046476 Ga0495662_0035433 Ga0495662_0035433_150_1133 300
226 3300046511 Ga0495608_0072335 Ga0495608_0072335_519_1421 300
227 3300046514 Ga0495618_0022171 Ga0495618_0022171_1474_2376 300
228 3300046516 Ga0495628_0077369 Ga0495628_0077369_1319_2302 300
229 3300046533 Ga0495640_0041097 Ga0495640_0041097_2155_3057 300
230 3300046536 Ga0495587_0026520 Ga0495587_0026520_1525_2427 300
231 3300046559 Ga0495667_0052295 Ga0495667_0052295_471_1373 300
232 3300046615 Ga0495656_0030836 Ga0495656_0030836_218_1207 300
233 3300046642 Ga0495634_0032131 Ga0495634_0032131_1151_2053 300
234 3300046663 Ga0495635_0009786 Ga0495635_0009786_4536_5438 300
235 3300046675 Ga0495657_0017257 Ga0495657_0017257_571_1473 300
236 3300046680 Ga0495646_0069519 Ga0495646_0069519_513_1415 300
237 3300046690 Ga0495624_0076173 Ga0495624_0076173_101_1117 300
238 3300046809 Ga0495600_0087424 Ga0495600_0087424_32_934 300
239 3300047317 Ga0495604_0104267 Ga0495604_0104267_961_1944 300
240 3300047319 Ga0495674_0031831 Ga0495674_0031831_1521_2423 300
241 3300047322 Ga0495680_0134535 Ga0495680_0134535_859_1761 300
242 3300047444 Ga0495675_0025056 Ga0495675_0025056_1818_2720 300
243 3300047471 Ga0495684_0042879 Ga0495684_0042879_1774_2790 300
244 3300047471 Ga0495684_0093406 Ga0495684_0093406_1143_2045 300
245 3300048088 Ga0495602_0048245 Ga0495602_0048245_870_1772 300
246 3300048904 Ga0496101_0049766 Ga0496101_0049766_1139_2122 300
247 3300048905 Ga0496102_0019575 Ga0496102_0019575_3122_4105 300
248 3300048907 Ga0496104_0009159 Ga0496104_0009159_5990_6973 300
249 3300048907 Ga0496104_0036875 Ga0496104_0036875_812_1804 300
250 3300048908 Ga0496105_0015982 Ga0496105_0015982_1859_2842 300
251 3300048908 Ga0496105_0030253 Ga0496105_0030253_2020_3012 300
252 3300048909 Ga0496106_0004487 Ga0496106_0004487_1925_2908 300
253 3300048910 Ga0496107_0010967 Ga0496107_0010967_1887_2870 300
254 3300048911 Ga0496108_0005575 Ga0496108_0005575_7341_8324 300
255 3300048911 Ga0496108_0572872 Ga0496108_0572872_27_929 300
256 3300048912 Ga0496109_0007668 Ga0496109_0007668_1831_2814 300
257 3300048913 Ga0496110_0006575 Ga0496110_0006575_6340_7323 300
258 3300048913 Ga0496110_0400401 Ga0496110_0400401_183_1175 300
259 3300048916 Ga0496113_0145229 Ga0496113_0145229_676_1668 300
260 3300048917 Ga0496114_0194213 Ga0496114_0194213_52_1035 300
261 3300048918 Ga0496115_0001125 Ga0496115_0001125_1925_2908 300
262 3300050491 nmdc:mga00v17_65664_c1 nmdc:mga00v17_65664_c1_1064_2053 300
263 3300050509 nmdc:mga0qj67_41289_c1 nmdc:mga0qj67_41289_c1_2114_3097 300
264 3300050510 nmdc:mga06r32_103597_c1 nmdc:mga06r32_103597_c1_183_1172 300
265 3300050510 nmdc:mga06r32_103963_c1 nmdc:mga06r32_103963_c1_620_1603 300
266 3300053077 Ga0495601_0022880 Ga0495601_0022880_1013_1996 300
267 3300053077 Ga0495601_0092344 Ga0495601_0092344_801_1814 300
268 3300053084 Ga0495595_0037282 Ga0495595_0037282_1097_1999 300
269 3300000043 ARcpr5yngRDRAFT_c000794 ARcpr5yngRDRAFT_0007941 301
270 3300000044 ARSoilOldRDRAFT_c000065 ARSoilOldRDRAFT_00006527 301
271 3300005329 Ga0070683_100032525 Ga0070683_1000325254 301
272 3300005330 Ga0070690_100031526 Ga0070690_1000315261 301
273 3300005331 Ga0070670_100073248 Ga0070670_1000732481 301
274 3300005331 Ga0070670_100174214 Ga0070670_1001742142 301
275 3300005335 Ga0070666_10008838 Ga0070666_100088384 301
276 3300005337 Ga0070682_100029483 Ga0070682_1000294833 301
277 3300005338 Ga0068868_100035011 Ga0068868_1000350114 301
278 3300005339 Ga0070660_100067773 Ga0070660_1000677733 301
279 3300005343 Ga0070687_100014213 Ga0070687_1000142133 301
280 3300005344 Ga0070661_100026196 Ga0070661_1000261963 301
281 3300005353 Ga0070669_100317490 Ga0070669_1003174901 301
282 3300005355 Ga0070671_100017927 Ga0070671_1000179274 301
283 3300005356 Ga0070674_100223071 Ga0070674_1002230712 301
284 3300005365 Ga0070688_100013038 Ga0070688_1000130383 301
285 3300005366 Ga0070659_100247923 Ga0070659_1002479232 301
286 3300005367 Ga0070667_100027719 Ga0070667_1000277193 301
287 3300005434 Ga0070709_10003774 Ga0070709_100037745 301
288 3300005435 Ga0070714_100075294 Ga0070714_1000752942 301
289 3300005435 Ga0070714_100139858 Ga0070714_1001398582 301
290 3300005436 Ga0070713_100000923 Ga0070713_1000009235 301
291 3300005436 Ga0070713_100034040 Ga0070713_1000340403 301
292 3300005436 Ga0070713_100114274 Ga0070713_1001142743 301
293 3300005437 Ga0070710_10001800 Ga0070710_1000180010 301
294 3300005437 Ga0070710_10136407 Ga0070710_101364072 301
295 3300005437 Ga0070710_10190217 Ga0070710_101902171 301
296 3300005439 Ga0070711_100020052 Ga0070711_1000200525 301
297 3300005439 Ga0070711_100089950 Ga0070711_1000899501 301
298 3300005439 Ga0070711_100447851 Ga0070711_1004478511 301
299 3300005455 Ga0070663_100094641 Ga0070663_1000946413 301
300 3300005466 Ga0070685_10019636 Ga0070685_100196365 301
301 3300005467 Ga0070706_100120354 Ga0070706_1001203545 301
302 3300005530 Ga0070679_100107410 Ga0070679_1001074102 301
303 3300005535 Ga0070684_100137545 Ga0070684_1001375452 301
304 3300005535 Ga0070684_100243053 Ga0070684_1002430531 301
305 3300005544 Ga0070686_100013188 Ga0070686_1000131884 301
306 3300005548 Ga0070665_100385802 Ga0070665_1003858022 301
307 3300005564 Ga0070664_100089868 Ga0070664_1000898681 301
308 3300005614 Ga0068856_100310923 Ga0068856_1003109231 301
309 3300005615 Ga0070702_100024201 Ga0070702_1000242014 301
310 3300005617 Ga0068859_100032057 Ga0068859_1000320575 301
311 3300005841 Ga0068863_100015305 Ga0068863_1000153058 301
312 3300005842 Ga0068858_100352348 Ga0068858_1003523482 301
313 3300005843 Ga0068860_100032446 Ga0068860_1000324464 301
314 3300005937 Ga0081455_10001955 Ga0081455_1000195530 301
315 3300005937 Ga0081455_10024203 Ga0081455_100242033 301
316 3300005937 Ga0081455_10156660 Ga0081455_101566602 301
317 3300006028 Ga0070717_10004425 Ga0070717_1000442510 301
318 3300006028 Ga0070717_10007219 Ga0070717_100072199 301
319 3300006058 Ga0075432_10031978 Ga0075432_100319783 301
320 3300006163 Ga0070715_10015983 Ga0070715_100159833 301
321 3300006163 Ga0070715_10045606 Ga0070715_100456061 301
322 3300006173 Ga0070716_100004152 Ga0070716_1000041529 301
323 3300006173 Ga0070716_100097712 Ga0070716_1000977123 301
324 3300006175 Ga0070712_100001612 Ga0070712_1000016122 301
325 3300006175 Ga0070712_100006051 Ga0070712_1000060514 301
326 3300006175 Ga0070712_100007463 Ga0070712_10000746310 301
327 3300006175 Ga0070712_100017046 Ga0070712_1000170463 301
328 3300006175 Ga0070712_100048364 Ga0070712_1000483642 301
329 3300006175 Ga0070712_100107234 Ga0070712_1001072342 301
330 3300006175 Ga0070712_100311454 Ga0070712_1003114541 301
331 3300006194 Ga0075427_10008290 Ga0075427_100082902 301
332 3300006237 Ga0097621_100044921 Ga0097621_1000449212 301
333 3300006237 Ga0097621_100049306 Ga0097621_1000493063 301
334 3300006358 Ga0068871_100006454 Ga0068871_1000064548 301
335 3300006844 Ga0075428_100075063 Ga0075428_1000750632 301
336 3300006844 Ga0075428_100458872 Ga0075428_1004588721 301
337 3300006846 Ga0075430_100103543 Ga0075430_1001035431 301
338 3300006847 Ga0075431_100194443 Ga0075431_1001944431 301
339 3300006847 Ga0075431_100237436 Ga0075431_1002374362 301
340 3300006852 Ga0075433_10157415 Ga0075433_101574153 301
341 3300006871 Ga0075434_100020106 Ga0075434_1000201065 301
342 3300006871 Ga0075434_100263797 Ga0075434_1002637972 301
343 3300006871 Ga0075434_100322650 Ga0075434_1003226502 301
344 3300006871 Ga0075434_100382915 Ga0075434_1003829152 301
345 3300006880 Ga0075429_100126461 Ga0075429_1001264612 301
346 3300006880 Ga0075429_100216177 Ga0075429_1002161772 301
347 3300006880 Ga0075429_100247926 Ga0075429_1002479262 301
348 3300006880 Ga0075429_100371792 Ga0075429_1003717921 301
349 3300006931 Ga0097620_100032057 Ga0097620_1000320573 301
350 3300007076 Ga0075435_100014492 Ga0075435_1000144924 301
351 3300007265 Ga0099794_10011522 Ga0099794_100115222 301
352 3300007265 Ga0099794_10068857 Ga0099794_100688571 301
353 3300009094 Ga0111539_10025469 Ga0111539_1002546911 301
354 3300009094 Ga0111539_10065075 Ga0111539_100650752 301
355 3300009094 Ga0111539_10480413 Ga0111539_104804131 301
356 3300009098 Ga0105245_10005433 Ga0105245_100054332 301
357 3300009098 Ga0105245_10402658 Ga0105245_104026581 301
358 3300009101 Ga0105247_10049357 Ga0105247_100493573 301
359 3300009147 Ga0114129_10068290 Ga0114129_100682905 301
360 3300009147 Ga0114129_10160321 Ga0114129_101603211 301
361 3300009174 Ga0105241_10051972 Ga0105241_100519723 301
362 3300009176 Ga0105242_10016785 Ga0105242_100167855 301
363 3300009176 Ga0105242_10020765 Ga0105242_100207651 301
364 3300009177 Ga0105248_10025971 Ga0105248_100259714 301
365 3300009545 Ga0105237_10054339 Ga0105237_100543392 301
366 3300009551 Ga0105238_10032771 Ga0105238_100327713 301
367 3300009553 Ga0105249_10046888 Ga0105249_100468883 301
368 3300009553 Ga0105249_10137536 Ga0105249_101375361 301
369 3300010375 Ga0105239_10095686 Ga0105239_100956861 301
370 3300010375 Ga0105239_10110462 Ga0105239_101104623 301
371 3300011119 Ga0105246_10027298 Ga0105246_100272983 301
372 3300013104 Ga0157370_10150244 Ga0157370_101502442 301
373 3300013296 Ga0157374_10092945 Ga0157374_100929452 301
374 3300013297 Ga0157378_10019818 Ga0157378_100198182 301
375 3300013306 Ga0163162_10111399 Ga0163162_101113992 301
376 3300013308 Ga0157375_10245606 Ga0157375_102456061 301
377 3300013308 Ga0157375_10688806 Ga0157375_106888062 301
378 3300014325 Ga0163163_10014823 Ga0163163_100148238 301
379 3300014325 Ga0163163_10050054 Ga0163163_100500543 301
380 3300014968 Ga0157379_10019495 Ga0157379_100194954 301
381 3300014969 Ga0157376_10015168 Ga0157376_100151683 301
382 3300014969 Ga0157376_10027383 Ga0157376_100273837 301
383 3300014969 Ga0157376_10072633 Ga0157376_100726334 301
384 3300017792 Ga0163161_10056567 Ga0163161_100565673 301
385 3300017792 Ga0163161_10386990 Ga0163161_103869901 301
386 3300025898 Ga0207692_10017964 Ga0207692_100179643 301
387 3300025898 Ga0207692_10029119 Ga0207692_100291191 301
388 3300025898 Ga0207692_10190285 Ga0207692_101902851 301
389 3300025900 Ga0207710_10016265 Ga0207710_100162652 301
390 3300025903 Ga0207680_10047161 Ga0207680_100471613 301
391 3300025906 Ga0207699_10006751 Ga0207699_100067514 301
392 3300025907 Ga0207645_10014673 Ga0207645_100146733 301
393 3300025910 Ga0207684_10210458 Ga0207684_102104582 301
394 3300025915 Ga0207693_10010191 Ga0207693_100101912 301
395 3300025915 Ga0207693_10010613 Ga0207693_100106138 301
396 3300025915 Ga0207693_10012093 Ga0207693_100120938 301
397 3300025915 Ga0207693_10061411 Ga0207693_100614112 301
398 3300025915 Ga0207693_10228538 Ga0207693_102285382 301
399 3300025916 Ga0207663_10029771 Ga0207663_100297713 301
400 3300025916 Ga0207663_10030742 Ga0207663_100307423 301
401 3300025916 Ga0207663_10262407 Ga0207663_102624072 301
402 3300025924 Ga0207694_10178942 Ga0207694_101789421 301
403 3300025925 Ga0207650_10027179 Ga0207650_100271794 301
404 3300025925 Ga0207650_10195809 Ga0207650_101958093 301
405 3300025927 Ga0207687_10031905 Ga0207687_100319052 301
406 3300025928 Ga0207700_10002289 Ga0207700_100022895 301
407 3300025928 Ga0207700_10124042 Ga0207700_101240423 301
408 3300025928 Ga0207700_10161769 Ga0207700_101617692 301
409 3300025929 Ga0207664_10075598 Ga0207664_100755983 301
410 3300025929 Ga0207664_10123800 Ga0207664_101238002 301
411 3300025931 Ga0207644_10025420 Ga0207644_100254203 301
412 3300025931 Ga0207644_10176433 Ga0207644_101764331 301
413 3300025932 Ga0207690_10188960 Ga0207690_101889602 301
414 3300025933 Ga0207706_10309080 Ga0207706_103090801 301
415 3300025934 Ga0207686_10023983 Ga0207686_100239835 301
416 3300025937 Ga0207669_10186711 Ga0207669_101867112 301
417 3300025938 Ga0207704_10064424 Ga0207704_100644242 301
418 3300025939 Ga0207665_10000223 Ga0207665_1000022340 301
419 3300025939 Ga0207665_10037889 Ga0207665_100378892 301
420 3300025941 Ga0207711_10036147 Ga0207711_100361473 301
421 3300025944 Ga0207661_10052476 Ga0207661_100524763 301
422 3300025945 Ga0207679_10034277 Ga0207679_100342773 301
423 3300025961 Ga0207712_10098067 Ga0207712_100980671 301
424 3300025961 Ga0207712_10155881 Ga0207712_101558812 301
425 3300026023 Ga0207677_10364164 Ga0207677_103641641 301
426 3300026035 Ga0207703_10104985 Ga0207703_101049853 301
427 3300026035 Ga0207703_10311976 Ga0207703_103119761 301
428 3300026067 Ga0207678_10046170 Ga0207678_100461703 301
429 3300026067 Ga0207678_10115428 Ga0207678_101154283 301
430 3300026078 Ga0207702_10107216 Ga0207702_101072163 301
431 3300026088 Ga0207641_10013191 Ga0207641_100131916 301
432 3300026095 Ga0207676_10106741 Ga0207676_101067411 301
433 3300026095 Ga0207676_10305287 Ga0207676_103052871 301
434 3300026121 Ga0207683_10015344 Ga0207683_100153442 301
435 3300027907 Ga0207428_10004670 Ga0207428_1000467018 301
436 3300027907 Ga0207428_10192556 Ga0207428_101925561 301
437 3300028379 Ga0268266_10008517 Ga0268266_100085174 301
438 3300035084 Ga0373928_0036346 Ga0373928_0036346_100_1089 301
439 3300035085 Ga0373929_0002042 Ga0373929_0002042_2290_3195 301
440 3300035089 Ga0373944_0007107 Ga0373944_0007107_13_1002 301
441 3300035111 Ga0373923_0017150 Ga0373923_0017150_1259_2245 301
442 3300035112 Ga0373932_0001123 Ga0373932_0001123_4208_5113 301
443 3300035112 Ga0373932_0020084 Ga0373932_0020084_624_1613 301
444 3300035114 Ga0373939_0001315 Ga0373939_0001315_4107_5012 301
445 3300035115 Ga0373941_0004546 Ga0373941_0004546_358_1263 301
446 3300035116 Ga0373945_0018869 Ga0373945_0018869_588_1577 301
447 3300035116 Ga0373945_0100846 Ga0373945_0100846_87_1073 301
448 3300035121 Ga0373960_0000064 Ga0373960_0000064_13718_14623 301
449 3300035121 Ga0373960_0070309 Ga0373960_0070309_12_998 301
450 3300035170 Ga0373943_0056454 Ga0373943_0056454_183_1169 301
451 3300035171 Ga0373946_0006191 Ga0373946_0006191_1852_2841 301
452 3300035171 Ga0373946_0031331 Ga0373946_0031331_961_1947 301
453 3300035171 Ga0373946_0126969 Ga0373946_0126969_212_1117 301
454 3300035242 Ga0373962_0001185 Ga0373962_0001185_2246_3151 301
455 3300035242 Ga0373962_0014611 Ga0373962_0014611_486_1475 301
456 3300035410 Ga0373924_0062118 Ga0373924_0062118_105_1094 301
457 3300035691 Ga0373931_0001721 Ga0373931_0001721_5921_6826 301
458 3300035691 Ga0373931_0004124 Ga0373931_0004124_5488_6477 301
459 3300035692 Ga0373935_0086318 Ga0373935_0086318_292_1278 301
460 3300035692 Ga0373935_0312671 Ga0373935_0312671_91_1077 301
461 3300035695 Ga0373927_0211941 Ga0373927_0211941_238_1227 301
462 3300035695 Ga0373927_0219795 Ga0373927_0219795_306_1211 301
463 3300035725 Ga0373947_0044438 Ga0373947_0044438_1436_2422 301
464 3300035725 Ga0373947_0123297 Ga0373947_0123297_382_1371 301
465 3300035725 Ga0373947_0253979 Ga0373947_0253979_66_1052 301
466 3300046454 Ga0495592_0020257 Ga0495592_0020257_2853_3842 301
467 3300046459 Ga0495629_0020608 Ga0495629_0020608_2116_3102 301
468 3300046462 Ga0495651_0009655 Ga0495651_0009655_5169_6158 301
469 3300046463 Ga0495653_0019340 Ga0495653_0019340_4419_5405 301
470 3300046463 Ga0495653_0167905 Ga0495653_0167905_473_1462 301
471 3300046473 Ga0495582_0002764 Ga0495582_0002764_808_1797 301
472 3300046475 Ga0495639_0048956 Ga0495639_0048956_236_1225 301
473 3300046476 Ga0495662_0069873 Ga0495662_0069873_473_1462 301
474 3300046477 Ga0495664_0011692 Ga0495664_0011692_2648_3634 301
475 3300046477 Ga0495664_0023314 Ga0495664_0023314_1854_2903 301
476 3300046492 Ga0495585_0151617 Ga0495585_0151617_80_1069 301
477 3300046499 Ga0495594_0082286 Ga0495594_0082286_574_1563 301
478 3300046511 Ga0495608_0063938 Ga0495608_0063938_1179_2168 301
479 3300046514 Ga0495618_0024995 Ga0495618_0024995_1169_2158 301
480 3300046514 Ga0495618_0084634 Ga0495618_0084634_805_1791 301
481 3300046516 Ga0495628_0126344 Ga0495628_0126344_588_1577 301
482 3300046516 Ga0495628_0266185 Ga0495628_0266185_267_1253 301
483 3300046517 Ga0495630_0040874 Ga0495630_0040874_1542_2531 301
484 3300046523 Ga0495644_0042716 Ga0495644_0042716_52_1041 301
485 3300046526 Ga0495666_0026753 Ga0495666_0026753_997_1986 301
486 3300046529 Ga0495652_0069543 Ga0495652_0069543_1854_2843 301
487 3300046531 Ga0495665_0084196 Ga0495665_0084196_603_1592 301
488 3300046533 Ga0495640_0017049 Ga0495640_0017049_3673_4659 301
489 3300046533 Ga0495640_0042267 Ga0495640_0042267_1529_2578 301
490 3300046533 Ga0495640_0081061 Ga0495640_0081061_993_1982 301
491 3300046533 Ga0495640_0099625 Ga0495640_0099625_903_1889 301
492 3300046535 Ga0495586_0164365 Ga0495586_0164365_50_1036 301
493 3300046536 Ga0495587_0044014 Ga0495587_0044014_1009_1998 301
494 3300046559 Ga0495667_0004013 Ga0495667_0004013_7103_8092 301
495 3300046642 Ga0495634_0024631 Ga0495634_0024631_2792_3778 301
496 3300046642 Ga0495634_0041018 Ga0495634_0041018_658_1644 301
497 3300046642 Ga0495634_0152320 Ga0495634_0152320_260_1249 301
498 3300046642 Ga0495634_0233586 Ga0495634_0233586_128_1117 301
499 3300046663 Ga0495635_0034221 Ga0495635_0034221_1565_2551 301
500 3300046663 Ga0495635_0053526 Ga0495635_0053526_650_1699 301
501 3300046663 Ga0495635_0095729 Ga0495635_0095729_344_1333 301
502 3300046674 Ga0495588_0086635 Ga0495588_0086635_550_1536 301
503 3300046681 Ga0495647_0034188 Ga0495647_0034188_331_1317 301
504 3300046683 Ga0495658_0088135 Ga0495658_0088135_832_1821 301
505 3300046683 Ga0495658_0192908 Ga0495658_0192908_221_1207 301
506 3300046689 Ga0495613_0079701 Ga0495613_0079701_991_1980 301
507 3300046690 Ga0495624_0026957 Ga0495624_0026957_2715_3701 301
508 3300046809 Ga0495600_0047376 Ga0495600_0047376_905_1894 301
509 3300047319 Ga0495674_0001877 Ga0495674_0001877_8784_9770 301
510 3300047319 Ga0495674_0005000 Ga0495674_0005000_8399_9388 301
511 3300047319 Ga0495674_0008643 Ga0495674_0008643_2901_3950 301
512 3300047321 Ga0495676_0097020 Ga0495676_0097020_1260_2165 301
513 3300047322 Ga0495680_0015575 Ga0495680_0015575_4118_5107 301
514 3300047322 Ga0495680_0150848 Ga0495680_0150848_12_998 301
515 3300047322 Ga0495680_0213292 Ga0495680_0213292_16_1002 301
516 3300047471 Ga0495684_0023821 Ga0495684_0023821_2708_3697 301
517 3300047471 Ga0495684_0049472 Ga0495684_0049472_922_1908 301
518 3300047471 Ga0495684_0203340 Ga0495684_0203340_22_957 301
519 3300047673 Ga0495593_0004152 Ga0495593_0004152_1695_2684 301
520 3300047673 Ga0495593_0045830 Ga0495593_0045830_342_1328 301
521 3300048089 Ga0495614_0006790 Ga0495614_0006790_3660_4649 301
522 3300048903 Ga0496100_0015805 Ga0496100_0015805_2212_3198 301
523 3300048904 Ga0496101_0017030 Ga0496101_0017030_657_1643 301
524 3300048904 Ga0496101_0132060 Ga0496101_0132060_70_1062 301
525 3300048905 Ga0496102_0024115 Ga0496102_0024115_549_1535 301
526 3300048905 Ga0496102_0111189 Ga0496102_0111189_1561_2466 301
527 3300048905 Ga0496102_0288895 Ga0496102_0288895_219_1208 301
528 3300048907 Ga0496104_0004332 Ga0496104_0004332_8252_9238 301
529 3300048907 Ga0496104_0009515 Ga0496104_0009515_1633_2538 301
530 3300048907 Ga0496104_0088807 Ga0496104_0088807_661_1650 301
531 3300048907 Ga0496104_0096179 Ga0496104_0096179_1404_2390 301
532 3300048907 Ga0496104_0471638 Ga0496104_0471638_125_1114 301
533 3300048908 Ga0496105_0037882 Ga0496105_0037882_1492_2397 301
534 3300048909 Ga0496106_0010963 Ga0496106_0010963_2487_3488 301
535 3300048910 Ga0496107_0003431 Ga0496107_0003431_7690_8691 301
536 3300048910 Ga0496107_0018111 Ga0496107_0018111_3877_4863 301
537 3300048911 Ga0496108_0003735 Ga0496108_0003735_3060_3965 301
538 3300048911 Ga0496108_0420934 Ga0496108_0420934_53_1042 301
539 3300048912 Ga0496109_0009387 Ga0496109_0009387_1639_2544 301
540 3300048912 Ga0496109_0011242 Ga0496109_0011242_592_1578 301
541 3300048912 Ga0496109_0014298 Ga0496109_0014298_5753_6754 301
542 3300048912 Ga0496109_0104222 Ga0496109_0104222_200_1189 301
543 3300048913 Ga0496110_0007902 Ga0496110_0007902_6025_6930 301
544 3300048913 Ga0496110_0044048 Ga0496110_0044048_2855_3844 301
545 3300048914 Ga0496111_0022467 Ga0496111_0022467_2589_3578 301
546 3300048914 Ga0496111_0029133 Ga0496111_0029133_2413_3414 301
547 3300048915 Ga0496112_0014731 Ga0496112_0014731_1633_2538 301
548 3300048915 Ga0496112_0095576 Ga0496112_0095576_361_1350 301
549 3300048916 Ga0496113_0001073 Ga0496113_0001073_12251_13156 301
550 3300048916 Ga0496113_0315195 Ga0496113_0315195_226_1227 301
551 3300048917 Ga0496114_0012875 Ga0496114_0012875_5136_6125 301
552 3300048918 Ga0496115_0004469 Ga0496115_0004469_1316_2302 301
553 3300048918 Ga0496115_0009006 Ga0496115_0009006_4051_5052 301
554 3300048918 Ga0496115_0087575 Ga0496115_0087575_245_1234 301
555 3300048918 Ga0496115_0502397 Ga0496115_0502397_27_932 301
556 3300048929 Ga0496126_0007361 Ga0496126_0007361_6655_7644 301
557 3300050507 nmdc:mga05p37_19687_c1 nmdc:mga05p37_19687_c1_1123_2112 301
558 3300050507 nmdc:mga05p37_29436_c1 nmdc:mga05p37_29436_c1_5525_6514 301
559 3300050507 nmdc:mga05p37_511744_c1 nmdc:mga05p37_511744_c1_183_1181 301
560 3300050507 nmdc:mga05p37_715781_c1 nmdc:mga05p37_715781_c1_31_1020 301
561 3300050508 nmdc:mga09592_19502_c1 nmdc:mga09592_19502_c1_158_1147 301
562 3300050508 nmdc:mga09592_239344_c1 nmdc:mga09592_239344_c1_201_1190 301
563 3300050508 nmdc:mga09592_345589_c1 nmdc:mga09592_345589_c1_208_1209 301
564 3300050508 nmdc:mga09592_48942_c1 nmdc:mga09592_48942_c1_463_1452 301
565 3300050509 nmdc:mga0qj67_264993_c1 nmdc:mga0qj67_264993_c1_166_1155 301
566 3300050509 nmdc:mga0qj67_58391_c1 nmdc:mga0qj67_58391_c1_219_1220 301
567 3300050510 nmdc:mga06r32_204444_c1 nmdc:mga06r32_204444_c1_258_1247 301
568 3300050510 nmdc:mga06r32_407973_c1 nmdc:mga06r32_407973_c1_173_1162 301
569 3300050510 nmdc:mga06r32_43682_c1 nmdc:mga06r32_43682_c1_383_1372 301
570 3300050511 nmdc:mga08y16_103085_c1 nmdc:mga08y16_103085_c1_1795_2784 301
571 3300050511 nmdc:mga08y16_22646_c1 nmdc:mga08y16_22646_c1_1740_2729 301
572 3300050511 nmdc:mga08y16_42275_c1 nmdc:mga08y16_42275_c1_3695_4684 301
573 3300050511 nmdc:mga08y16_562563_c1 nmdc:mga08y16_562563_c1_28_1017 301
574 3300050511 nmdc:mga08y16_5773_c1 nmdc:mga08y16_5773_c1_565_1470 301
575 3300050512 nmdc:mga0n895_17696_c1 nmdc:mga0n895_17696_c1_1080_2069 301
576 3300050512 nmdc:mga0n895_39498_c1 nmdc:mga0n895_39498_c1_3540_4529 301
577 3300050513 nmdc:mga0rr50_248596_c1 nmdc:mga0rr50_248596_c1_75_1061 301
578 3300050513 nmdc:mga0rr50_271799_c1 nmdc:mga0rr50_271799_c1_178_1167 301
579 3300050515 nmdc:mga0a205_33865_c1 nmdc:mga0a205_33865_c1_3579_4568 301
580 3300053077 Ga0495601_0000849 Ga0495601_0000849_4506_5492 301
581 3300053077 Ga0495601_0003182 Ga0495601_0003182_2613_3662 301
582 3300053077 Ga0495601_0030335 Ga0495601_0030335_1319_2308 301
583 3300053077 Ga0495601_0100860 Ga0495601_0100860_249_1238 301
584 3300053077 Ga0495601_0179755 Ga0495601_0179755_117_1103 301
585 3300053077 Ga0495601_0305370 Ga0495601_0305370_37_984 301
586 3300053078 Ga0495612_0001357 Ga0495612_0001357_3135_4184 301
587 3300053078 Ga0495612_0027772 Ga0495612_0027772_534_1520 301
588 3300053083 Ga0495655_0021161 Ga0495655_0021161_164_1156 301
589 3300053085 Ga0495619_0000128 Ga0495619_0000128_3281_4330 301
590 3300053085 Ga0495619_0002432 Ga0495619_0002432_1049_2035 301
591 3300053085 Ga0495619_0003256 Ga0495619_0003256_4253_5242 301
592 3300053085 Ga0495619_0015771 Ga0495619_0015771_3405_4394 301
593 3300053085 Ga0495619_0074594 Ga0495619_0074594_1202_2188 301
594 3300053085 Ga0495619_0163192 Ga0495619_0163192_134_1120 301
595 3300053085 Ga0495619_0262968 Ga0495619_0262968_23_970 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

76

366

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9192 2 300
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9154 2 299
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9104 2 300
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9063 4 300
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9037 2 299
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8659 123 300 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8657 123 299 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8495 123 300 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8435 123 299 3.40.50.2300
3e61A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8369 4 91 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537RBB7-F1-model_v4 ABC transporter substrate-binding protein 0.9831 1 87
AF-A0A537SGS6-F1-model_v4 ABC transporter substrate-binding protein 0.9821 1 301
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9808 195 301
AF-A0A537SGS6-F1-model_v4 ABC transporter substrate-binding protein 0.9789 1 301
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9785 194 301

Feature Viewer

pLDDT pTM Quality
95.08 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map