F467455

General Info

Members Datasets Scaffolds Average Seq Length
595 332 1190 206

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10209358|Ga0307414_102093582
Length 228
Sequence MKPKIIMSNTSDKSIGLMDDKTQKFTEEENEGYLKIDRYNEDKIATIATHYKDILFQIGENPEREGLHKTPERVAKALQFLTHGYDADPEQILRSAMFKEEYSQMVVVKDIEVFSMCEHHMLPFFGKAHIAYIPNGHIVGLSKIPRVVDAFARRLQVQERLTNEIRDCIQKTLNPAGVAVVIECKHLCMSMRGIQKQNSVTTTSAFTGEFAQDKTRAEFLRLITANLH

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
169 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
170 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
171 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
265 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
266 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
267 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
287 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
288 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
293 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
294 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
295 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
296 2738541283 Pedobacter sp. OK701 Isolate Unclassified
297 2738541284 Pedobacter sp. YR016 Isolate Unclassified
298 2738541302 Pedobacter sp. CF074 Isolate Unclassified
299 2738543023 Pedobacter sp. OK628 Isolate Unclassified
300 2739367651 Pedobacter sp. OK291 Isolate Unclassified
301 2739367656 Pedobacter sp. CF523 Isolate Unclassified
302 2739367663 Pedobacter sp. YR510 Isolate Unclassified
303 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
304 2818991437 Pedobacter terrae 518 Isolate Unclassified
305 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
306 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
307 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
308 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
309 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
310 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
311 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
312 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
313 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
314 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
315 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
316 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
317 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
318 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
319 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
320 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
321 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
322 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
323 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
324 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
325 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
326 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
327 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
328 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
329 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
330 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
331 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
332 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0.67
Isolates 6.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 0.5
Rhizosphere 85.55
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10209358 3300032004 Bacteria 1592
2 SwRhRL2b_contig_3308433 2162886007 Bacteria 12186
3 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
4 JGI24736J21556_1000812 3300001904 Bacteria 5763
5 JGI24736J21556_1001942 3300001904 Bacteria 3678
6 JGI24740J21852_10012653 3300001979 Bacteria 3174
7 JGI24739J22299_10001457 3300001989 Bacteria 8917
8 JGI24737J22298_10000852 3300001990 Bacteria 10878
9 JGI24737J22298_10001745 3300001990 Bacteria 7761
10 JGI24737J22298_10002702 3300001990 Bacteria 6273
11 JGI24737J22298_10015372 3300001990 Bacteria 2477
12 JGI24737J22298_10024646 3300001990 Bacteria 1905
13 JGI24735J21928_10000027 3300002067 Bacteria 83494
14 JGI24735J21928_10015914 3300002067 Bacteria 2341
15 JGI24751J29686_10000772 3300002459 Bacteria 7557
16 JGI25157J39369_1002704 3300002741 Bacteria 4111
17 JGI25164J39214_1001144 3300002772 Bacteria 7484
18 JGI25152J39213_1000043 3300002773 Bacteria 87508
19 JGI25150J39212_1000023 3300002774 Bacteria 130663
20 JGI25151J46595_10000082 3300003187 Bacteria 130832
21 JGI25165J46597_1001050 3300003214 Bacteria 17908
22 JGI25165J46597_1008856 3300003214 Bacteria 1548
23 JGI25153J46596_10000060 3300003215 Bacteria 131744
24 rootH1_10031584 3300003316 Bacteria 16796
25 rootH2_10001273 3300003320 Bacteria 179792
26 rootH2_10114261 3300003320 Bacteria 1972
27 rootL2_10020975 3300003322 Bacteria 6506
28 rootH1_10024310 3300003323 Bacteria 54858
29 rootH1_10083498 3300003323 Bacteria 4553
30 rootH1_10124986 3300003323 Bacteria 2534
31 rootH1_10233543 3300003323 Bacteria 4367
32 Ga0055536_1000002 3300003781 Bacteria 605605
33 Ga0055530_10000739 3300003791 Bacteria 27214
34 Ga0058863_11920979 3300004799 Bacteria 3023
35 Ga0058862_12833523 3300004803 Bacteria 2412
36 Ga0065714_10002980 3300005288 Bacteria 14261
37 Ga0065714_10003630 3300005288 Bacteria 23830
38 Ga0065714_10004446 3300005288 Bacteria 6584
39 Ga0065714_10064525 3300005288 Bacteria 41731
40 Ga0065714_10080235 3300005288 Bacteria 2414
41 Ga0065704_10000206 3300005289 Bacteria 121672
42 Ga0065704_10099903 3300005289 Bacteria 2293
43 Ga0065704_10166991 3300005289 Bacteria 1316
44 Ga0065704_10333564 3300005289 Bacteria 834
45 Ga0070658_10111073 3300005327 Bacteria 2271
46 Ga0070658_10226211 3300005327 Bacteria 1583
47 Ga0070658_10259587 3300005327 Bacteria 1475
48 Ga0070676_10014740 3300005328 Bacteria 4300
49 Ga0070683_100008086 3300005329 Bacteria 8932
50 Ga0070670_100008042 3300005331 Bacteria 8971
51 Ga0070670_100193626 3300005331 Bacteria 1766
52 Ga0070670_100465243 3300005331 Bacteria 1122
53 Ga0070680_100247464 3300005336 Bacteria 1507
54 Ga0070680_100413117 3300005336 Bacteria 1151
55 Ga0068868_100047960 3300005338 Bacteria 3350
56 Ga0070660_100049784 3300005339 Bacteria 3222
57 Ga0070660_100363636 3300005339 Bacteria 1193
58 Ga0070689_100327777 3300005340 Bacteria 1280
59 Ga0070689_100677490 3300005340 Bacteria 899
60 Ga0070674_100016874 3300005356 Bacteria 4582
61 Ga0070673_100026225 3300005364 Bacteria 4302
62 Ga0070688_100335239 3300005365 Bacteria 1103
63 Ga0070659_100000412 3300005366 Bacteria 32519
64 Ga0070659_100040361 3300005366 Bacteria 3646
65 Ga0070667_100467059 3300005367 Bacteria 1154
66 Ga0070700_100311417 3300005441 Bacteria 1153
67 Ga0070700_100745457 3300005441 Bacteria 783
68 Ga0070663_100014280 3300005455 Bacteria 5094
69 Ga0070678_100007878 3300005456 Bacteria 6340
70 Ga0070662_100000468 3300005457 Bacteria 24024
71 Ga0070681_10000627 3300005458 Bacteria 28983
72 Ga0070681_10125196 3300005458 Bacteria 2502
73 Ga0068867_100004302 3300005459 Bacteria 10024
74 Ga0068867_100977383 3300005459 Bacteria 766
75 Ga0070707_100133283 3300005468 Bacteria 2416
76 Ga0070707_100309700 3300005468 Bacteria 1535
77 Ga0070698_100229296 3300005471 Bacteria 1790
78 Ga0070699_100050734 3300005518 Bacteria 3592
79 Ga0070679_100006243 3300005530 Bacteria 11102
80 Ga0070679_100040127 3300005530 Bacteria 4657
81 Ga0070679_100141289 3300005530 Bacteria 2387
82 Ga0070684_100423450 3300005535 Bacteria 1229
83 Ga0070684_100991513 3300005535 Bacteria 788
84 Ga0068853_100039336 3300005539 Bacteria 4033
85 Ga0068853_100231655 3300005539 Bacteria 1690
86 Ga0068853_100428574 3300005539 Bacteria 1241
87 Ga0070672_100191686 3300005543 Bacteria 1707
88 Ga0070693_100597344 3300005547 Bacteria 796
89 Ga0070665_100000118 3300005548 Bacteria 149830
90 Ga0070704_100000050 3300005549 Bacteria 38334
91 Ga0070704_100998476 3300005549 Bacteria 757
92 Ga0068855_100000958 3300005563 Bacteria 35849
93 Ga0068855_100008698 3300005563 Bacteria 12273
94 Ga0068855_100019618 3300005563 Bacteria 8121
95 Ga0068855_100091183 3300005563 Bacteria 3516
96 Ga0068855_100109018 3300005563 Bacteria 3180
97 Ga0068855_100381016 3300005563 Bacteria 1549
98 Ga0068854_100117651 3300005578 Bacteria 2013
99 Ga0068856_100000006 3300005614 Bacteria 223827
100 Ga0068856_100050674 3300005614 Bacteria 4093
101 Ga0068852_100000720 3300005616 Bacteria 21705
102 Ga0068852_100386360 3300005616 Bacteria 1374
103 Ga0068864_100079743 3300005618 Bacteria 2867
104 Ga0068866_10002584 3300005718 Bacteria 7472
105 Ga0068866_10172763 3300005718 Bacteria 1270
106 Ga0068866_10208103 3300005718 Bacteria 1173
107 Ga0068861_100205966 3300005719 Unclassified 1654
108 Ga0068861_100546056 3300005719 Bacteria 1055
109 Ga0068863_100340770 3300005841 Bacteria 1458
110 Ga0068858_100351757 3300005842 Bacteria 1411
111 Ga0068860_101546838 3300005843 Bacteria 685
112 Ga0075366_10014581 3300006195 Bacteria 4490
113 Ga0075366_10042954 3300006195 Bacteria 2677
114 Ga0097621_100000285 3300006237 Bacteria 34046
115 Ga0097621_100340497 3300006237 Bacteria 1332
116 Ga0097621_100612460 3300006237 Bacteria 996
117 Ga0068871_100000080 3300006358 Bacteria 53930
118 Ga0075430_100047773 3300006846 Bacteria 3614
119 Ga0075431_100008882 3300006847 Bacteria 10068
120 Ga0075431_100551069 3300006847 Bacteria 1140
121 Ga0075434_100000318 3300006871 Bacteria 34363
122 Ga0075429_100055559 3300006880 Bacteria 3445
123 Ga0068865_100000218 3300006881 Bacteria 31890
124 Ga0075436_100015330 3300006914 Bacteria 5252
125 Ga0075436_100019266 3300006914 Bacteria 4676
126 Ga0075435_100003168 3300007076 Bacteria 11124
127 Ga0105244_10042625 3300009036 Bacteria 2345
128 Ga0105240_10048169 3300009093 Bacteria 5388
129 Ga0105240_10097171 3300009093 Bacteria 3589
130 Ga0105240_10152098 3300009093 Bacteria 2755
131 Ga0105240_10186200 3300009093 Bacteria 2445
132 Ga0105240_10191749 3300009093 Bacteria 2403
133 Ga0105240_10216578 3300009093 Bacteria 2234
134 Ga0105240_10310454 3300009093 Bacteria 1801
135 Ga0105240_10397261 3300009093 Bacteria 1554
136 Ga0105240_10643183 3300009093 Bacteria 1163
137 Ga0105240_10675164 3300009093 Bacteria 1130
138 Ga0105240_10901263 3300009093 Bacteria 951
139 Ga0105240_10996881 3300009093 Bacteria 896
140 Ga0111539_10014062 3300009094 Bacteria 10002
141 Ga0111539_11293396 3300009094 Bacteria 846
142 Ga0105243_10000046 3300009148 Bacteria 155277
143 Ga0105243_10314960 3300009148 Bacteria 1423
144 Ga0105241_10000999 3300009174 Bacteria 21432
145 Ga0105241_10474511 3300009174 Bacteria 1111
146 Ga0105242_10002835 3300009176 Bacteria 13581
147 Ga0105242_10349946 3300009176 Unclassified 1364
148 Ga0105237_10000088 3300009545 Bacteria 124518
149 Ga0105237_10002840 3300009545 Bacteria 21062
150 Ga0105237_10003145 3300009545 Bacteria 19862
151 Ga0105237_10004869 3300009545 Bacteria 15388
152 Ga0105237_10023283 3300009545 Bacteria 6348
153 Ga0105237_10232232 3300009545 Bacteria 1845
154 Ga0105237_10410378 3300009545 Bacteria 1359
155 Ga0105238_10003441 3300009551 Bacteria 15759
156 Ga0105238_10081249 3300009551 Bacteria 3230
157 Ga0105238_10476982 3300009551 Bacteria 1246
158 Ga0105249_10006600 3300009553 Bacteria 10096
159 Ga0105249_11222409 3300009553 Bacteria 822
160 Ga0105239_10000008 3300010375 Bacteria 376925
161 Ga0105239_10000115 3300010375 Bacteria 113217
162 Ga0105239_10002115 3300010375 Bacteria 25648
163 Ga0105239_10002395 3300010375 Bacteria 23910
164 Ga0105239_10008252 3300010375 Bacteria 11878
165 Ga0105239_10014398 3300010375 Bacteria 8776
166 Ga0105239_10239007 3300010375 Bacteria 2039
167 Ga0105239_10674133 3300010375 Bacteria 1181
168 Ga0105239_10680154 3300010375 Bacteria 1176
169 Ga0105246_10302210 3300011119 Bacteria 1292
170 Ga0105246_10640219 3300011119 Bacteria 924
171 Ga0157373_10000376 3300013100 Bacteria 35743
172 Ga0157373_10000486 3300013100 Bacteria 31473
173 Ga0157373_10000546 3300013100 Bacteria 29458
174 Ga0157373_10042194 3300013100 Bacteria 3261
175 Ga0157373_10405367 3300013100 Bacteria 978
176 Ga0157371_10000151 3300013102 Bacteria 101401
177 Ga0157371_10000888 3300013102 Bacteria 33749
178 Ga0157371_10001401 3300013102 Bacteria 25151
179 Ga0157371_10001845 3300013102 Bacteria 21336
180 Ga0157371_10005485 3300013102 Bacteria 10684
181 Ga0157371_10023303 3300013102 Bacteria 4527
182 Ga0157371_10366364 3300013102 Bacteria 1051
183 Ga0157370_10000597 3300013104 Bacteria 45043
184 Ga0157370_10006731 3300013104 Bacteria 12608
185 Ga0157370_10017828 3300013104 Bacteria 7155
186 Ga0157370_10069775 3300013104 Bacteria 3319
187 Ga0157370_10070205 3300013104 Bacteria 3307
188 Ga0157370_10089848 3300013104 Bacteria 2885
189 Ga0157370_10110214 3300013104 Bacteria 2573
190 Ga0157370_10136766 3300013104 Bacteria 2283
191 Ga0157370_10263023 3300013104 Bacteria 1594
192 Ga0157370_10409702 3300013104 Bacteria 1247
193 Ga0157370_10486180 3300013104 Bacteria 1134
194 Ga0157370_10501905 3300013104 Bacteria 1114
195 Ga0157369_10000101 3300013105 Bacteria 118683
196 Ga0157369_10021519 3300013105 Bacteria 7214
197 Ga0157369_10096977 3300013105 Bacteria 3145
198 Ga0157369_10101557 3300013105 Bacteria 3065
199 Ga0157369_10131283 3300013105 Bacteria 2654
200 Ga0157369_10708961 3300013105 Bacteria 1036
201 Ga0157369_10742467 3300013105 Bacteria 1010
202 Ga0157374_10000741 3300013296 Bacteria 28443
203 Ga0157374_10001208 3300013296 Bacteria 22108
204 Ga0157374_10038994 3300013296 Bacteria 4370
205 Ga0157374_10223725 3300013296 Bacteria 1847
206 Ga0157374_10302577 3300013296 Bacteria 1582
207 Ga0157378_10017834 3300013297 Bacteria 6232
208 Ga0157378_10222586 3300013297 Bacteria 1794
209 Ga0163162_10000011 3300013306 Bacteria 299877
210 Ga0163162_10000012 3300013306 Bacteria 292674
211 Ga0163162_10006625 3300013306 Bacteria 11224
212 Ga0163162_10025616 3300013306 Bacteria 5830
213 Ga0163162_10228148 3300013306 Bacteria 1992
214 Ga0157372_10000041 3300013307 Bacteria 158494
215 Ga0157372_10000199 3300013307 Bacteria 66101
216 Ga0157372_10000538 3300013307 Bacteria 41695
217 Ga0157372_10007865 3300013307 Bacteria 11331
218 Ga0157375_10064342 3300013308 Bacteria 3651
219 Ga0157375_10156528 3300013308 Bacteria 2418
220 Ga0157375_10206292 3300013308 Bacteria 2122
221 Ga0157375_10251304 3300013308 Bacteria 1929
222 Ga0157375_11170978 3300013308 Bacteria 901
223 Ga0163163_10207919 3300014325 Bacteria 2006
224 Ga0163163_10461653 3300014325 Bacteria 1330
225 Ga0163163_10664547 3300014325 Bacteria 1105
226 Ga0157380_10039114 3300014326 Bacteria 3687
227 Ga0182008_10000020 3300014497 Bacteria 228333
228 Ga0182008_10000296 3300014497 Bacteria 39012
229 Ga0182008_10000342 3300014497 Bacteria 36331
230 Ga0182008_10138260 3300014497 Bacteria 1217
231 Ga0182008_10247581 3300014497 Bacteria 919
232 Ga0157379_10086604 3300014968 Bacteria 2809
233 Ga0157376_10090563 3300014969 Bacteria 2647
234 Ga0157376_10637486 3300014969 Bacteria 1065
235 Ga0182006_1000242 3300015261 Bacteria 50864
236 Ga0182006_1000310 3300015261 Bacteria 42614
237 Ga0182006_1000735 3300015261 Bacteria 22520
238 Ga0182006_1005572 3300015261 Bacteria 5979
239 Ga0182006_1022335 3300015261 Bacteria 2632
240 Ga0182007_10008621 3300015262 Bacteria 4173
241 Ga0182007_10062468 3300015262 Bacteria 1221
242 Ga0183373_1002 3300015682 Bacteria 990153
243 Ga0163161_10000330 3300017792 Bacteria 40454
244 Ga0163161_10000565 3300017792 Bacteria 29834
245 Ga0163161_10002836 3300017792 Bacteria 12297
246 Ga0163161_10062000 3300017792 Bacteria 2723
247 Ga0163161_10067561 3300017792 Bacteria 2611
248 Ga0163161_10073200 3300017792 Bacteria 2510
249 Ga0163161_10173456 3300017792 Bacteria 1650
250 Ga0206351_10221156 3300020077 Bacteria 1747
251 Ga0213872_10002511 3300021361 Bacteria 10719
252 Ga0213876_10002643 3300021384 Bacteria 10472
253 Ga0209563_106202 3300025230 Bacteria 2075
254 Ga0207427_100072 3300025231 Bacteria 158364
255 Ga0209437_100026 3300025233 Bacteria 542698
256 Ga0209437_100144 3300025233 Bacteria 164794
257 Ga0207425_1000051 3300025245 Bacteria 166795
258 Ga0209026_1000246 3300025250 Bacteria 69164
259 Ga0209026_1001159 3300025250 Bacteria 12323
260 Ga0209026_1003618 3300025250 Bacteria 4967
261 Ga0209129_1000121 3300025258 Bacteria 135404
262 Ga0209129_1012439 3300025258 Bacteria 1952
263 Ga0209233_1000111 3300025261 Bacteria 260262
264 Ga0209233_1002603 3300025261 Bacteria 6554
265 Ga0209233_1012503 3300025261 Bacteria 2463
266 Ga0209455_1002153 3300025272 Bacteria 7807
267 Ga0209676_1000022 3300025292 Bacteria 605659
268 Ga0209025_1000160 3300025294 Bacteria 166795
269 Ga0209758_1000147 3300025297 Bacteria 166795
270 Ga0209050_1000020 3300025298 Bacteria 605671
271 Ga0209051_1086543 3300025303 Bacteria 886
272 Ga0207642_10018419 3300025899 Bacteria 2680
273 Ga0207642_10166460 3300025899 Bacteria 1189
274 Ga0207647_10000049 3300025904 Bacteria 88392
275 Ga0207647_10000103 3300025904 Bacteria 65792
276 Ga0207647_10116372 3300025904 Bacteria 1578
277 Ga0207645_10000398 3300025907 Bacteria 35913
278 Ga0207705_10000026 3300025909 Bacteria 256051
279 Ga0207705_10049489 3300025909 Bacteria 3024
280 Ga0207705_10229116 3300025909 Bacteria 1413
281 Ga0207684_10395995 3300025910 Bacteria 1187
282 Ga0207654_10075439 3300025911 Bacteria 2015
283 Ga0207707_10010987 3300025912 Bacteria 7877
284 Ga0207695_10007414 3300025913 Bacteria 13973
285 Ga0207695_10015443 3300025913 Bacteria 8988
286 Ga0207695_10092143 3300025913 Bacteria 3041
287 Ga0207695_10097954 3300025913 Bacteria 2932
288 Ga0207695_10185343 3300025913 Bacteria 2000
289 Ga0207695_10383123 3300025913 Bacteria 1292
290 Ga0207695_10416484 3300025913 Bacteria 1228
291 Ga0207671_10000744 3300025914 Bacteria 41309
292 Ga0207671_10004017 3300025914 Bacteria 14293
293 Ga0207671_10006480 3300025914 Bacteria 10419
294 Ga0207671_10007251 3300025914 Bacteria 9654
295 Ga0207671_10009778 3300025914 Bacteria 7981
296 Ga0207671_10104465 3300025914 Bacteria 2149
297 Ga0207671_10266393 3300025914 Bacteria 1349
298 Ga0207660_10205501 3300025917 Bacteria 1540
299 Ga0207660_10346178 3300025917 Bacteria 1191
300 Ga0207657_10076595 3300025919 Bacteria 2821
301 Ga0207657_10225709 3300025919 Bacteria 1499
302 Ga0207652_10004777 3300025921 Bacteria 10982
303 Ga0207652_10027991 3300025921 Bacteria 4700
304 Ga0207646_10097715 3300025922 Bacteria 2631
305 Ga0207646_10785375 3300025922 Bacteria 849
306 Ga0207694_10024569 3300025924 Bacteria 4577
307 Ga0207650_10056844 3300025925 Bacteria 2908
308 Ga0207650_10189142 3300025925 Bacteria 1644
309 Ga0207644_10003140 3300025931 Bacteria 10640
310 Ga0207690_10000049 3300025932 Bacteria 113589
311 Ga0207690_10004182 3300025932 Bacteria 8526
312 Ga0207706_10000111 3300025933 Bacteria 87282
313 Ga0207706_10108611 3300025933 Bacteria 2441
314 Ga0207686_10241814 3300025934 Unclassified 1314
315 Ga0207709_10000020 3300025935 Bacteria 392366
316 Ga0207709_10110310 3300025935 Bacteria 1838
317 Ga0207669_10774433 3300025937 Bacteria 794
318 Ga0207704_10000065 3300025938 Bacteria 69867
319 Ga0207667_10000477 3300025949 Bacteria 53347
320 Ga0207667_10010697 3300025949 Bacteria 10708
321 Ga0207667_10021217 3300025949 Bacteria 7200
322 Ga0207667_10612805 3300025949 Bacteria 1097
323 Ga0207667_10733555 3300025949 Bacteria 988
324 Ga0207651_10066219 3300025960 Bacteria 2537
325 Ga0207712_10078204 3300025961 Bacteria 2400
326 Ga0207668_10447831 3300025972 Unclassified 1101
327 Ga0207640_10035481 3300025981 Bacteria 3122
328 Ga0207677_10049549 3300026023 Bacteria 2835
329 Ga0207703_10317410 3300026035 Bacteria 1426
330 Ga0207639_10007063 3300026041 Bacteria 7658
331 Ga0207639_10156388 3300026041 Bacteria 1916
332 Ga0207639_10369873 3300026041 Bacteria 1285
333 Ga0207678_10025963 3300026067 Bacteria 5112
334 Ga0207708_10597297 3300026075 Unclassified 935
335 Ga0207708_10690005 3300026075 Bacteria 872
336 Ga0207702_10000023 3300026078 Bacteria 189234
337 Ga0207702_10169323 3300026078 Bacteria 2002
338 Ga0207702_10364406 3300026078 Bacteria 1386
339 Ga0207641_10365866 3300026088 Bacteria 1378
340 Ga0207648_10001417 3300026089 Bacteria 26440
341 Ga0207648_10031033 3300026089 Bacteria 4727
342 Ga0207648_10253273 3300026089 Bacteria 1570
343 Ga0207648_11010143 3300026089 Bacteria 779
344 Ga0207676_10035984 3300026095 Unclassified 3763
345 Ga0207674_10084236 3300026116 Bacteria 3178
346 Ga0207675_100438723 3300026118 Bacteria 1292
347 Ga0207675_100749241 3300026118 Bacteria 988
348 Ga0207675_101141607 3300026118 Unclassified 799
349 Ga0207683_10008658 3300026121 Bacteria 8702
350 Ga0207698_10126567 3300026142 Bacteria 2174
351 Ga0207698_10162949 3300026142 Bacteria 1953
352 Ga0207698_10191445 3300026142 Bacteria 1822
353 Ga0209969_1044390 3300027360 Bacteria 693
354 Ga0207428_10074681 3300027907 Bacteria 2658
355 Ga0268266_10000121 3300028379 Bacteria 154995
356 Ga0268265_10017212 3300028380 Bacteria 4983
357 Ga0268264_10399221 3300028381 Bacteria 1321
358 Ga0268264_11186022 3300028381 Bacteria 773
359 Ga0307517_10001388 3300028786 Bacteria 40654
360 Ga0307515_10016181 3300028794 Bacteria 13677
361 Ga0307515_10319199 3300028794 Bacteria 1221
362 Ga0265338_10130761 3300028800 Bacteria 1983
363 Ga0316177_1061403 3300030731 Bacteria 896
364 Ga0316177_1071693 3300030731 Bacteria 4201
365 Ga0316176_1096751 3300030732 Bacteria 6470
366 Ga0316183_1100732 3300030742 Bacteria 40906
367 Ga0316181_1213886 3300030744 Bacteria 3041
368 Ga0316181_1231306 3300030744 Bacteria 13138
369 Ga0265327_10086159 3300031251 Bacteria 1541
370 Ga0265327_10193094 3300031251 Bacteria 926
371 Ga0307509_10050400 3300031507 Bacteria 4458
372 Ga0307408_100000209 3300031548 Bacteria 62437
373 Ga0307408_100000393 3300031548 Bacteria 39808
374 Ga0307408_100000487 3300031548 Bacteria 34716
375 Ga0265313_10116255 3300031595 Bacteria 1171
376 Ga0307405_10012446 3300031731 Bacteria 4504
377 Ga0307412_10000001 3300031911 Bacteria 822691
378 Ga0307412_10000724 3300031911 Bacteria 19071
379 Ga0307412_10083081 3300031911 Bacteria 2219
380 Ga0307412_10149339 3300031911 Bacteria 1722
381 Ga0307412_10286128 3300031911 Unclassified 1296
382 Ga0307409_100713620 3300031995 Bacteria 1003
383 Ga0307416_100490311 3300032002 Bacteria 1291
384 Ga0307414_10001886 3300032004 Bacteria 10825
385 Ga0307414_10013334 3300032004 Bacteria 4890
386 Ga0307414_10019675 3300032004 Bacteria 4190
387 Ga0307414_10052108 3300032004 Bacteria 2846
388 Ga0307414_10058710 3300032004 Bacteria 2712
389 Ga0307414_10060303 3300032004 Bacteria 2682
390 Ga0307414_10068665 3300032004 Bacteria 2544
391 Ga0307414_10098407 3300032004 Bacteria 2194
392 Ga0307414_10192770 3300032004 Bacteria 1650
393 Ga0307510_10000419 3300033180 Bacteria 40732
394 Ga0373941_0106381 3300035115 Unclassified 983
395 Ga0373954_0000087 3300035118 Bacteria 31710
396 Ga0373955_0032403 3300035172 Bacteria 2743
397 Ga0373942_0001205 3300035207 Bacteria 6822
398 Ga0373924_0248595 3300035410 Bacteria 787
399 Ga0373931_0007503 3300035691 Bacteria 5135
400 Ga0373931_0235284 3300035691 Bacteria 1108
401 Ga0373933_0107137 3300035724 Bacteria 1739
402 Ga0373937_0000296 3300036401 Bacteria 47231
403 Ga0395899_0000024 3300037312 Bacteria 357402
404 Ga0395899_0000237 3300037312 Bacteria 74249
405 Ga0395900_0001123 3300037418 Bacteria 33875
406 Ga0395900_0001352 3300037418 Bacteria 29621
407 Ga0395900_0004216 3300037418 Bacteria 15260
408 Ga0395900_0700686 3300037418 Bacteria 946
409 Ga0395898_0022388 3300037466 Bacteria 6400
410 Ga0395898_0763171 3300037466 Bacteria 908
411 Ga0395905_0000246 3300037471 Bacteria 81356
412 Ga0395905_0000347 3300037471 Bacteria 65943
413 Ga0395901_0000184 3300038443 Bacteria 81257
414 Ga0395901_0109857 3300038443 Bacteria 2895
415 Ga0395901_0134229 3300038443 Bacteria 2601
416 Ga0400489_23297 3300039093 Bacteria 1043
417 Ga0436365_0017022 3300039437 Bacteria 19896
418 Ga0436365_1865498 3300039437 Bacteria 1040
419 Ga0436365_1931949 3300039437 Bacteria 26658
420 Ga0436361_1055999 3300039447 Bacteria 7793
421 Ga0451793_0339311 3300041452 Bacteria 932
422 Ga0451802_1573306 3300041460 Bacteria 1073
423 Ga0451835_0168801 3300041492 Unclassified 1461
424 Ga0451843_0248749 3300041509 Bacteria 1120
425 Ga0451853_0991347 3300041512 Bacteria 784
426 Ga0439448_0002050 3300042005 Bacteria 5402
427 Ga0439457_024042 3300042014 Bacteria 1348
428 Ga0466969_0032983 3300044656 Bacteria 2632
429 Ga0466966_0010043 3300044684 Bacteria 6274
430 Ga0466961_0037243 3300044693 Bacteria 3121
431 Ga0466964_0035307 3300044706 Bacteria 1998
432 Ga0466968_0113713 3300044735 Bacteria 1219
433 Ga0466970_0285335 3300044765 Bacteria 929
434 Ga0451576_0247853 3300045051 Bacteria 1861
435 Ga0451576_1388416 3300045051 Unclassified 731
436 Ga0466958_0027342 3300045836 Bacteria 3377
437 Ga0466967_0000469 3300045976 Bacteria 19507
438 Ga0495650_0000098 3300046471 Bacteria 215716
439 Ga0495605_0017082 3300046474 Unclassified 3917
440 Ga0495585_0000308 3300046492 Bacteria 48809
441 Ga0495583_0032516 3300046506 Bacteria 2518
442 Ga0495583_0044858 3300046506 Bacteria 2048
443 Ga0495606_0006041 3300046507 Bacteria 11328
444 Ga0495606_0020092 3300046507 Bacteria 4938
445 Ga0495606_0035610 3300046507 Bacteria 3401
446 Ga0495606_0106567 3300046507 Bacteria 1697
447 Ga0495610_0000054 3300046512 Bacteria 140031
448 Ga0495616_0000433 3300046513 Bacteria 31968
449 Ga0495616_0006824 3300046513 Bacteria 6878
450 Ga0495632_0045318 3300046519 Bacteria 2191
451 Ga0495643_0035714 3300046522 Bacteria 2735
452 Ga0495648_0041623 3300046524 Bacteria 2899
453 Ga0495642_0285348 3300046528 Bacteria 723
454 Ga0495609_0020070 3300046538 Bacteria 3089
455 Ga0495633_0011309 3300046558 Bacteria 4818
456 Ga0495668_0000963 3300046616 Bacteria 31968
457 Ga0495668_0114690 3300046616 Bacteria 1474
458 Ga0495625_0000183 3300046660 Bacteria 98174
459 Ga0495625_0021304 3300046660 Bacteria 4993
460 Ga0495625_0075871 3300046660 Bacteria 2351
461 Ga0495625_0144600 3300046660 Bacteria 1602
462 Ga0495661_0003387 3300046665 Bacteria 11796
463 Ga0495661_0003737 3300046665 Bacteria 11149
464 Ga0495661_0045590 3300046665 Bacteria 2680
465 Ga0495671_0062011 3300046692 Bacteria 1843
466 Ga0495649_0000046 3300046694 Bacteria 120254
467 Ga0495649_0067759 3300046694 Bacteria 1915
468 Ga0495660_0002367 3300046810 Bacteria 12053
469 Ga0495672_0006319 3300047320 Bacteria 9212
470 Ga0495683_0010104 3300047323 Bacteria 5001
471 Ga0495687_007696 3300047443 Bacteria 6290
472 Ga0495686_0001597 3300047472 Bacteria 23929
473 Ga0495686_0015329 3300047472 Bacteria 5239
474 Ga0495686_0030576 3300047472 Bacteria 3497
475 Ga0496116_0004756 3300048919 Bacteria 12822
476 Ga0496117_0000995 3300048920 Bacteria 43366
477 Ga0496122_0000817 3300048925 Bacteria 59596
478 Ga0496122_0060092 3300048925 Bacteria 2801
479 Ga0496123_0008229 3300048926 Bacteria 9615
480 Ga0496123_0027067 3300048926 Bacteria 4279
481 Ga0496125_0304610 3300048928 Bacteria 974
482 Ga0495678_006015 3300049459 Bacteria 6543
483 Ga0501031_0021291 3300049568 Bacteria 4227
484 Ga0501033_0068767 3300049570 Bacteria 2603
485 Ga0501033_0107917 3300049570 Bacteria 2028
486 Ga0501034_0000002 3300049571 Bacteria 565510
487 Ga0501034_0004775 3300049571 Bacteria 15000
488 Ga0501034_0013117 3300049571 Bacteria 8540
489 Ga0501034_0022667 3300049571 Bacteria 6396
490 Ga0501034_0345596 3300049571 Bacteria 1417
491 Ga0501036_0000813 3300049572 Bacteria 23193
492 Ga0501036_0074613 3300049572 Bacteria 2869
493 Ga0501037_0071865 3300049573 Bacteria 2517
494 Ga0501038_0003073 3300049574 Bacteria 15555
495 Ga0501038_0065228 3300049574 Bacteria 3103
496 Ga0501038_0334181 3300049574 Bacteria 1183
497 Ga0501039_0009779 3300049575 Bacteria 7306
498 Ga0501039_0097242 3300049575 Bacteria 2296
499 Ga0501039_0437114 3300049575 Bacteria 1028
500 Ga0501040_0050250 3300049576 Bacteria 2851
501 Ga0501041_0001139 3300049577 Bacteria 14553
502 Ga0501041_0012717 3300049577 Bacteria 4987
503 Ga0501043_0025429 3300049579 Bacteria 4646
504 Ga0501043_0447510 3300049579 Bacteria 971
505 Ga0501046_0011178 3300049580 Bacteria 7691
506 Ga0501047_0550726 3300049581 Bacteria 978
507 Ga0501048_0040000 3300049582 Bacteria 3361
508 Ga0501048_0108631 3300049582 Bacteria 1958
509 Ga0501069_0266341 3300049585 Bacteria 1001
510 Ga0501070_0059508 3300049586 Bacteria 3167
511 Ga0501071_0007860 3300049587 Bacteria 7034
512 Ga0501071_0589265 3300049587 Bacteria 855
513 Ga0501072_0013016 3300049588 Bacteria 6367
514 Ga0501073_0474445 3300049589 Bacteria 865
515 Ga0501074_0047295 3300049590 Bacteria 3110
516 Ga0501075_0090559 3300049591 Bacteria 2320
517 Ga0501076_0002359 3300049592 Bacteria 12925
518 Ga0501077_0000739 3300049593 Bacteria 19791
519 Ga0501198_001244 3300049649 Bacteria 3288
520 Ga0501223_001575 3300049663 Bacteria 5252
521 Ga0501243_016482 3300049675 Bacteria 1193
522 Ga0501252_006249 3300049682 Bacteria 1319
523 Ga0501079_0003530 3300049741 Bacteria 11495
524 Ga0501079_0472761 3300049741 Bacteria 985
525 Ga0501080_0009560 3300049742 Bacteria 8851
526 Ga0501081_0044098 3300049743 Bacteria 3060
527 Ga0501081_0455488 3300049743 Bacteria 951
528 Ga0501083_0392857 3300049744 Bacteria 902
529 Ga0501241_002477 3300049758 Bacteria 3570
530 Ga0501241_016529 3300049758 Bacteria 1346
531 Ga0501035_0088519 3300049822 Bacteria 2728
532 Ga0501044_0014346 3300049823 Bacteria 8555
533 Ga0501045_0030748 3300049824 Bacteria 3887
534 Ga0501045_0073748 3300049824 Bacteria 2513
535 nmdc:mga0k408_16491_c1 3300050493 Bacteria 4100
536 nmdc:mga0k408_671_c1 3300050493 Bacteria 13349
537 nmdc:mga09592_310251_c1 3300050508 Bacteria 1367
538 nmdc:mga0qj67_23955_c1 3300050509 Bacteria 4701
539 nmdc:mga0qj67_515449_c1 3300050509 Bacteria 961
540 nmdc:mga06r32_513442_c1 3300050510 Bacteria 1174
541 nmdc:mga08y16_15272_c1 3300050511 Bacteria 8078
542 nmdc:mga08y16_627299_c1 3300050511 Bacteria 1081
543 nmdc:mga0n895_4843_c1 3300050512 Bacteria 11156
544 nmdc:mga0rr50_4012_c1 3300050513 Bacteria 8584
545 nmdc:mga08x19_23291_c1 3300050514 Bacteria 3841
546 nmdc:mga08x19_3855_c1 3300050514 Bacteria 8926
547 Ga0500635_0002410 3300053080 Bacteria 4631
548 Ga0500651_0001978 3300053093 Bacteria 10625
549 Ga0500608_000417 3300053122 Bacteria 16208
550 Ga0500642_0092787 3300053130 Bacteria 1397
551 Ga0500624_000230 3300053157 Bacteria 20306
552 Ga0501084_0074508 3300054114 Bacteria 2842
553 Ga0587073_0024615 3300059492 Bacteria 1190
554 Ga0501082_0963381 3300060353 Bacteria 746
555 Ga0530510_0000675 3300061734 Bacteria 21957
556 2586206413 2585427687 Bacteria 5544917
557 2599481747 2599185184 Bacteria 6430550
558 2722731230 2721755487 Bacteria 6357185
559 2738755961 2738541283 Bacteria 7222293
560 2738761377 2738541284 Bacteria 5199923
561 2738852877 2738541302 Bacteria 5944758
562 2739304347 2738543023 Bacteria 6767879
563 2739586821 2739367651 Bacteria 6359826
564 2739615138 2739367656 Bacteria 5152243
565 2739645725 2739367663 Bacteria 5040914
566 2776616011 2775506987 Bacteria 5373360
567 2819547243 2818991437 Bacteria 5805520
568 2842726988 2842722452 Bacteria 6263924
569 2842905068 2842903701 Bacteria 6986368
570 2842911010 2842909656 Bacteria 6185908
571 2849283870 2849281842 Bacteria 6065644
572 2852627100 2852623160 Bacteria 4376875
573 2852628202 2852627209 Bacteria 5896285
574 2857627927 2857627736 Bacteria 5625397
575 2883294564 2883291878 Bacteria 5894118
576 2884935166 2884933994 Bacteria 4535041
577 2887381318 2887375801 Bacteria 5334027
578 2890739219 2890737413 Bacteria 4269751
579 2896320285 2896317667 Bacteria 4606601
580 2896347310 2896344016 Bacteria 3811746
581 2898714527 2898713307 Bacteria 4110805
582 2902052092 2902048731 Bacteria 4976191
583 2904447724 2904445276 Bacteria 5310396
584 2904782306 2904780799 Bacteria 5840761
585 2919178497 2919177583 Bacteria 5641607
586 2919188562 2919186247 Bacteria 6244071
587 2919439401 2919437846 Bacteria 6199444
588 2928082020 2928078545 Bacteria 6534839
589 2928152040 2928147474 Bacteria 6512076
590 2932088075 2932082852 Bacteria 6563563
591 2939667283 2939664404 Bacteria 6364494
592 2954020358 2954016120 Bacteria 6446024
593 2977234728 2977232053 Bacteria 5485925
594 3003235904 3003233435 Bacteria 4458031
595 8055591401 8055588893 Bacteria 3619545
596 Ga0307414_10209358
597 SwRhRL2b_contig_3308433
598 SwRhRL2b_contig_677025
599 JGI24736J21556_1000812
600 JGI24736J21556_1001942
601 JGI24740J21852_10012653
602 JGI24739J22299_10001457
603 JGI24737J22298_10000852
604 JGI24737J22298_10001745
605 JGI24737J22298_10002702
606 JGI24737J22298_10015372
607 JGI24737J22298_10024646
608 JGI24735J21928_10000027
609 JGI24735J21928_10015914
610 JGI24751J29686_10000772
611 JGI25157J39369_1002704
612 JGI25164J39214_1001144
613 JGI25152J39213_1000043
614 JGI25150J39212_1000023
615 JGI25151J46595_10000082
616 JGI25165J46597_1001050
617 JGI25165J46597_1008856
618 JGI25153J46596_10000060
619 rootH1_10031584
620 rootH2_10001273
621 rootH2_10114261
622 rootL2_10020975
623 rootH1_10024310
624 rootH1_10083498
625 rootH1_10124986
626 rootH1_10233543
627 Ga0055536_1000002
628 Ga0055530_10000739
629 Ga0058863_11920979
630 Ga0058862_12833523
631 Ga0065714_10002980
632 Ga0065714_10003630
633 Ga0065714_10004446
634 Ga0065714_10064525
635 Ga0065714_10080235
636 Ga0065704_10000206
637 Ga0065704_10099903
638 Ga0065704_10166991
639 Ga0065704_10333564
640 Ga0070658_10111073
641 Ga0070658_10226211
642 Ga0070658_10259587
643 Ga0070676_10014740
644 Ga0070683_100008086
645 Ga0070670_100008042
646 Ga0070670_100193626
647 Ga0070670_100465243
648 Ga0070680_100247464
649 Ga0070680_100413117
650 Ga0068868_100047960
651 Ga0070660_100049784
652 Ga0070660_100363636
653 Ga0070689_100327777
654 Ga0070689_100677490
655 Ga0070674_100016874
656 Ga0070673_100026225
657 Ga0070688_100335239
658 Ga0070659_100000412
659 Ga0070659_100040361
660 Ga0070667_100467059
661 Ga0070700_100311417
662 Ga0070700_100745457
663 Ga0070663_100014280
664 Ga0070678_100007878
665 Ga0070662_100000468
666 Ga0070681_10000627
667 Ga0070681_10125196
668 Ga0068867_100004302
669 Ga0068867_100977383
670 Ga0070707_100133283
671 Ga0070707_100309700
672 Ga0070698_100229296
673 Ga0070699_100050734
674 Ga0070679_100006243
675 Ga0070679_100040127
676 Ga0070679_100141289
677 Ga0070684_100423450
678 Ga0070684_100991513
679 Ga0068853_100039336
680 Ga0068853_100231655
681 Ga0068853_100428574
682 Ga0070672_100191686
683 Ga0070693_100597344
684 Ga0070665_100000118
685 Ga0070704_100000050
686 Ga0070704_100998476
687 Ga0068855_100000958
688 Ga0068855_100008698
689 Ga0068855_100019618
690 Ga0068855_100091183
691 Ga0068855_100109018
692 Ga0068855_100381016
693 Ga0068854_100117651
694 Ga0068856_100000006
695 Ga0068856_100050674
696 Ga0068852_100000720
697 Ga0068852_100386360
698 Ga0068864_100079743
699 Ga0068866_10002584
700 Ga0068866_10172763
701 Ga0068866_10208103
702 Ga0068861_100205966
703 Ga0068861_100546056
704 Ga0068863_100340770
705 Ga0068858_100351757
706 Ga0068860_101546838
707 Ga0075366_10014581
708 Ga0075366_10042954
709 Ga0097621_100000285
710 Ga0097621_100340497
711 Ga0097621_100612460
712 Ga0068871_100000080
713 Ga0075430_100047773
714 Ga0075431_100008882
715 Ga0075431_100551069
716 Ga0075434_100000318
717 Ga0075429_100055559
718 Ga0068865_100000218
719 Ga0075436_100015330
720 Ga0075436_100019266
721 Ga0075435_100003168
722 Ga0105244_10042625
723 Ga0105240_10048169
724 Ga0105240_10097171
725 Ga0105240_10152098
726 Ga0105240_10186200
727 Ga0105240_10191749
728 Ga0105240_10216578
729 Ga0105240_10310454
730 Ga0105240_10397261
731 Ga0105240_10643183
732 Ga0105240_10675164
733 Ga0105240_10901263
734 Ga0105240_10996881
735 Ga0111539_10014062
736 Ga0111539_11293396
737 Ga0105243_10000046
738 Ga0105243_10314960
739 Ga0105241_10000999
740 Ga0105241_10474511
741 Ga0105242_10002835
742 Ga0105242_10349946
743 Ga0105237_10000088
744 Ga0105237_10002840
745 Ga0105237_10003145
746 Ga0105237_10004869
747 Ga0105237_10023283
748 Ga0105237_10232232
749 Ga0105237_10410378
750 Ga0105238_10003441
751 Ga0105238_10081249
752 Ga0105238_10476982
753 Ga0105249_10006600
754 Ga0105249_11222409
755 Ga0105239_10000008
756 Ga0105239_10000115
757 Ga0105239_10002115
758 Ga0105239_10002395
759 Ga0105239_10008252
760 Ga0105239_10014398
761 Ga0105239_10239007
762 Ga0105239_10674133
763 Ga0105239_10680154
764 Ga0105246_10302210
765 Ga0105246_10640219
766 Ga0157373_10000376
767 Ga0157373_10000486
768 Ga0157373_10000546
769 Ga0157373_10042194
770 Ga0157373_10405367
771 Ga0157371_10000151
772 Ga0157371_10000888
773 Ga0157371_10001401
774 Ga0157371_10001845
775 Ga0157371_10005485
776 Ga0157371_10023303
777 Ga0157371_10366364
778 Ga0157370_10000597
779 Ga0157370_10006731
780 Ga0157370_10017828
781 Ga0157370_10069775
782 Ga0157370_10070205
783 Ga0157370_10089848
784 Ga0157370_10110214
785 Ga0157370_10136766
786 Ga0157370_10263023
787 Ga0157370_10409702
788 Ga0157370_10486180
789 Ga0157370_10501905
790 Ga0157369_10000101
791 Ga0157369_10021519
792 Ga0157369_10096977
793 Ga0157369_10101557
794 Ga0157369_10131283
795 Ga0157369_10708961
796 Ga0157369_10742467
797 Ga0157374_10000741
798 Ga0157374_10001208
799 Ga0157374_10038994
800 Ga0157374_10223725
801 Ga0157374_10302577
802 Ga0157378_10017834
803 Ga0157378_10222586
804 Ga0163162_10000011
805 Ga0163162_10000012
806 Ga0163162_10006625
807 Ga0163162_10025616
808 Ga0163162_10228148
809 Ga0157372_10000041
810 Ga0157372_10000199
811 Ga0157372_10000538
812 Ga0157372_10007865
813 Ga0157375_10064342
814 Ga0157375_10156528
815 Ga0157375_10206292
816 Ga0157375_10251304
817 Ga0157375_11170978
818 Ga0163163_10207919
819 Ga0163163_10461653
820 Ga0163163_10664547
821 Ga0157380_10039114
822 Ga0182008_10000020
823 Ga0182008_10000296
824 Ga0182008_10000342
825 Ga0182008_10138260
826 Ga0182008_10247581
827 Ga0157379_10086604
828 Ga0157376_10090563
829 Ga0157376_10637486
830 Ga0182006_1000242
831 Ga0182006_1000310
832 Ga0182006_1000735
833 Ga0182006_1005572
834 Ga0182006_1022335
835 Ga0182007_10008621
836 Ga0182007_10062468
837 Ga0183373_1002
838 Ga0163161_10000330
839 Ga0163161_10000565
840 Ga0163161_10002836
841 Ga0163161_10062000
842 Ga0163161_10067561
843 Ga0163161_10073200
844 Ga0163161_10173456
845 Ga0206351_10221156
846 Ga0213872_10002511
847 Ga0213876_10002643
848 Ga0209563_106202
849 Ga0207427_100072
850 Ga0209437_100026
851 Ga0209437_100144
852 Ga0207425_1000051
853 Ga0209026_1000246
854 Ga0209026_1001159
855 Ga0209026_1003618
856 Ga0209129_1000121
857 Ga0209129_1012439
858 Ga0209233_1000111
859 Ga0209233_1002603
860 Ga0209233_1012503
861 Ga0209455_1002153
862 Ga0209676_1000022
863 Ga0209025_1000160
864 Ga0209758_1000147
865 Ga0209050_1000020
866 Ga0209051_1086543
867 Ga0207642_10018419
868 Ga0207642_10166460
869 Ga0207647_10000049
870 Ga0207647_10000103
871 Ga0207647_10116372
872 Ga0207645_10000398
873 Ga0207705_10000026
874 Ga0207705_10049489
875 Ga0207705_10229116
876 Ga0207684_10395995
877 Ga0207654_10075439
878 Ga0207707_10010987
879 Ga0207695_10007414
880 Ga0207695_10015443
881 Ga0207695_10092143
882 Ga0207695_10097954
883 Ga0207695_10185343
884 Ga0207695_10383123
885 Ga0207695_10416484
886 Ga0207671_10000744
887 Ga0207671_10004017
888 Ga0207671_10006480
889 Ga0207671_10007251
890 Ga0207671_10009778
891 Ga0207671_10104465
892 Ga0207671_10266393
893 Ga0207660_10205501
894 Ga0207660_10346178
895 Ga0207657_10076595
896 Ga0207657_10225709
897 Ga0207652_10004777
898 Ga0207652_10027991
899 Ga0207646_10097715
900 Ga0207646_10785375
901 Ga0207694_10024569
902 Ga0207650_10056844
903 Ga0207650_10189142
904 Ga0207644_10003140
905 Ga0207690_10000049
906 Ga0207690_10004182
907 Ga0207706_10000111
908 Ga0207706_10108611
909 Ga0207686_10241814
910 Ga0207709_10000020
911 Ga0207709_10110310
912 Ga0207669_10774433
913 Ga0207704_10000065
914 Ga0207667_10000477
915 Ga0207667_10010697
916 Ga0207667_10021217
917 Ga0207667_10612805
918 Ga0207667_10733555
919 Ga0207651_10066219
920 Ga0207712_10078204
921 Ga0207668_10447831
922 Ga0207640_10035481
923 Ga0207677_10049549
924 Ga0207703_10317410
925 Ga0207639_10007063
926 Ga0207639_10156388
927 Ga0207639_10369873
928 Ga0207678_10025963
929 Ga0207708_10597297
930 Ga0207708_10690005
931 Ga0207702_10000023
932 Ga0207702_10169323
933 Ga0207702_10364406
934 Ga0207641_10365866
935 Ga0207648_10001417
936 Ga0207648_10031033
937 Ga0207648_10253273
938 Ga0207648_11010143
939 Ga0207676_10035984
940 Ga0207674_10084236
941 Ga0207675_100438723
942 Ga0207675_100749241
943 Ga0207675_101141607
944 Ga0207683_10008658
945 Ga0207698_10126567
946 Ga0207698_10162949
947 Ga0207698_10191445
948 Ga0209969_1044390
949 Ga0207428_10074681
950 Ga0268266_10000121
951 Ga0268265_10017212
952 Ga0268264_10399221
953 Ga0268264_11186022
954 Ga0307517_10001388
955 Ga0307515_10016181
956 Ga0307515_10319199
957 Ga0265338_10130761
958 Ga0316177_1061403
959 Ga0316177_1071693
960 Ga0316176_1096751
961 Ga0316183_1100732
962 Ga0316181_1213886
963 Ga0316181_1231306
964 Ga0265327_10086159
965 Ga0265327_10193094
966 Ga0307509_10050400
967 Ga0307408_100000209
968 Ga0307408_100000393
969 Ga0307408_100000487
970 Ga0265313_10116255
971 Ga0307405_10012446
972 Ga0307412_10000001
973 Ga0307412_10000724
974 Ga0307412_10083081
975 Ga0307412_10149339
976 Ga0307412_10286128
977 Ga0307409_100713620
978 Ga0307416_100490311
979 Ga0307414_10001886
980 Ga0307414_10013334
981 Ga0307414_10019675
982 Ga0307414_10052108
983 Ga0307414_10058710
984 Ga0307414_10060303
985 Ga0307414_10068665
986 Ga0307414_10098407
987 Ga0307414_10192770
988 Ga0307510_10000419
989 Ga0373941_0106381
990 Ga0373954_0000087
991 Ga0373955_0032403
992 Ga0373942_0001205
993 Ga0373924_0248595
994 Ga0373931_0007503
995 Ga0373931_0235284
996 Ga0373933_0107137
997 Ga0373937_0000296
998 Ga0395899_0000024
999 Ga0395899_0000237
1000 Ga0395900_0001123
1001 Ga0395900_0001352
1002 Ga0395900_0004216
1003 Ga0395900_0700686
1004 Ga0395898_0022388
1005 Ga0395898_0763171
1006 Ga0395905_0000246
1007 Ga0395905_0000347
1008 Ga0395901_0000184
1009 Ga0395901_0109857
1010 Ga0395901_0134229
1011 Ga0400489_23297
1012 Ga0436365_0017022
1013 Ga0436365_1865498
1014 Ga0436365_1931949
1015 Ga0436361_1055999
1016 Ga0451793_0339311
1017 Ga0451802_1573306
1018 Ga0451835_0168801
1019 Ga0451843_0248749
1020 Ga0451853_0991347
1021 Ga0439448_0002050
1022 Ga0439457_024042
1023 Ga0466969_0032983
1024 Ga0466966_0010043
1025 Ga0466961_0037243
1026 Ga0466964_0035307
1027 Ga0466968_0113713
1028 Ga0466970_0285335
1029 Ga0451576_0247853
1030 Ga0451576_1388416
1031 Ga0466958_0027342
1032 Ga0466967_0000469
1033 Ga0495650_0000098
1034 Ga0495605_0017082
1035 Ga0495585_0000308
1036 Ga0495583_0032516
1037 Ga0495583_0044858
1038 Ga0495606_0006041
1039 Ga0495606_0020092
1040 Ga0495606_0035610
1041 Ga0495606_0106567
1042 Ga0495610_0000054
1043 Ga0495616_0000433
1044 Ga0495616_0006824
1045 Ga0495632_0045318
1046 Ga0495643_0035714
1047 Ga0495648_0041623
1048 Ga0495642_0285348
1049 Ga0495609_0020070
1050 Ga0495633_0011309
1051 Ga0495668_0000963
1052 Ga0495668_0114690
1053 Ga0495625_0000183
1054 Ga0495625_0021304
1055 Ga0495625_0075871
1056 Ga0495625_0144600
1057 Ga0495661_0003387
1058 Ga0495661_0003737
1059 Ga0495661_0045590
1060 Ga0495671_0062011
1061 Ga0495649_0000046
1062 Ga0495649_0067759
1063 Ga0495660_0002367
1064 Ga0495672_0006319
1065 Ga0495683_0010104
1066 Ga0495687_007696
1067 Ga0495686_0001597
1068 Ga0495686_0015329
1069 Ga0495686_0030576
1070 Ga0496116_0004756
1071 Ga0496117_0000995
1072 Ga0496122_0000817
1073 Ga0496122_0060092
1074 Ga0496123_0008229
1075 Ga0496123_0027067
1076 Ga0496125_0304610
1077 Ga0495678_006015
1078 Ga0501031_0021291
1079 Ga0501033_0068767
1080 Ga0501033_0107917
1081 Ga0501034_0000002
1082 Ga0501034_0004775
1083 Ga0501034_0013117
1084 Ga0501034_0022667
1085 Ga0501034_0345596
1086 Ga0501036_0000813
1087 Ga0501036_0074613
1088 Ga0501037_0071865
1089 Ga0501038_0003073
1090 Ga0501038_0065228
1091 Ga0501038_0334181
1092 Ga0501039_0009779
1093 Ga0501039_0097242
1094 Ga0501039_0437114
1095 Ga0501040_0050250
1096 Ga0501041_0001139
1097 Ga0501041_0012717
1098 Ga0501043_0025429
1099 Ga0501043_0447510
1100 Ga0501046_0011178
1101 Ga0501047_0550726
1102 Ga0501048_0040000
1103 Ga0501048_0108631
1104 Ga0501069_0266341
1105 Ga0501070_0059508
1106 Ga0501071_0007860
1107 Ga0501071_0589265
1108 Ga0501072_0013016
1109 Ga0501073_0474445
1110 Ga0501074_0047295
1111 Ga0501075_0090559
1112 Ga0501076_0002359
1113 Ga0501077_0000739
1114 Ga0501198_001244
1115 Ga0501223_001575
1116 Ga0501243_016482
1117 Ga0501252_006249
1118 Ga0501079_0003530
1119 Ga0501079_0472761
1120 Ga0501080_0009560
1121 Ga0501081_0044098
1122 Ga0501081_0455488
1123 Ga0501083_0392857
1124 Ga0501241_002477
1125 Ga0501241_016529
1126 Ga0501035_0088519
1127 Ga0501044_0014346
1128 Ga0501045_0030748
1129 Ga0501045_0073748
1130 nmdc:mga0k408_16491_c1
1131 nmdc:mga0k408_671_c1
1132 nmdc:mga09592_310251_c1
1133 nmdc:mga0qj67_23955_c1
1134 nmdc:mga0qj67_515449_c1
1135 nmdc:mga06r32_513442_c1
1136 nmdc:mga08y16_15272_c1
1137 nmdc:mga08y16_627299_c1
1138 nmdc:mga0n895_4843_c1
1139 nmdc:mga0rr50_4012_c1
1140 nmdc:mga08x19_23291_c1
1141 nmdc:mga08x19_3855_c1
1142 Ga0500635_0002410
1143 Ga0500651_0001978
1144 Ga0500608_000417
1145 Ga0500642_0092787
1146 Ga0500624_000230
1147 Ga0501084_0074508
1148 Ga0587073_0024615
1149 Ga0501082_0963381
1150 Ga0530510_0000675
1151 2586206413
1152 2599481747
1153 2722731230
1154 2738755961
1155 2738761377
1156 2738852877
1157 2739304347
1158 2739586821
1159 2739615138
1160 2739645725
1161 2776616011
1162 2819547243
1163 2842726988
1164 2842905068
1165 2842911010
1166 2849283870
1167 2852627100
1168 2852628202
1169 2857627927
1170 2883294564
1171 2884935166
1172 2887381318
1173 2890739219
1174 2896320285
1175 2896347310
1176 2898714527
1177 2902052092
1178 2904447724
1179 2904782306
1180 2919178497
1181 2919188562
1182 2919439401
1183 2928082020
1184 2928152040
1185 2932088075
1186 2939667283
1187 2954020358
1188 2977234728
1189 3003235904
1190 8055591401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

47

224

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z88-assembly1.cif.gz_I human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9766 26 204
6z89-assembly1.cif.gz_D-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9692 22 204
7ala-assembly1.cif.gz_E-2 human gch-gfrp inhibitory complex 0.969 22 204
6z88-assembly1.cif.gz_B human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9684 22 204
7alc-assembly1.cif.gz_C-2 human gch-gfrp stimulatory complex 0.9674 26 204
ID Description Score Start End Superfamily
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9589 77 189 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9525 79 206 3.30.1130.10
1wm9B01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9406 25 73 1.10.286.10
1wuqA01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9384 25 73 1.10.286.10
1wm9A01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9362 25 73 1.10.286.10
ID Description Score Start End GO Terms
AF-X1MIN2-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 1.001 79 170 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A7Y1V6H8-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9837 14 156 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-Q2RYU5-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.9814 14 207 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A814HEM1-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9809 23 165 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A521N396-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.9799 14 209 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654

Map