F467475
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 595 | 269 | 1188 | 680 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0008881|Ga0495583_0008881_2607_4811 |
| Length | 734 |
| Sequence | MQRASASASRTAEIPGRQSTPLLQRVKLLPRSWRAVALPDDTRDTLDEESMKLRLLMLGAAVAASSAVAAPRGLTVEDLVSLERVGSPAVSPDARRVVYTVRRTDLGKNRGHTSLWIADLNGANAAPKALTDHDSSSTDPEWSPSGDAVYFLSSRSGSSQVWRQPANGGEPVQVTNLPLDVDNFRISPTGERIAFSLAVFRDCPDLACTKDRLDAQAKNKASGHVYDRLFVRHWDTWADGRNAVLFSAPIDANGRVSSAPVSLSGSLDGDVPSKPFGDREEYRFSPDGKTVVFSARIAGKTEAWSTNFDLYSVPAAGNAAPRNLTAENKAWDSKGVFSPDGRTLAYLAMARPGFEADRYQVMLMDVASGTKRKLAPNWDRSAGALQWSEDGKSLVVDAEDVGQHRLFSIDVASGKVSALTDKGSIGGFDMRRDTIAYTQATLSSPAQLYTTSLHGGTPQQLSNNNADKLADVRFGEYEQFSFKGAHGDTVYGHVMKPWNATPGVKYPIAFLVHGGPQGSFGNAWSYRWNPQVYAGAGYAAVFIDFHGSTGYGQKFTDAISGDWGGAPLVDLQKGLEAAVKKFPWLDRGRSCALGASYGGYMMNWIEGNWSDGFKCIVNHDGVFDTRGMAYSTEEQWFTDWENGGAYFSVPQQHERFNPVLHVNKWKTPMLVVQGDLDFRIPTAQGLSTFTALQRRGIESKLLVFPDENHWVLKPANSLLWHHTVIGWLDQHLKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 8 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 58 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 95 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 102 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 103 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 109 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 110 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 111 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 112 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 113 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 114 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 115 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 116 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 117 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 118 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 119 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 123 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 124 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 205 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 206 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 207 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 208 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 209 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 210 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 211 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 212 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 216 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 224 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 225 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 226 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 227 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 228 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 229 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 230 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 231 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 232 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 233 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 234 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 235 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 236 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 237 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 238 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 239 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 240 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 241 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 242 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 243 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 244 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 245 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 246 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 247 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 248 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 249 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 250 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 251 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 252 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 253 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 254 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 255 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 256 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 257 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 258 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 259 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 260 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 261 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 262 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 263 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 264 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 265 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 266 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 267 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 268 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 269 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.77 |
| Metatranscriptomes | 0 |
| Isolates | 7.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.93 |
| Nodule | 0.5 |
| Rhizoplane | 2.69 |
| Rhizosphere | 75.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495583_0008881 | 3300046506 | Bacteria | 6077 |
| 2 | JGI25152J39213_1000003 | 3300002773 | Bacteria | 214804 |
| 3 | JGI25150J39212_1000325 | 3300002774 | Bacteria | 23492 |
| 4 | JGI25159J45721_1002066 | 3300002987 | Bacteria | 7923 |
| 5 | JGI25159J45721_1002463 | 3300002987 | Bacteria | 7022 |
| 6 | JGI25153J46596_10010601 | 3300003215 | Bacteria | 4151 |
| 7 | rootL2_10004162 | 3300003322 | Bacteria | 10037 |
| 8 | JGI25161J50226_1000830 | 3300003374 | Bacteria | 11561 |
| 9 | Ga0055529_1000152 | 3300003763 | Bacteria | 98133 |
| 10 | Ga0055526_1000025 | 3300003771 | Bacteria | 154279 |
| 11 | Ga0055526_1000079 | 3300003771 | Bacteria | 89698 |
| 12 | Ga0055526_1000467 | 3300003771 | Bacteria | 32128 |
| 13 | Ga0055526_1000514 | 3300003771 | Bacteria | 30863 |
| 14 | Ga0055537_1000098 | 3300003773 | Bacteria | 65302 |
| 15 | Ga0055524_1000090 | 3300003775 | Bacteria | 114109 |
| 16 | Ga0055524_1000696 | 3300003775 | Bacteria | 23514 |
| 17 | Ga0055524_1011614 | 3300003775 | Bacteria | 3431 |
| 18 | Ga0055536_1001410 | 3300003781 | Bacteria | 14516 |
| 19 | Ga0055534_1000009 | 3300003784 | Bacteria | 210256 |
| 20 | Ga0055534_1005698 | 3300003784 | Bacteria | 3279 |
| 21 | Ga0055528_1000012 | 3300003790 | Bacteria | 182704 |
| 22 | Ga0055528_1005576 | 3300003790 | Bacteria | 5827 |
| 23 | Ga0055530_10001584 | 3300003791 | Bacteria | 16276 |
| 24 | Ga0055543_1001111 | 3300004625 | Bacteria | 11599 |
| 25 | Ga0055543_1002742 | 3300004625 | Bacteria | 5609 |
| 26 | Ga0065165_1000051 | 3300005262 | Bacteria | 194844 |
| 27 | Ga0065165_1005229 | 3300005262 | Bacteria | 7449 |
| 28 | Ga0070658_10049742 | 3300005327 | Bacteria | 3397 |
| 29 | Ga0070658_10096718 | 3300005327 | Bacteria | 2438 |
| 30 | Ga0070680_100021120 | 3300005336 | Bacteria | 5171 |
| 31 | Ga0070660_100036848 | 3300005339 | Bacteria | 3706 |
| 32 | Ga0070689_100005216 | 3300005340 | Bacteria | 8850 |
| 33 | Ga0070671_100008369 | 3300005355 | Bacteria | 8287 |
| 34 | Ga0070659_100050580 | 3300005366 | Bacteria | 3266 |
| 35 | Ga0070714_100054936 | 3300005435 | Bacteria | 3403 |
| 36 | Ga0070710_10026745 | 3300005437 | Bacteria | 3069 |
| 37 | Ga0070708_100021206 | 3300005445 | Bacteria | 5490 |
| 38 | Ga0070681_10118016 | 3300005458 | Bacteria | 2590 |
| 39 | Ga0070706_100008026 | 3300005467 | Bacteria | 9850 |
| 40 | Ga0070698_100004950 | 3300005471 | Bacteria | 14603 |
| 41 | Ga0070684_100008554 | 3300005535 | Bacteria | 8011 |
| 42 | Ga0068855_100121551 | 3300005563 | Bacteria | 2988 |
| 43 | Ga0070664_100073356 | 3300005564 | Bacteria | 2936 |
| 44 | Ga0068852_100001921 | 3300005616 | Bacteria | 14156 |
| 45 | Ga0068859_100018821 | 3300005617 | Bacteria | 6938 |
| 46 | Ga0068851_10011558 | 3300005834 | Bacteria | 4142 |
| 47 | Ga0068858_100014283 | 3300005842 | Bacteria | 7487 |
| 48 | Ga0068860_100004026 | 3300005843 | Bacteria | 15091 |
| 49 | Ga0075428_100006344 | 3300006844 | Bacteria | 13157 |
| 50 | Ga0075428_100037453 | 3300006844 | Bacteria | 5339 |
| 51 | Ga0075430_100045767 | 3300006846 | Bacteria | 3695 |
| 52 | Ga0075431_100023523 | 3300006847 | Bacteria | 6305 |
| 53 | Ga0075433_10057598 | 3300006852 | Bacteria | 3397 |
| 54 | Ga0075433_10121249 | 3300006852 | Bacteria | 2322 |
| 55 | Ga0075434_100004850 | 3300006871 | Bacteria | 12192 |
| 56 | Ga0075434_100090191 | 3300006871 | Bacteria | 3067 |
| 57 | Ga0075436_100060843 | 3300006914 | Bacteria | 2609 |
| 58 | Ga0097620_100018821 | 3300006931 | Bacteria | 6938 |
| 59 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 60 | Ga0105244_10000891 | 3300009036 | Bacteria | 25233 |
| 61 | Ga0105244_10000981 | 3300009036 | Bacteria | 23934 |
| 62 | Ga0105244_10032501 | 3300009036 | Bacteria | 2761 |
| 63 | Ga0111539_10061455 | 3300009094 | Bacteria | 4450 |
| 64 | Ga0105241_10005321 | 3300009174 | Bacteria | 9508 |
| 65 | Ga0105242_10008974 | 3300009176 | Bacteria | 7679 |
| 66 | Ga0105237_10007063 | 3300009545 | Bacteria | 12348 |
| 67 | Ga0105237_10051228 | 3300009545 | Bacteria | 4146 |
| 68 | Ga0157371_10000399 | 3300013102 | Bacteria | 54380 |
| 69 | Ga0157371_10010317 | 3300013102 | Bacteria | 7290 |
| 70 | Ga0157371_10029129 | 3300013102 | Bacteria | 3997 |
| 71 | Ga0157371_10034644 | 3300013102 | Bacteria | 3620 |
| 72 | Ga0157370_10010757 | 3300013104 | Bacteria | 9623 |
| 73 | Ga0157369_10037576 | 3300013105 | Bacteria | 5301 |
| 74 | Ga0182006_1000080 | 3300015261 | Bacteria | 122163 |
| 75 | Ga0182006_1000097 | 3300015261 | Bacteria | 102186 |
| 76 | Ga0182007_10000227 | 3300015262 | Bacteria | 37880 |
| 77 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 78 | Ga0182005_1000038 | 3300015265 | Bacteria | 160030 |
| 79 | Ga0213872_10000005 | 3300021361 | Bacteria | 290165 |
| 80 | Ga0209436_100099 | 3300025208 | Bacteria | 42519 |
| 81 | Ga0209436_100273 | 3300025208 | Bacteria | 23718 |
| 82 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 83 | Ga0207425_1000014 | 3300025245 | Bacteria | 481113 |
| 84 | Ga0207425_1000053 | 3300025245 | Bacteria | 156878 |
| 85 | Ga0209646_1000190 | 3300025246 | Bacteria | 75772 |
| 86 | Ga0209677_103085 | 3300025253 | Bacteria | 5682 |
| 87 | Ga0209148_1000272 | 3300025254 | Bacteria | 81330 |
| 88 | Ga0209129_1000017 | 3300025258 | Bacteria | 480935 |
| 89 | Ga0209565_1000015 | 3300025263 | Bacteria | 494091 |
| 90 | Ga0209565_1000558 | 3300025263 | Bacteria | 25649 |
| 91 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 92 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 93 | Ga0209673_1009290 | 3300025273 | Bacteria | 4280 |
| 94 | Ga0209130_1000063 | 3300025284 | Bacteria | 198142 |
| 95 | Ga0209130_1001797 | 3300025284 | Bacteria | 12595 |
| 96 | Ga0209130_1001856 | 3300025284 | Bacteria | 12110 |
| 97 | Ga0209675_1000012 | 3300025291 | Bacteria | 494061 |
| 98 | Ga0209675_1000655 | 3300025291 | Bacteria | 24384 |
| 99 | Ga0209675_1004711 | 3300025291 | Bacteria | 5971 |
| 100 | Ga0209676_1000115 | 3300025292 | Bacteria | 205183 |
| 101 | Ga0209025_1009248 | 3300025294 | Bacteria | 6904 |
| 102 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 103 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 104 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 105 | Ga0209564_1000184 | 3300025295 | Bacteria | 149989 |
| 106 | Ga0209564_1002884 | 3300025295 | Bacteria | 12595 |
| 107 | Ga0209758_1000038 | 3300025297 | Bacteria | 433771 |
| 108 | Ga0209758_1009637 | 3300025297 | Bacteria | 5954 |
| 109 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 110 | Ga0209050_1000159 | 3300025298 | Bacteria | 157244 |
| 111 | Ga0209050_1001486 | 3300025298 | Bacteria | 24922 |
| 112 | Ga0209050_1005040 | 3300025298 | Bacteria | 8556 |
| 113 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 114 | Ga0209256_1000138 | 3300025299 | Bacteria | 156076 |
| 115 | Ga0209256_1000290 | 3300025299 | Bacteria | 88227 |
| 116 | Ga0209256_1000593 | 3300025299 | Bacteria | 50391 |
| 117 | Ga0209256_1005123 | 3300025299 | Bacteria | 7762 |
| 118 | Ga0207426_1000654 | 3300025302 | Bacteria | 42532 |
| 119 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 120 | Ga0209257_1000090 | 3300025304 | Bacteria | 274746 |
| 121 | Ga0207655_1004025 | 3300025728 | Bacteria | 10605 |
| 122 | Ga0207680_10028010 | 3300025903 | Bacteria | 3146 |
| 123 | Ga0207705_10001666 | 3300025909 | Bacteria | 17666 |
| 124 | Ga0207684_10021521 | 3300025910 | Bacteria | 5506 |
| 125 | Ga0207654_10002340 | 3300025911 | Bacteria | 9727 |
| 126 | Ga0207707_10113795 | 3300025912 | Bacteria | 2365 |
| 127 | Ga0207657_10019062 | 3300025919 | Bacteria | 6527 |
| 128 | Ga0207657_10023264 | 3300025919 | Bacteria | 5773 |
| 129 | Ga0207652_10035614 | 3300025921 | Bacteria | 4203 |
| 130 | Ga0207646_10009557 | 3300025922 | Bacteria | 9571 |
| 131 | Ga0207664_10048689 | 3300025929 | Bacteria | 3334 |
| 132 | Ga0207690_10036169 | 3300025932 | Bacteria | 3195 |
| 133 | Ga0207690_10036678 | 3300025932 | Bacteria | 3176 |
| 134 | Ga0207690_10038026 | 3300025932 | Bacteria | 3129 |
| 135 | Ga0207686_10004244 | 3300025934 | Bacteria | 7680 |
| 136 | Ga0207691_10015946 | 3300025940 | Bacteria | 7138 |
| 137 | Ga0207703_10025686 | 3300026035 | Bacteria | 4634 |
| 138 | Ga0207674_10009103 | 3300026116 | Bacteria | 11396 |
| 139 | Ga0207674_10036681 | 3300026116 | Bacteria | 5105 |
| 140 | Ga0207698_10007362 | 3300026142 | Bacteria | 6897 |
| 141 | Ga0209281_1004269 | 3300027111 | Bacteria | 4336 |
| 142 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 143 | Ga0268266_10001639 | 3300028379 | Bacteria | 25975 |
| 144 | Ga0268264_10005333 | 3300028381 | Bacteria | 10892 |
| 145 | Ga0307408_100000201 | 3300031548 | Bacteria | 64686 |
| 146 | Ga0307408_100000244 | 3300031548 | Bacteria | 56961 |
| 147 | Ga0307408_100021893 | 3300031548 | Bacteria | 4334 |
| 148 | Ga0265314_10036835 | 3300031711 | Bacteria | 3550 |
| 149 | Ga0307412_10000683 | 3300031911 | Bacteria | 19623 |
| 150 | Ga0307416_100011300 | 3300032002 | Bacteria | 5941 |
| 151 | Ga0307414_10011321 | 3300032004 | Bacteria | 5226 |
| 152 | Ga0307414_10046584 | 3300032004 | Bacteria | 2977 |
| 153 | Ga0373925_0072945 | 3300037068 | Bacteria | 2597 |
| 154 | Ga0395899_0000207 | 3300037312 | Bacteria | 86182 |
| 155 | Ga0395899_0014688 | 3300037312 | Bacteria | 5975 |
| 156 | Ga0395899_0024233 | 3300037312 | Bacteria | 4590 |
| 157 | Ga0395899_0030403 | 3300037312 | Bacteria | 4062 |
| 158 | Ga0395899_0098493 | 3300037312 | Bacteria | 2112 |
| 159 | Ga0395900_0001494 | 3300037418 | Bacteria | 27808 |
| 160 | Ga0395900_0003169 | 3300037418 | Bacteria | 17834 |
| 161 | Ga0395900_0009476 | 3300037418 | Bacteria | 9980 |
| 162 | Ga0395900_0027990 | 3300037418 | Bacteria | 5771 |
| 163 | Ga0395900_0057982 | 3300037418 | Bacteria | 3986 |
| 164 | Ga0395905_0023707 | 3300037471 | Bacteria | 5794 |
| 165 | Ga0395901_0000307 | 3300038443 | Bacteria | 60012 |
| 166 | Ga0395901_0003234 | 3300038443 | Bacteria | 16383 |
| 167 | Ga0436361_0153820 | 3300039447 | Bacteria | 129660 |
| 168 | Ga0436361_0166253 | 3300039447 | Bacteria | 25088 |
| 169 | Ga0436361_0756774 | 3300039447 | Bacteria | 7872 |
| 170 | Ga0439448_0005870 | 3300042005 | Bacteria | 3510 |
| 171 | Ga0450904_000237 | 3300042139 | Bacteria | 12065 |
| 172 | Ga0439458_0001931 | 3300042157 | Bacteria | 5137 |
| 173 | Ga0451577_0001913 | 3300042876 | Bacteria | 26387 |
| 174 | Ga0451577_0012027 | 3300042876 | Bacteria | 8146 |
| 175 | Ga0453683_0001881 | 3300044673 | Bacteria | 17195 |
| 176 | Ga0466965_0004201 | 3300044683 | Bacteria | 6402 |
| 177 | Ga0466965_0006857 | 3300044683 | Bacteria | 5206 |
| 178 | Ga0466966_0002604 | 3300044684 | Bacteria | 11832 |
| 179 | Ga0466966_0010985 | 3300044684 | Bacteria | 6009 |
| 180 | Ga0466966_0018044 | 3300044684 | Bacteria | 4659 |
| 181 | Ga0466963_0055906 | 3300044694 | Bacteria | 2625 |
| 182 | Ga0466964_0000552 | 3300044706 | Bacteria | 11764 |
| 183 | Ga0453684_0000080 | 3300044712 | Bacteria | 411138 |
| 184 | Ga0453684_0188764 | 3300044712 | Bacteria | 2412 |
| 185 | Ga0466957_0000668 | 3300044842 | Bacteria | 17441 |
| 186 | Ga0466957_0010797 | 3300044842 | Bacteria | 5251 |
| 187 | Ga0466959_0016008 | 3300045049 | Bacteria | 5472 |
| 188 | Ga0451576_0001277 | 3300045051 | Bacteria | 43875 |
| 189 | Ga0466958_0062094 | 3300045836 | Bacteria | 2277 |
| 190 | Ga0466967_0018780 | 3300045976 | Bacteria | 5538 |
| 191 | Ga0466967_0030102 | 3300045976 | Bacteria | 4552 |
| 192 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 193 | Ga0495617_000075 | 3300046452 | Bacteria | 78250 |
| 194 | Ga0495617_000189 | 3300046452 | Bacteria | 38970 |
| 195 | Ga0495617_001824 | 3300046452 | Bacteria | 9071 |
| 196 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 197 | Ga0495627_000915 | 3300046453 | Bacteria | 20456 |
| 198 | Ga0495603_0028150 | 3300046455 | Bacteria | 3389 |
| 199 | Ga0495590_0000021 | 3300046457 | Bacteria | 210878 |
| 200 | Ga0495590_0000061 | 3300046457 | Bacteria | 88102 |
| 201 | Ga0495590_0002112 | 3300046457 | Bacteria | 8327 |
| 202 | Ga0495590_0009447 | 3300046457 | Bacteria | 3700 |
| 203 | Ga0495591_000893 | 3300046458 | Bacteria | 20883 |
| 204 | Ga0495638_0000096 | 3300046460 | Bacteria | 141626 |
| 205 | Ga0495638_0000851 | 3300046460 | Bacteria | 31827 |
| 206 | Ga0495638_0002022 | 3300046460 | Bacteria | 17279 |
| 207 | Ga0495638_0018570 | 3300046460 | Bacteria | 4615 |
| 208 | Ga0495653_0000044 | 3300046463 | Bacteria | 115591 |
| 209 | Ga0495653_0007535 | 3300046463 | Bacteria | 8900 |
| 210 | Ga0495653_0090290 | 3300046463 | Bacteria | 2242 |
| 211 | Ga0495650_0000056 | 3300046471 | Bacteria | 307565 |
| 212 | Ga0495650_0000100 | 3300046471 | Bacteria | 213752 |
| 213 | Ga0495650_0000254 | 3300046471 | Bacteria | 103512 |
| 214 | Ga0495650_0000533 | 3300046471 | Bacteria | 55008 |
| 215 | Ga0495650_0000941 | 3300046471 | Bacteria | 33764 |
| 216 | Ga0495650_0001000 | 3300046471 | Bacteria | 32010 |
| 217 | Ga0495650_0001068 | 3300046471 | Bacteria | 30381 |
| 218 | Ga0495650_0007208 | 3300046471 | Bacteria | 6738 |
| 219 | Ga0495650_0013505 | 3300046471 | Bacteria | 4313 |
| 220 | Ga0495582_0032410 | 3300046473 | Bacteria | 2874 |
| 221 | Ga0495605_0000098 | 3300046474 | Bacteria | 109816 |
| 222 | Ga0495605_0000121 | 3300046474 | Bacteria | 102560 |
| 223 | Ga0495605_0000276 | 3300046474 | Bacteria | 57745 |
| 224 | Ga0495605_0000402 | 3300046474 | Bacteria | 39733 |
| 225 | Ga0495639_0005299 | 3300046475 | Bacteria | 5552 |
| 226 | Ga0495639_0009772 | 3300046475 | Bacteria | 4116 |
| 227 | Ga0495662_0000383 | 3300046476 | Bacteria | 19652 |
| 228 | Ga0495584_0000011 | 3300046491 | Bacteria | 208322 |
| 229 | Ga0495584_0000967 | 3300046491 | Bacteria | 18038 |
| 230 | Ga0495584_0001472 | 3300046491 | Bacteria | 14115 |
| 231 | Ga0495584_0002367 | 3300046491 | Bacteria | 10740 |
| 232 | Ga0495584_0005137 | 3300046491 | Bacteria | 6947 |
| 233 | Ga0495584_0008240 | 3300046491 | Bacteria | 5403 |
| 234 | Ga0495584_0013925 | 3300046491 | Bacteria | 4097 |
| 235 | Ga0495585_0000231 | 3300046492 | Bacteria | 57572 |
| 236 | Ga0495585_0000661 | 3300046492 | Bacteria | 31722 |
| 237 | Ga0495585_0000804 | 3300046492 | Bacteria | 27367 |
| 238 | Ga0495585_0001080 | 3300046492 | Bacteria | 22474 |
| 239 | Ga0495585_0003340 | 3300046492 | Bacteria | 10880 |
| 240 | Ga0495585_0018152 | 3300046492 | Bacteria | 4059 |
| 241 | Ga0495585_0021248 | 3300046492 | Bacteria | 3728 |
| 242 | Ga0495596_0000167 | 3300046500 | Bacteria | 46189 |
| 243 | Ga0495596_0001014 | 3300046500 | Bacteria | 16692 |
| 244 | Ga0495596_0001079 | 3300046500 | Bacteria | 16165 |
| 245 | Ga0495596_0006984 | 3300046500 | Bacteria | 5132 |
| 246 | Ga0495596_0008630 | 3300046500 | Bacteria | 4524 |
| 247 | Ga0495596_0008862 | 3300046500 | Bacteria | 4452 |
| 248 | Ga0495607_0000541 | 3300046501 | Bacteria | 36992 |
| 249 | Ga0495607_0002543 | 3300046501 | Bacteria | 14752 |
| 250 | Ga0495607_0002623 | 3300046501 | Bacteria | 14447 |
| 251 | Ga0495607_0002921 | 3300046501 | Bacteria | 13470 |
| 252 | Ga0495607_0003644 | 3300046501 | Bacteria | 11690 |
| 253 | Ga0495607_0006338 | 3300046501 | Bacteria | 8337 |
| 254 | Ga0495607_0011753 | 3300046501 | Bacteria | 5807 |
| 255 | Ga0495607_0038118 | 3300046501 | Bacteria | 2881 |
| 256 | Ga0495583_0000150 | 3300046506 | Bacteria | 117772 |
| 257 | Ga0495583_0000204 | 3300046506 | Bacteria | 99749 |
| 258 | Ga0495583_0000277 | 3300046506 | Bacteria | 82954 |
| 259 | Ga0495583_0000295 | 3300046506 | Bacteria | 79005 |
| 260 | Ga0495583_0003003 | 3300046506 | Bacteria | 13506 |
| 261 | Ga0495583_0003424 | 3300046506 | Bacteria | 12095 |
| 262 | Ga0495583_0006723 | 3300046506 | Bacteria | 7440 |
| 263 | Ga0495583_0006809 | 3300046506 | Bacteria | 7381 |
| 264 | Ga0495583_0011338 | 3300046506 | Bacteria | 5124 |
| 265 | Ga0495606_0000080 | 3300046507 | Bacteria | 161866 |
| 266 | Ga0495606_0000093 | 3300046507 | Bacteria | 152281 |
| 267 | Ga0495606_0000099 | 3300046507 | Bacteria | 150950 |
| 268 | Ga0495606_0000208 | 3300046507 | Bacteria | 103578 |
| 269 | Ga0495606_0000223 | 3300046507 | Bacteria | 100501 |
| 270 | Ga0495606_0001227 | 3300046507 | Bacteria | 35902 |
| 271 | Ga0495606_0002619 | 3300046507 | Bacteria | 20530 |
| 272 | Ga0495606_0003499 | 3300046507 | Bacteria | 16627 |
| 273 | Ga0495606_0007328 | 3300046507 | Bacteria | 9919 |
| 274 | Ga0495606_0012672 | 3300046507 | Bacteria | 6731 |
| 275 | Ga0495606_0046827 | 3300046507 | Bacteria | 2855 |
| 276 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 277 | Ga0495610_0000670 | 3300046512 | Bacteria | 33331 |
| 278 | Ga0495610_0000833 | 3300046512 | Bacteria | 28846 |
| 279 | Ga0495610_0015472 | 3300046512 | Bacteria | 4430 |
| 280 | Ga0495616_0000513 | 3300046513 | Bacteria | 29356 |
| 281 | Ga0495616_0001343 | 3300046513 | Bacteria | 17155 |
| 282 | Ga0495616_0002023 | 3300046513 | Bacteria | 13637 |
| 283 | Ga0495616_0003717 | 3300046513 | Bacteria | 9735 |
| 284 | Ga0495616_0008346 | 3300046513 | Bacteria | 6142 |
| 285 | Ga0495616_0009559 | 3300046513 | Bacteria | 5661 |
| 286 | Ga0495616_0017117 | 3300046513 | Bacteria | 4000 |
| 287 | Ga0495616_0024879 | 3300046513 | Bacteria | 3205 |
| 288 | Ga0495630_0000083 | 3300046517 | Bacteria | 74973 |
| 289 | Ga0495630_0025319 | 3300046517 | Bacteria | 4386 |
| 290 | Ga0495631_0001460 | 3300046518 | Bacteria | 14333 |
| 291 | Ga0495631_0006287 | 3300046518 | Bacteria | 6146 |
| 292 | Ga0495632_0000648 | 3300046519 | Bacteria | 31962 |
| 293 | Ga0495632_0001800 | 3300046519 | Bacteria | 17287 |
| 294 | Ga0495632_0002267 | 3300046519 | Bacteria | 14828 |
| 295 | Ga0495637_0000047 | 3300046520 | Bacteria | 106648 |
| 296 | Ga0495637_0001447 | 3300046520 | Bacteria | 13972 |
| 297 | Ga0495637_0008919 | 3300046520 | Bacteria | 4907 |
| 298 | Ga0495643_0000142 | 3300046522 | Bacteria | 115533 |
| 299 | Ga0495643_0000209 | 3300046522 | Bacteria | 89487 |
| 300 | Ga0495643_0000672 | 3300046522 | Bacteria | 40238 |
| 301 | Ga0495643_0002391 | 3300046522 | Bacteria | 14978 |
| 302 | Ga0495643_0006507 | 3300046522 | Bacteria | 7685 |
| 303 | Ga0495643_0013124 | 3300046522 | Bacteria | 4973 |
| 304 | Ga0495643_0015589 | 3300046522 | Bacteria | 4489 |
| 305 | Ga0495644_0000594 | 3300046523 | Bacteria | 15164 |
| 306 | Ga0495644_0006197 | 3300046523 | Bacteria | 4648 |
| 307 | Ga0495644_0007776 | 3300046523 | Bacteria | 4133 |
| 308 | Ga0495648_0000017 | 3300046524 | Bacteria | 283100 |
| 309 | Ga0495648_0000305 | 3300046524 | Bacteria | 54610 |
| 310 | Ga0495648_0001222 | 3300046524 | Bacteria | 25744 |
| 311 | Ga0495648_0001823 | 3300046524 | Bacteria | 20505 |
| 312 | Ga0495648_0004635 | 3300046524 | Bacteria | 11678 |
| 313 | Ga0495648_0006199 | 3300046524 | Bacteria | 9798 |
| 314 | Ga0495648_0007998 | 3300046524 | Bacteria | 8385 |
| 315 | Ga0495648_0020281 | 3300046524 | Bacteria | 4640 |
| 316 | Ga0495648_0021344 | 3300046524 | Bacteria | 4487 |
| 317 | Ga0495666_0004100 | 3300046526 | Bacteria | 7359 |
| 318 | Ga0495666_0037295 | 3300046526 | Bacteria | 2364 |
| 319 | Ga0495642_0001019 | 3300046528 | Bacteria | 13015 |
| 320 | Ga0495642_0001727 | 3300046528 | Bacteria | 9405 |
| 321 | Ga0495642_0001772 | 3300046528 | Bacteria | 9310 |
| 322 | Ga0495642_0002181 | 3300046528 | Bacteria | 8041 |
| 323 | Ga0495652_0004868 | 3300046529 | Bacteria | 12746 |
| 324 | Ga0495654_0000030 | 3300046530 | Bacteria | 216715 |
| 325 | Ga0495654_0008889 | 3300046530 | Bacteria | 5523 |
| 326 | Ga0495654_0011932 | 3300046530 | Bacteria | 4685 |
| 327 | Ga0495654_0018310 | 3300046530 | Bacteria | 3672 |
| 328 | Ga0495665_0006843 | 3300046531 | Bacteria | 6150 |
| 329 | Ga0495586_0011094 | 3300046535 | Bacteria | 4788 |
| 330 | Ga0495586_0017583 | 3300046535 | Bacteria | 3801 |
| 331 | Ga0495587_0025234 | 3300046536 | Bacteria | 3632 |
| 332 | Ga0495587_0034417 | 3300046536 | Bacteria | 3055 |
| 333 | Ga0495609_0000028 | 3300046538 | Bacteria | 219908 |
| 334 | Ga0495609_0000235 | 3300046538 | Bacteria | 52774 |
| 335 | Ga0495609_0000240 | 3300046538 | Bacteria | 52192 |
| 336 | Ga0495609_0000872 | 3300046538 | Bacteria | 22122 |
| 337 | Ga0495609_0007111 | 3300046538 | Bacteria | 5629 |
| 338 | Ga0495609_0007725 | 3300046538 | Bacteria | 5330 |
| 339 | Ga0495597_0000017 | 3300046542 | Bacteria | 165491 |
| 340 | Ga0495597_0000257 | 3300046542 | Bacteria | 48447 |
| 341 | Ga0495597_0002408 | 3300046542 | Bacteria | 11907 |
| 342 | Ga0495597_0004838 | 3300046542 | Bacteria | 7265 |
| 343 | Ga0495597_0005826 | 3300046542 | Bacteria | 6448 |
| 344 | Ga0495597_0010618 | 3300046542 | Bacteria | 4492 |
| 345 | Ga0495622_0000044 | 3300046557 | Bacteria | 115528 |
| 346 | Ga0495622_0000058 | 3300046557 | Bacteria | 97458 |
| 347 | Ga0495622_0019659 | 3300046557 | Bacteria | 3144 |
| 348 | Ga0495633_0000070 | 3300046558 | Bacteria | 133333 |
| 349 | Ga0495633_0000394 | 3300046558 | Bacteria | 45904 |
| 350 | Ga0495633_0000415 | 3300046558 | Bacteria | 44389 |
| 351 | Ga0495633_0001217 | 3300046558 | Bacteria | 20751 |
| 352 | Ga0495633_0001238 | 3300046558 | Bacteria | 20442 |
| 353 | Ga0495633_0002108 | 3300046558 | Bacteria | 14289 |
| 354 | Ga0495633_0005389 | 3300046558 | Bacteria | 7839 |
| 355 | Ga0495668_0000101 | 3300046616 | Bacteria | 137289 |
| 356 | Ga0495668_0000143 | 3300046616 | Bacteria | 107442 |
| 357 | Ga0495668_0000286 | 3300046616 | Bacteria | 69771 |
| 358 | Ga0495668_0000647 | 3300046616 | Bacteria | 41830 |
| 359 | Ga0495668_0002087 | 3300046616 | Bacteria | 17292 |
| 360 | Ga0495668_0002663 | 3300046616 | Bacteria | 14338 |
| 361 | Ga0495668_0003929 | 3300046616 | Bacteria | 10853 |
| 362 | Ga0495668_0006324 | 3300046616 | Bacteria | 7787 |
| 363 | Ga0495668_0007058 | 3300046616 | Bacteria | 7235 |
| 364 | Ga0495668_0009671 | 3300046616 | Bacteria | 5895 |
| 365 | Ga0495668_0012953 | 3300046616 | Bacteria | 4936 |
| 366 | Ga0495668_0015524 | 3300046616 | Bacteria | 4444 |
| 367 | Ga0495668_0038616 | 3300046616 | Bacteria | 2667 |
| 368 | Ga0495634_0014674 | 3300046642 | Bacteria | 5640 |
| 369 | Ga0495611_0004010 | 3300046648 | Bacteria | 6412 |
| 370 | Ga0495611_0005790 | 3300046648 | Bacteria | 5273 |
| 371 | Ga0495611_0007547 | 3300046648 | Bacteria | 4612 |
| 372 | Ga0495611_0011654 | 3300046648 | Bacteria | 3729 |
| 373 | Ga0495611_0013886 | 3300046648 | Bacteria | 3435 |
| 374 | Ga0495611_0018727 | 3300046648 | Bacteria | 2970 |
| 375 | Ga0495625_0000338 | 3300046660 | Bacteria | 71524 |
| 376 | Ga0495625_0000556 | 3300046660 | Bacteria | 54663 |
| 377 | Ga0495625_0002771 | 3300046660 | Bacteria | 18506 |
| 378 | Ga0495625_0003853 | 3300046660 | Bacteria | 14496 |
| 379 | Ga0495625_0014887 | 3300046660 | Bacteria | 6186 |
| 380 | Ga0495625_0016511 | 3300046660 | Bacteria | 5807 |
| 381 | Ga0495625_0045337 | 3300046660 | Bacteria | 3178 |
| 382 | Ga0495625_0047241 | 3300046660 | Bacteria | 3104 |
| 383 | Ga0495635_0049909 | 3300046663 | Bacteria | 2885 |
| 384 | Ga0495659_0000064 | 3300046664 | Bacteria | 47646 |
| 385 | Ga0495659_0000308 | 3300046664 | Bacteria | 19457 |
| 386 | Ga0495661_0000862 | 3300046665 | Bacteria | 28269 |
| 387 | Ga0495661_0002077 | 3300046665 | Bacteria | 15719 |
| 388 | Ga0495661_0002137 | 3300046665 | Bacteria | 15482 |
| 389 | Ga0495661_0004303 | 3300046665 | Bacteria | 10329 |
| 390 | Ga0495661_0004545 | 3300046665 | Bacteria | 9994 |
| 391 | Ga0495661_0010939 | 3300046665 | Bacteria | 6170 |
| 392 | Ga0495661_0010992 | 3300046665 | Bacteria | 6148 |
| 393 | Ga0495661_0026485 | 3300046665 | Bacteria | 3735 |
| 394 | Ga0495661_0031596 | 3300046665 | Bacteria | 3357 |
| 395 | Ga0495661_0033983 | 3300046665 | Bacteria | 3212 |
| 396 | Ga0495588_0000070 | 3300046674 | Bacteria | 227611 |
| 397 | Ga0495588_0003187 | 3300046674 | Bacteria | 7102 |
| 398 | Ga0495669_0001025 | 3300046684 | Bacteria | 11649 |
| 399 | Ga0495669_0001424 | 3300046684 | Bacteria | 9846 |
| 400 | Ga0495613_0022050 | 3300046689 | Bacteria | 4747 |
| 401 | Ga0495670_0010706 | 3300046691 | Bacteria | 4507 |
| 402 | Ga0495671_0000026 | 3300046692 | Bacteria | 237110 |
| 403 | Ga0495671_0000093 | 3300046692 | Bacteria | 83958 |
| 404 | Ga0495671_0004255 | 3300046692 | Bacteria | 8610 |
| 405 | Ga0495671_0006818 | 3300046692 | Bacteria | 6562 |
| 406 | Ga0495649_0001152 | 3300046694 | Bacteria | 20593 |
| 407 | Ga0495649_0001587 | 3300046694 | Bacteria | 17010 |
| 408 | Ga0495649_0001686 | 3300046694 | Bacteria | 16376 |
| 409 | Ga0495649_0002639 | 3300046694 | Bacteria | 12495 |
| 410 | Ga0495649_0006769 | 3300046694 | Bacteria | 7100 |
| 411 | Ga0495589_0000218 | 3300046794 | Bacteria | 48625 |
| 412 | Ga0495589_0001502 | 3300046794 | Bacteria | 13425 |
| 413 | Ga0495589_0002489 | 3300046794 | Bacteria | 10306 |
| 414 | Ga0495589_0003933 | 3300046794 | Bacteria | 7973 |
| 415 | Ga0495589_0010022 | 3300046794 | Bacteria | 4923 |
| 416 | Ga0495660_0000113 | 3300046810 | Bacteria | 86593 |
| 417 | Ga0495660_0000538 | 3300046810 | Bacteria | 31032 |
| 418 | Ga0495660_0000631 | 3300046810 | Bacteria | 27411 |
| 419 | Ga0495660_0001129 | 3300046810 | Bacteria | 19041 |
| 420 | Ga0495660_0003212 | 3300046810 | Bacteria | 10154 |
| 421 | Ga0495660_0005091 | 3300046810 | Bacteria | 7897 |
| 422 | Ga0495660_0013362 | 3300046810 | Bacteria | 4758 |
| 423 | Ga0495660_0018625 | 3300046810 | Bacteria | 3991 |
| 424 | Ga0495660_0032229 | 3300046810 | Bacteria | 2942 |
| 425 | Ga0495581_0021886 | 3300047315 | Bacteria | 3706 |
| 426 | Ga0495636_0000880 | 3300047318 | Bacteria | 11120 |
| 427 | Ga0495636_0003298 | 3300047318 | Bacteria | 6252 |
| 428 | Ga0495636_0005337 | 3300047318 | Bacteria | 5050 |
| 429 | Ga0495674_0015016 | 3300047319 | Bacteria | 7248 |
| 430 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 431 | Ga0495672_0000245 | 3300047320 | Bacteria | 76419 |
| 432 | Ga0495672_0000566 | 3300047320 | Bacteria | 41811 |
| 433 | Ga0495672_0001524 | 3300047320 | Bacteria | 22682 |
| 434 | Ga0495672_0001701 | 3300047320 | Bacteria | 21332 |
| 435 | Ga0495672_0003873 | 3300047320 | Bacteria | 12581 |
| 436 | Ga0495672_0004351 | 3300047320 | Bacteria | 11644 |
| 437 | Ga0495672_0010490 | 3300047320 | Bacteria | 6599 |
| 438 | Ga0495672_0026359 | 3300047320 | Bacteria | 3710 |
| 439 | Ga0495676_0000635 | 3300047321 | Bacteria | 29072 |
| 440 | Ga0495676_0003661 | 3300047321 | Bacteria | 13942 |
| 441 | Ga0495676_0089939 | 3300047321 | Bacteria | 2299 |
| 442 | Ga0495680_0031285 | 3300047322 | Bacteria | 4333 |
| 443 | Ga0495680_0062296 | 3300047322 | Bacteria | 2868 |
| 444 | Ga0495683_0000088 | 3300047323 | Bacteria | 92118 |
| 445 | Ga0495683_0001399 | 3300047323 | Bacteria | 15929 |
| 446 | Ga0495683_0003839 | 3300047323 | Bacteria | 8664 |
| 447 | Ga0495683_0021370 | 3300047323 | Bacteria | 3335 |
| 448 | Ga0495683_0027698 | 3300047323 | Bacteria | 2897 |
| 449 | Ga0495687_000057 | 3300047443 | Bacteria | 186224 |
| 450 | Ga0495687_000256 | 3300047443 | Bacteria | 71778 |
| 451 | Ga0495687_000288 | 3300047443 | Bacteria | 66346 |
| 452 | Ga0495687_001662 | 3300047443 | Bacteria | 19944 |
| 453 | Ga0495687_002171 | 3300047443 | Bacteria | 16339 |
| 454 | Ga0495687_004834 | 3300047443 | Bacteria | 8866 |
| 455 | Ga0495687_005242 | 3300047443 | Bacteria | 8330 |
| 456 | Ga0495687_006298 | 3300047443 | Bacteria | 7312 |
| 457 | Ga0495687_010266 | 3300047443 | Bacteria | 5146 |
| 458 | Ga0495687_010547 | 3300047443 | Bacteria | 5060 |
| 459 | Ga0495675_0009848 | 3300047444 | Bacteria | 5960 |
| 460 | Ga0495677_0000161 | 3300047445 | Bacteria | 32173 |
| 461 | Ga0495677_0000285 | 3300047445 | Bacteria | 22182 |
| 462 | Ga0495677_0000526 | 3300047445 | Bacteria | 16029 |
| 463 | Ga0495677_0001852 | 3300047445 | Bacteria | 8456 |
| 464 | Ga0495677_0004724 | 3300047445 | Bacteria | 5191 |
| 465 | Ga0495677_0005155 | 3300047445 | Bacteria | 4971 |
| 466 | Ga0495679_004809 | 3300047446 | Bacteria | 6109 |
| 467 | Ga0495685_000044 | 3300047447 | Bacteria | 50670 |
| 468 | Ga0495673_0000069 | 3300047469 | Bacteria | 218170 |
| 469 | Ga0495673_0000080 | 3300047469 | Bacteria | 201831 |
| 470 | Ga0495673_0000203 | 3300047469 | Bacteria | 89918 |
| 471 | Ga0495673_0003510 | 3300047469 | Bacteria | 10315 |
| 472 | Ga0495681_0002303 | 3300047470 | Bacteria | 13735 |
| 473 | Ga0495681_0002335 | 3300047470 | Bacteria | 13627 |
| 474 | Ga0495681_0007296 | 3300047470 | Bacteria | 7089 |
| 475 | Ga0495681_0012714 | 3300047470 | Bacteria | 4929 |
| 476 | Ga0495686_0000212 | 3300047472 | Bacteria | 107418 |
| 477 | Ga0495686_0000612 | 3300047472 | Bacteria | 49335 |
| 478 | Ga0495686_0000722 | 3300047472 | Bacteria | 44277 |
| 479 | Ga0495686_0000799 | 3300047472 | Bacteria | 40834 |
| 480 | Ga0495686_0015576 | 3300047472 | Bacteria | 5185 |
| 481 | Ga0495593_0026008 | 3300047673 | Bacteria | 3235 |
| 482 | Ga0495602_0006516 | 3300048088 | Bacteria | 12245 |
| 483 | Ga0495626_0000030 | 3300048091 | Bacteria | 202562 |
| 484 | Ga0495626_0001112 | 3300048091 | Bacteria | 22702 |
| 485 | Ga0495626_0001336 | 3300048091 | Bacteria | 19967 |
| 486 | Ga0495626_0001875 | 3300048091 | Bacteria | 15726 |
| 487 | Ga0495626_0019683 | 3300048091 | Bacteria | 3372 |
| 488 | Ga0495626_0025480 | 3300048091 | Bacteria | 2892 |
| 489 | Ga0496102_0000196 | 3300048905 | Bacteria | 82747 |
| 490 | Ga0496102_0002399 | 3300048905 | Bacteria | 15993 |
| 491 | Ga0496102_0086971 | 3300048905 | Bacteria | 2887 |
| 492 | Ga0496102_0103906 | 3300048905 | Bacteria | 2642 |
| 493 | Ga0496103_0029922 | 3300048906 | Bacteria | 3311 |
| 494 | Ga0496105_0098473 | 3300048908 | Bacteria | 2415 |
| 495 | Ga0496107_0047232 | 3300048910 | Bacteria | 3101 |
| 496 | Ga0496109_0083296 | 3300048912 | Bacteria | 2949 |
| 497 | Ga0496110_0002992 | 3300048913 | Bacteria | 12821 |
| 498 | Ga0496110_0006313 | 3300048913 | Bacteria | 9361 |
| 499 | Ga0496111_0005490 | 3300048914 | Bacteria | 8136 |
| 500 | Ga0496111_0047101 | 3300048914 | Bacteria | 3104 |
| 501 | Ga0496112_0054585 | 3300048915 | Bacteria | 3926 |
| 502 | Ga0496114_0051371 | 3300048917 | Bacteria | 3432 |
| 503 | Ga0496115_0062264 | 3300048918 | Bacteria | 3009 |
| 504 | Ga0496116_0037327 | 3300048919 | Bacteria | 3390 |
| 505 | Ga0496117_0000132 | 3300048920 | Bacteria | 162117 |
| 506 | Ga0496118_0000099 | 3300048921 | Bacteria | 160412 |
| 507 | Ga0496120_0017696 | 3300048923 | Bacteria | 4609 |
| 508 | Ga0496122_0004240 | 3300048925 | Bacteria | 17984 |
| 509 | Ga0496122_0005480 | 3300048925 | Bacteria | 15100 |
| 510 | Ga0496122_0009038 | 3300048925 | Bacteria | 10577 |
| 511 | Ga0496122_0023073 | 3300048925 | Bacteria | 5503 |
| 512 | Ga0496122_0054954 | 3300048925 | Bacteria | 2984 |
| 513 | Ga0496123_0003509 | 3300048926 | Bacteria | 17468 |
| 514 | Ga0496123_0003741 | 3300048926 | Bacteria | 16678 |
| 515 | Ga0496123_0004584 | 3300048926 | Bacteria | 14394 |
| 516 | Ga0496123_0014552 | 3300048926 | Bacteria | 6512 |
| 517 | Ga0496123_0022761 | 3300048926 | Bacteria | 4818 |
| 518 | Ga0496124_0011144 | 3300048927 | Bacteria | 9020 |
| 519 | Ga0496124_0020367 | 3300048927 | Bacteria | 6132 |
| 520 | Ga0496124_0024495 | 3300048927 | Bacteria | 5484 |
| 521 | Ga0496124_0026152 | 3300048927 | Bacteria | 5268 |
| 522 | Ga0496124_0047348 | 3300048927 | Bacteria | 3679 |
| 523 | Ga0496124_0147220 | 3300048927 | Bacteria | 1852 |
| 524 | Ga0496125_0002623 | 3300048928 | Bacteria | 23045 |
| 525 | Ga0496125_0005966 | 3300048928 | Bacteria | 13335 |
| 526 | Ga0496125_0034264 | 3300048928 | Bacteria | 4478 |
| 527 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 528 | Ga0495678_000200 | 3300049459 | Bacteria | 70334 |
| 529 | Ga0495678_000230 | 3300049459 | Bacteria | 64445 |
| 530 | Ga0495678_000523 | 3300049459 | Bacteria | 37505 |
| 531 | Ga0495678_001473 | 3300049459 | Bacteria | 18420 |
| 532 | Ga0495678_001481 | 3300049459 | Bacteria | 18350 |
| 533 | Ga0495678_002815 | 3300049459 | Bacteria | 11286 |
| 534 | Ga0495678_002857 | 3300049459 | Bacteria | 11183 |
| 535 | Ga0495682_0001242 | 3300049460 | Bacteria | 14423 |
| 536 | Ga0495682_0001674 | 3300049460 | Bacteria | 11313 |
| 537 | Ga0501227_001645 | 3300049665 | Bacteria | 4982 |
| 538 | Ga0501269_000096 | 3300049766 | Bacteria | 27393 |
| 539 | Ga0501035_0004391 | 3300049822 | Bacteria | 13383 |
| 540 | nmdc:mga0qj67_54920_c1 | 3300050509 | Bacteria | 3154 |
| 541 | nmdc:mga0n895_2750_c1 | 3300050512 | Bacteria | 13887 |
| 542 | nmdc:mga0rr50_38275_c1 | 3300050513 | Bacteria | 3469 |
| 543 | nmdc:mga08x19_34190_c1 | 3300050514 | Bacteria | 3212 |
| 544 | nmdc:mga0a205_68281_c1 | 3300050515 | Bacteria | 3433 |
| 545 | nmdc:mga0a205_9670_c1 | 3300050515 | Bacteria | 8829 |
| 546 | Ga0500644_0000924 | 3300053088 | Bacteria | 9347 |
| 547 | Ga0500651_0013897 | 3300053093 | Bacteria | 4916 |
| 548 | Ga0500641_0003080 | 3300053096 | Bacteria | 5909 |
| 549 | Ga0500618_001070 | 3300053125 | Bacteria | 13517 |
| 550 | Ga0500586_000020 | 3300053145 | Bacteria | 30971 |
| 551 | Ga0500586_002907 | 3300053145 | Bacteria | 3964 |
| 552 | 2601670196 | 2600255292 | Bacteria | 6300551 |
| 553 | 2643791037 | 2643221554 | Bacteria | 6603920 |
| 554 | 2643797571 | 2643221556 | Bacteria | 7251154 |
| 555 | 2643884606 | 2643221574 | Bacteria | 2789653 |
| 556 | 2644215243 | 2643221638 | Bacteria | 6579467 |
| 557 | 2644254615 | 2643221645 | Bacteria | 7207331 |
| 558 | 2644351446 | 2643221663 | Bacteria | 3425771 |
| 559 | 2644360163 | 2643221664 | Bacteria | 7272945 |
| 560 | 2644470647 | 2643221684 | Bacteria | 7145183 |
| 561 | 2644553261 | 2643221699 | Bacteria | 5731501 |
| 562 | 2738710464 | 2738541275 | Bacteria | 4830863 |
| 563 | 2738741918 | 2738541280 | Bacteria | 6630198 |
| 564 | 2738827021 | 2738541297 | Bacteria | 6549566 |
| 565 | 2738845901 | 2738541300 | Bacteria | 6675882 |
| 566 | 2738848889 | 2738541301 | Bacteria | 4834102 |
| 567 | 2738864618 | 2738541304 | Bacteria | 4833665 |
| 568 | 2739150818 | 2738541357 | Bacteria | 6549408 |
| 569 | 2739192737 | 2738543003 | Bacteria | 6549560 |
| 570 | 2739276796 | 2738543018 | Bacteria | 6718814 |
| 571 | 2739297136 | 2738543022 | Bacteria | 4835059 |
| 572 | 2739319214 | 2738543026 | Bacteria | 6549408 |
| 573 | 2739337455 | 2738543029 | Bacteria | 6549249 |
| 574 | 2739345840 | 2738543030 | Bacteria | 6719714 |
| 575 | 2739358814 | 2738543033 | Bacteria | 4833336 |
| 576 | 2809144071 | 2808606418 | Bacteria | 6724496 |
| 577 | 2821136439 | 2821131069 | Bacteria | 6108407 |
| 578 | 2842712125 | 2842711865 | Bacteria | 7155354 |
| 579 | 2857553074 | 2857547612 | Bacteria | 6179999 |
| 580 | 2857557792 | 2857553236 | Bacteria | 6166726 |
| 581 | 2857559661 | 2857558681 | Bacteria | 6617694 |
| 582 | 2857568236 | 2857564685 | Bacteria | 6290584 |
| 583 | 2885084278 | 2885080285 | Bacteria | 6355622 |
| 584 | 2904428598 | 2904424332 | Bacteria | 7633521 |
| 585 | 2919477170 | 2919476304 | Bacteria | 5888696 |
| 586 | 2928100564 | 2928100450 | Bacteria | 4837635 |
| 587 | 2928960627 | 2928959182 | Bacteria | 4725774 |
| 588 | 2928974185 | 2928972540 | Bacteria | 3058286 |
| 589 | 2932413703 | 2932410948 | Bacteria | 6312192 |
| 590 | 2932417763 | 2932416698 | Bacteria | 6315112 |
| 591 | 2941487860 | 2941485952 | Bacteria | 3591484 |
| 592 | 2977240852 | 2977240413 | Bacteria | 3191065 |
| 593 | 8002869633 | 8002869464 | Bacteria | 3588529 |
| 594 | 8047678866 | 8047673197 | Bacteria | 7395230 |
| 595 | Ga0495583_0008881 | |||
| 596 | JGI25152J39213_1000003 | |||
| 597 | JGI25150J39212_1000325 | |||
| 598 | JGI25159J45721_1002066 | |||
| 599 | JGI25159J45721_1002463 | |||
| 600 | JGI25153J46596_10010601 | |||
| 601 | rootL2_10004162 | |||
| 602 | JGI25161J50226_1000830 | |||
| 603 | Ga0055529_1000152 | |||
| 604 | Ga0055526_1000025 | |||
| 605 | Ga0055526_1000079 | |||
| 606 | Ga0055526_1000467 | |||
| 607 | Ga0055526_1000514 | |||
| 608 | Ga0055537_1000098 | |||
| 609 | Ga0055524_1000090 | |||
| 610 | Ga0055524_1000696 | |||
| 611 | Ga0055524_1011614 | |||
| 612 | Ga0055536_1001410 | |||
| 613 | Ga0055534_1000009 | |||
| 614 | Ga0055534_1005698 | |||
| 615 | Ga0055528_1000012 | |||
| 616 | Ga0055528_1005576 | |||
| 617 | Ga0055530_10001584 | |||
| 618 | Ga0055543_1001111 | |||
| 619 | Ga0055543_1002742 | |||
| 620 | Ga0065165_1000051 | |||
| 621 | Ga0065165_1005229 | |||
| 622 | Ga0070658_10049742 | |||
| 623 | Ga0070658_10096718 | |||
| 624 | Ga0070680_100021120 | |||
| 625 | Ga0070660_100036848 | |||
| 626 | Ga0070689_100005216 | |||
| 627 | Ga0070671_100008369 | |||
| 628 | Ga0070659_100050580 | |||
| 629 | Ga0070714_100054936 | |||
| 630 | Ga0070710_10026745 | |||
| 631 | Ga0070708_100021206 | |||
| 632 | Ga0070681_10118016 | |||
| 633 | Ga0070706_100008026 | |||
| 634 | Ga0070698_100004950 | |||
| 635 | Ga0070684_100008554 | |||
| 636 | Ga0068855_100121551 | |||
| 637 | Ga0070664_100073356 | |||
| 638 | Ga0068852_100001921 | |||
| 639 | Ga0068859_100018821 | |||
| 640 | Ga0068851_10011558 | |||
| 641 | Ga0068858_100014283 | |||
| 642 | Ga0068860_100004026 | |||
| 643 | Ga0075428_100006344 | |||
| 644 | Ga0075428_100037453 | |||
| 645 | Ga0075430_100045767 | |||
| 646 | Ga0075431_100023523 | |||
| 647 | Ga0075433_10057598 | |||
| 648 | Ga0075433_10121249 | |||
| 649 | Ga0075434_100004850 | |||
| 650 | Ga0075434_100090191 | |||
| 651 | Ga0075436_100060843 | |||
| 652 | Ga0097620_100018821 | |||
| 653 | Ga0099826_10000001 | |||
| 654 | Ga0105244_10000891 | |||
| 655 | Ga0105244_10000981 | |||
| 656 | Ga0105244_10032501 | |||
| 657 | Ga0111539_10061455 | |||
| 658 | Ga0105241_10005321 | |||
| 659 | Ga0105242_10008974 | |||
| 660 | Ga0105237_10007063 | |||
| 661 | Ga0105237_10051228 | |||
| 662 | Ga0157371_10000399 | |||
| 663 | Ga0157371_10010317 | |||
| 664 | Ga0157371_10029129 | |||
| 665 | Ga0157371_10034644 | |||
| 666 | Ga0157370_10010757 | |||
| 667 | Ga0157369_10037576 | |||
| 668 | Ga0182006_1000080 | |||
| 669 | Ga0182006_1000097 | |||
| 670 | Ga0182007_10000227 | |||
| 671 | Ga0182005_1000016 | |||
| 672 | Ga0182005_1000038 | |||
| 673 | Ga0213872_10000005 | |||
| 674 | Ga0209436_100099 | |||
| 675 | Ga0209436_100273 | |||
| 676 | Ga0209563_100015 | |||
| 677 | Ga0207425_1000014 | |||
| 678 | Ga0207425_1000053 | |||
| 679 | Ga0209646_1000190 | |||
| 680 | Ga0209677_103085 | |||
| 681 | Ga0209148_1000272 | |||
| 682 | Ga0209129_1000017 | |||
| 683 | Ga0209565_1000015 | |||
| 684 | Ga0209565_1000558 | |||
| 685 | Ga0209455_1000070 | |||
| 686 | Ga0209673_1000017 | |||
| 687 | Ga0209673_1009290 | |||
| 688 | Ga0209130_1000063 | |||
| 689 | Ga0209130_1001797 | |||
| 690 | Ga0209130_1001856 | |||
| 691 | Ga0209675_1000012 | |||
| 692 | Ga0209675_1000655 | |||
| 693 | Ga0209675_1004711 | |||
| 694 | Ga0209676_1000115 | |||
| 695 | Ga0209025_1009248 | |||
| 696 | Ga0209564_1000016 | |||
| 697 | Ga0209564_1000027 | |||
| 698 | Ga0209564_1000047 | |||
| 699 | Ga0209564_1000184 | |||
| 700 | Ga0209564_1002884 | |||
| 701 | Ga0209758_1000038 | |||
| 702 | Ga0209758_1009637 | |||
| 703 | Ga0209050_1000011 | |||
| 704 | Ga0209050_1000159 | |||
| 705 | Ga0209050_1001486 | |||
| 706 | Ga0209050_1005040 | |||
| 707 | Ga0209256_1000005 | |||
| 708 | Ga0209256_1000138 | |||
| 709 | Ga0209256_1000290 | |||
| 710 | Ga0209256_1000593 | |||
| 711 | Ga0209256_1005123 | |||
| 712 | Ga0207426_1000654 | |||
| 713 | Ga0209257_1000003 | |||
| 714 | Ga0209257_1000090 | |||
| 715 | Ga0207655_1004025 | |||
| 716 | Ga0207680_10028010 | |||
| 717 | Ga0207705_10001666 | |||
| 718 | Ga0207684_10021521 | |||
| 719 | Ga0207654_10002340 | |||
| 720 | Ga0207707_10113795 | |||
| 721 | Ga0207657_10019062 | |||
| 722 | Ga0207657_10023264 | |||
| 723 | Ga0207652_10035614 | |||
| 724 | Ga0207646_10009557 | |||
| 725 | Ga0207664_10048689 | |||
| 726 | Ga0207690_10036169 | |||
| 727 | Ga0207690_10036678 | |||
| 728 | Ga0207690_10038026 | |||
| 729 | Ga0207686_10004244 | |||
| 730 | Ga0207691_10015946 | |||
| 731 | Ga0207703_10025686 | |||
| 732 | Ga0207674_10009103 | |||
| 733 | Ga0207674_10036681 | |||
| 734 | Ga0207698_10007362 | |||
| 735 | Ga0209281_1004269 | |||
| 736 | Ga0209282_1000001 | |||
| 737 | Ga0268266_10001639 | |||
| 738 | Ga0268264_10005333 | |||
| 739 | Ga0307408_100000201 | |||
| 740 | Ga0307408_100000244 | |||
| 741 | Ga0307408_100021893 | |||
| 742 | Ga0265314_10036835 | |||
| 743 | Ga0307412_10000683 | |||
| 744 | Ga0307416_100011300 | |||
| 745 | Ga0307414_10011321 | |||
| 746 | Ga0307414_10046584 | |||
| 747 | Ga0373925_0072945 | |||
| 748 | Ga0395899_0000207 | |||
| 749 | Ga0395899_0014688 | |||
| 750 | Ga0395899_0024233 | |||
| 751 | Ga0395899_0030403 | |||
| 752 | Ga0395899_0098493 | |||
| 753 | Ga0395900_0001494 | |||
| 754 | Ga0395900_0003169 | |||
| 755 | Ga0395900_0009476 | |||
| 756 | Ga0395900_0027990 | |||
| 757 | Ga0395900_0057982 | |||
| 758 | Ga0395905_0023707 | |||
| 759 | Ga0395901_0000307 | |||
| 760 | Ga0395901_0003234 | |||
| 761 | Ga0436361_0153820 | |||
| 762 | Ga0436361_0166253 | |||
| 763 | Ga0436361_0756774 | |||
| 764 | Ga0439448_0005870 | |||
| 765 | Ga0450904_000237 | |||
| 766 | Ga0439458_0001931 | |||
| 767 | Ga0451577_0001913 | |||
| 768 | Ga0451577_0012027 | |||
| 769 | Ga0453683_0001881 | |||
| 770 | Ga0466965_0004201 | |||
| 771 | Ga0466965_0006857 | |||
| 772 | Ga0466966_0002604 | |||
| 773 | Ga0466966_0010985 | |||
| 774 | Ga0466966_0018044 | |||
| 775 | Ga0466963_0055906 | |||
| 776 | Ga0466964_0000552 | |||
| 777 | Ga0453684_0000080 | |||
| 778 | Ga0453684_0188764 | |||
| 779 | Ga0466957_0000668 | |||
| 780 | Ga0466957_0010797 | |||
| 781 | Ga0466959_0016008 | |||
| 782 | Ga0451576_0001277 | |||
| 783 | Ga0466958_0062094 | |||
| 784 | Ga0466967_0018780 | |||
| 785 | Ga0466967_0030102 | |||
| 786 | Ga0495617_000002 | |||
| 787 | Ga0495617_000075 | |||
| 788 | Ga0495617_000189 | |||
| 789 | Ga0495617_001824 | |||
| 790 | Ga0495627_000011 | |||
| 791 | Ga0495627_000915 | |||
| 792 | Ga0495603_0028150 | |||
| 793 | Ga0495590_0000021 | |||
| 794 | Ga0495590_0000061 | |||
| 795 | Ga0495590_0002112 | |||
| 796 | Ga0495590_0009447 | |||
| 797 | Ga0495591_000893 | |||
| 798 | Ga0495638_0000096 | |||
| 799 | Ga0495638_0000851 | |||
| 800 | Ga0495638_0002022 | |||
| 801 | Ga0495638_0018570 | |||
| 802 | Ga0495653_0000044 | |||
| 803 | Ga0495653_0007535 | |||
| 804 | Ga0495653_0090290 | |||
| 805 | Ga0495650_0000056 | |||
| 806 | Ga0495650_0000100 | |||
| 807 | Ga0495650_0000254 | |||
| 808 | Ga0495650_0000533 | |||
| 809 | Ga0495650_0000941 | |||
| 810 | Ga0495650_0001000 | |||
| 811 | Ga0495650_0001068 | |||
| 812 | Ga0495650_0007208 | |||
| 813 | Ga0495650_0013505 | |||
| 814 | Ga0495582_0032410 | |||
| 815 | Ga0495605_0000098 | |||
| 816 | Ga0495605_0000121 | |||
| 817 | Ga0495605_0000276 | |||
| 818 | Ga0495605_0000402 | |||
| 819 | Ga0495639_0005299 | |||
| 820 | Ga0495639_0009772 | |||
| 821 | Ga0495662_0000383 | |||
| 822 | Ga0495584_0000011 | |||
| 823 | Ga0495584_0000967 | |||
| 824 | Ga0495584_0001472 | |||
| 825 | Ga0495584_0002367 | |||
| 826 | Ga0495584_0005137 | |||
| 827 | Ga0495584_0008240 | |||
| 828 | Ga0495584_0013925 | |||
| 829 | Ga0495585_0000231 | |||
| 830 | Ga0495585_0000661 | |||
| 831 | Ga0495585_0000804 | |||
| 832 | Ga0495585_0001080 | |||
| 833 | Ga0495585_0003340 | |||
| 834 | Ga0495585_0018152 | |||
| 835 | Ga0495585_0021248 | |||
| 836 | Ga0495596_0000167 | |||
| 837 | Ga0495596_0001014 | |||
| 838 | Ga0495596_0001079 | |||
| 839 | Ga0495596_0006984 | |||
| 840 | Ga0495596_0008630 | |||
| 841 | Ga0495596_0008862 | |||
| 842 | Ga0495607_0000541 | |||
| 843 | Ga0495607_0002543 | |||
| 844 | Ga0495607_0002623 | |||
| 845 | Ga0495607_0002921 | |||
| 846 | Ga0495607_0003644 | |||
| 847 | Ga0495607_0006338 | |||
| 848 | Ga0495607_0011753 | |||
| 849 | Ga0495607_0038118 | |||
| 850 | Ga0495583_0000150 | |||
| 851 | Ga0495583_0000204 | |||
| 852 | Ga0495583_0000277 | |||
| 853 | Ga0495583_0000295 | |||
| 854 | Ga0495583_0003003 | |||
| 855 | Ga0495583_0003424 | |||
| 856 | Ga0495583_0006723 | |||
| 857 | Ga0495583_0006809 | |||
| 858 | Ga0495583_0011338 | |||
| 859 | Ga0495606_0000080 | |||
| 860 | Ga0495606_0000093 | |||
| 861 | Ga0495606_0000099 | |||
| 862 | Ga0495606_0000208 | |||
| 863 | Ga0495606_0000223 | |||
| 864 | Ga0495606_0001227 | |||
| 865 | Ga0495606_0002619 | |||
| 866 | Ga0495606_0003499 | |||
| 867 | Ga0495606_0007328 | |||
| 868 | Ga0495606_0012672 | |||
| 869 | Ga0495606_0046827 | |||
| 870 | Ga0495610_0000017 | |||
| 871 | Ga0495610_0000670 | |||
| 872 | Ga0495610_0000833 | |||
| 873 | Ga0495610_0015472 | |||
| 874 | Ga0495616_0000513 | |||
| 875 | Ga0495616_0001343 | |||
| 876 | Ga0495616_0002023 | |||
| 877 | Ga0495616_0003717 | |||
| 878 | Ga0495616_0008346 | |||
| 879 | Ga0495616_0009559 | |||
| 880 | Ga0495616_0017117 | |||
| 881 | Ga0495616_0024879 | |||
| 882 | Ga0495630_0000083 | |||
| 883 | Ga0495630_0025319 | |||
| 884 | Ga0495631_0001460 | |||
| 885 | Ga0495631_0006287 | |||
| 886 | Ga0495632_0000648 | |||
| 887 | Ga0495632_0001800 | |||
| 888 | Ga0495632_0002267 | |||
| 889 | Ga0495637_0000047 | |||
| 890 | Ga0495637_0001447 | |||
| 891 | Ga0495637_0008919 | |||
| 892 | Ga0495643_0000142 | |||
| 893 | Ga0495643_0000209 | |||
| 894 | Ga0495643_0000672 | |||
| 895 | Ga0495643_0002391 | |||
| 896 | Ga0495643_0006507 | |||
| 897 | Ga0495643_0013124 | |||
| 898 | Ga0495643_0015589 | |||
| 899 | Ga0495644_0000594 | |||
| 900 | Ga0495644_0006197 | |||
| 901 | Ga0495644_0007776 | |||
| 902 | Ga0495648_0000017 | |||
| 903 | Ga0495648_0000305 | |||
| 904 | Ga0495648_0001222 | |||
| 905 | Ga0495648_0001823 | |||
| 906 | Ga0495648_0004635 | |||
| 907 | Ga0495648_0006199 | |||
| 908 | Ga0495648_0007998 | |||
| 909 | Ga0495648_0020281 | |||
| 910 | Ga0495648_0021344 | |||
| 911 | Ga0495666_0004100 | |||
| 912 | Ga0495666_0037295 | |||
| 913 | Ga0495642_0001019 | |||
| 914 | Ga0495642_0001727 | |||
| 915 | Ga0495642_0001772 | |||
| 916 | Ga0495642_0002181 | |||
| 917 | Ga0495652_0004868 | |||
| 918 | Ga0495654_0000030 | |||
| 919 | Ga0495654_0008889 | |||
| 920 | Ga0495654_0011932 | |||
| 921 | Ga0495654_0018310 | |||
| 922 | Ga0495665_0006843 | |||
| 923 | Ga0495586_0011094 | |||
| 924 | Ga0495586_0017583 | |||
| 925 | Ga0495587_0025234 | |||
| 926 | Ga0495587_0034417 | |||
| 927 | Ga0495609_0000028 | |||
| 928 | Ga0495609_0000235 | |||
| 929 | Ga0495609_0000240 | |||
| 930 | Ga0495609_0000872 | |||
| 931 | Ga0495609_0007111 | |||
| 932 | Ga0495609_0007725 | |||
| 933 | Ga0495597_0000017 | |||
| 934 | Ga0495597_0000257 | |||
| 935 | Ga0495597_0002408 | |||
| 936 | Ga0495597_0004838 | |||
| 937 | Ga0495597_0005826 | |||
| 938 | Ga0495597_0010618 | |||
| 939 | Ga0495622_0000044 | |||
| 940 | Ga0495622_0000058 | |||
| 941 | Ga0495622_0019659 | |||
| 942 | Ga0495633_0000070 | |||
| 943 | Ga0495633_0000394 | |||
| 944 | Ga0495633_0000415 | |||
| 945 | Ga0495633_0001217 | |||
| 946 | Ga0495633_0001238 | |||
| 947 | Ga0495633_0002108 | |||
| 948 | Ga0495633_0005389 | |||
| 949 | Ga0495668_0000101 | |||
| 950 | Ga0495668_0000143 | |||
| 951 | Ga0495668_0000286 | |||
| 952 | Ga0495668_0000647 | |||
| 953 | Ga0495668_0002087 | |||
| 954 | Ga0495668_0002663 | |||
| 955 | Ga0495668_0003929 | |||
| 956 | Ga0495668_0006324 | |||
| 957 | Ga0495668_0007058 | |||
| 958 | Ga0495668_0009671 | |||
| 959 | Ga0495668_0012953 | |||
| 960 | Ga0495668_0015524 | |||
| 961 | Ga0495668_0038616 | |||
| 962 | Ga0495634_0014674 | |||
| 963 | Ga0495611_0004010 | |||
| 964 | Ga0495611_0005790 | |||
| 965 | Ga0495611_0007547 | |||
| 966 | Ga0495611_0011654 | |||
| 967 | Ga0495611_0013886 | |||
| 968 | Ga0495611_0018727 | |||
| 969 | Ga0495625_0000338 | |||
| 970 | Ga0495625_0000556 | |||
| 971 | Ga0495625_0002771 | |||
| 972 | Ga0495625_0003853 | |||
| 973 | Ga0495625_0014887 | |||
| 974 | Ga0495625_0016511 | |||
| 975 | Ga0495625_0045337 | |||
| 976 | Ga0495625_0047241 | |||
| 977 | Ga0495635_0049909 | |||
| 978 | Ga0495659_0000064 | |||
| 979 | Ga0495659_0000308 | |||
| 980 | Ga0495661_0000862 | |||
| 981 | Ga0495661_0002077 | |||
| 982 | Ga0495661_0002137 | |||
| 983 | Ga0495661_0004303 | |||
| 984 | Ga0495661_0004545 | |||
| 985 | Ga0495661_0010939 | |||
| 986 | Ga0495661_0010992 | |||
| 987 | Ga0495661_0026485 | |||
| 988 | Ga0495661_0031596 | |||
| 989 | Ga0495661_0033983 | |||
| 990 | Ga0495588_0000070 | |||
| 991 | Ga0495588_0003187 | |||
| 992 | Ga0495669_0001025 | |||
| 993 | Ga0495669_0001424 | |||
| 994 | Ga0495613_0022050 | |||
| 995 | Ga0495670_0010706 | |||
| 996 | Ga0495671_0000026 | |||
| 997 | Ga0495671_0000093 | |||
| 998 | Ga0495671_0004255 | |||
| 999 | Ga0495671_0006818 | |||
| 1000 | Ga0495649_0001152 | |||
| 1001 | Ga0495649_0001587 | |||
| 1002 | Ga0495649_0001686 | |||
| 1003 | Ga0495649_0002639 | |||
| 1004 | Ga0495649_0006769 | |||
| 1005 | Ga0495589_0000218 | |||
| 1006 | Ga0495589_0001502 | |||
| 1007 | Ga0495589_0002489 | |||
| 1008 | Ga0495589_0003933 | |||
| 1009 | Ga0495589_0010022 | |||
| 1010 | Ga0495660_0000113 | |||
| 1011 | Ga0495660_0000538 | |||
| 1012 | Ga0495660_0000631 | |||
| 1013 | Ga0495660_0001129 | |||
| 1014 | Ga0495660_0003212 | |||
| 1015 | Ga0495660_0005091 | |||
| 1016 | Ga0495660_0013362 | |||
| 1017 | Ga0495660_0018625 | |||
| 1018 | Ga0495660_0032229 | |||
| 1019 | Ga0495581_0021886 | |||
| 1020 | Ga0495636_0000880 | |||
| 1021 | Ga0495636_0003298 | |||
| 1022 | Ga0495636_0005337 | |||
| 1023 | Ga0495674_0015016 | |||
| 1024 | Ga0495672_0000013 | |||
| 1025 | Ga0495672_0000245 | |||
| 1026 | Ga0495672_0000566 | |||
| 1027 | Ga0495672_0001524 | |||
| 1028 | Ga0495672_0001701 | |||
| 1029 | Ga0495672_0003873 | |||
| 1030 | Ga0495672_0004351 | |||
| 1031 | Ga0495672_0010490 | |||
| 1032 | Ga0495672_0026359 | |||
| 1033 | Ga0495676_0000635 | |||
| 1034 | Ga0495676_0003661 | |||
| 1035 | Ga0495676_0089939 | |||
| 1036 | Ga0495680_0031285 | |||
| 1037 | Ga0495680_0062296 | |||
| 1038 | Ga0495683_0000088 | |||
| 1039 | Ga0495683_0001399 | |||
| 1040 | Ga0495683_0003839 | |||
| 1041 | Ga0495683_0021370 | |||
| 1042 | Ga0495683_0027698 | |||
| 1043 | Ga0495687_000057 | |||
| 1044 | Ga0495687_000256 | |||
| 1045 | Ga0495687_000288 | |||
| 1046 | Ga0495687_001662 | |||
| 1047 | Ga0495687_002171 | |||
| 1048 | Ga0495687_004834 | |||
| 1049 | Ga0495687_005242 | |||
| 1050 | Ga0495687_006298 | |||
| 1051 | Ga0495687_010266 | |||
| 1052 | Ga0495687_010547 | |||
| 1053 | Ga0495675_0009848 | |||
| 1054 | Ga0495677_0000161 | |||
| 1055 | Ga0495677_0000285 | |||
| 1056 | Ga0495677_0000526 | |||
| 1057 | Ga0495677_0001852 | |||
| 1058 | Ga0495677_0004724 | |||
| 1059 | Ga0495677_0005155 | |||
| 1060 | Ga0495679_004809 | |||
| 1061 | Ga0495685_000044 | |||
| 1062 | Ga0495673_0000069 | |||
| 1063 | Ga0495673_0000080 | |||
| 1064 | Ga0495673_0000203 | |||
| 1065 | Ga0495673_0003510 | |||
| 1066 | Ga0495681_0002303 | |||
| 1067 | Ga0495681_0002335 | |||
| 1068 | Ga0495681_0007296 | |||
| 1069 | Ga0495681_0012714 | |||
| 1070 | Ga0495686_0000212 | |||
| 1071 | Ga0495686_0000612 | |||
| 1072 | Ga0495686_0000722 | |||
| 1073 | Ga0495686_0000799 | |||
| 1074 | Ga0495686_0015576 | |||
| 1075 | Ga0495593_0026008 | |||
| 1076 | Ga0495602_0006516 | |||
| 1077 | Ga0495626_0000030 | |||
| 1078 | Ga0495626_0001112 | |||
| 1079 | Ga0495626_0001336 | |||
| 1080 | Ga0495626_0001875 | |||
| 1081 | Ga0495626_0019683 | |||
| 1082 | Ga0495626_0025480 | |||
| 1083 | Ga0496102_0000196 | |||
| 1084 | Ga0496102_0002399 | |||
| 1085 | Ga0496102_0086971 | |||
| 1086 | Ga0496102_0103906 | |||
| 1087 | Ga0496103_0029922 | |||
| 1088 | Ga0496105_0098473 | |||
| 1089 | Ga0496107_0047232 | |||
| 1090 | Ga0496109_0083296 | |||
| 1091 | Ga0496110_0002992 | |||
| 1092 | Ga0496110_0006313 | |||
| 1093 | Ga0496111_0005490 | |||
| 1094 | Ga0496111_0047101 | |||
| 1095 | Ga0496112_0054585 | |||
| 1096 | Ga0496114_0051371 | |||
| 1097 | Ga0496115_0062264 | |||
| 1098 | Ga0496116_0037327 | |||
| 1099 | Ga0496117_0000132 | |||
| 1100 | Ga0496118_0000099 | |||
| 1101 | Ga0496120_0017696 | |||
| 1102 | Ga0496122_0004240 | |||
| 1103 | Ga0496122_0005480 | |||
| 1104 | Ga0496122_0009038 | |||
| 1105 | Ga0496122_0023073 | |||
| 1106 | Ga0496122_0054954 | |||
| 1107 | Ga0496123_0003509 | |||
| 1108 | Ga0496123_0003741 | |||
| 1109 | Ga0496123_0004584 | |||
| 1110 | Ga0496123_0014552 | |||
| 1111 | Ga0496123_0022761 | |||
| 1112 | Ga0496124_0011144 | |||
| 1113 | Ga0496124_0020367 | |||
| 1114 | Ga0496124_0024495 | |||
| 1115 | Ga0496124_0026152 | |||
| 1116 | Ga0496124_0047348 | |||
| 1117 | Ga0496124_0147220 | |||
| 1118 | Ga0496125_0002623 | |||
| 1119 | Ga0496125_0005966 | |||
| 1120 | Ga0496125_0034264 | |||
| 1121 | Ga0495678_000010 | |||
| 1122 | Ga0495678_000200 | |||
| 1123 | Ga0495678_000230 | |||
| 1124 | Ga0495678_000523 | |||
| 1125 | Ga0495678_001473 | |||
| 1126 | Ga0495678_001481 | |||
| 1127 | Ga0495678_002815 | |||
| 1128 | Ga0495678_002857 | |||
| 1129 | Ga0495682_0001242 | |||
| 1130 | Ga0495682_0001674 | |||
| 1131 | Ga0501227_001645 | |||
| 1132 | Ga0501269_000096 | |||
| 1133 | Ga0501035_0004391 | |||
| 1134 | nmdc:mga0qj67_54920_c1 | |||
| 1135 | nmdc:mga0n895_2750_c1 | |||
| 1136 | nmdc:mga0rr50_38275_c1 | |||
| 1137 | nmdc:mga08x19_34190_c1 | |||
| 1138 | nmdc:mga0a205_68281_c1 | |||
| 1139 | nmdc:mga0a205_9670_c1 | |||
| 1140 | Ga0500644_0000924 | |||
| 1141 | Ga0500651_0013897 | |||
| 1142 | Ga0500641_0003080 | |||
| 1143 | Ga0500618_001070 | |||
| 1144 | Ga0500586_000020 | |||
| 1145 | Ga0500586_002907 | |||
| 1146 | 2601670196 | |||
| 1147 | 2643791037 | |||
| 1148 | 2643797571 | |||
| 1149 | 2643884606 | |||
| 1150 | 2644215243 | |||
| 1151 | 2644254615 | |||
| 1152 | 2644351446 | |||
| 1153 | 2644360163 | |||
| 1154 | 2644470647 | |||
| 1155 | 2644553261 | |||
| 1156 | 2738710464 | |||
| 1157 | 2738741918 | |||
| 1158 | 2738827021 | |||
| 1159 | 2738845901 | |||
| 1160 | 2738848889 | |||
| 1161 | 2738864618 | |||
| 1162 | 2739150818 | |||
| 1163 | 2739192737 | |||
| 1164 | 2739276796 | |||
| 1165 | 2739297136 | |||
| 1166 | 2739319214 | |||
| 1167 | 2739337455 | |||
| 1168 | 2739345840 | |||
| 1169 | 2739358814 | |||
| 1170 | 2809144071 | |||
| 1171 | 2821136439 | |||
| 1172 | 2842712125 | |||
| 1173 | 2857553074 | |||
| 1174 | 2857557792 | |||
| 1175 | 2857559661 | |||
| 1176 | 2857568236 | |||
| 1177 | 2885084278 | |||
| 1178 | 2904428598 | |||
| 1179 | 2919477170 | |||
| 1180 | 2928100564 | |||
| 1181 | 2928960627 | |||
| 1182 | 2928974185 | |||
| 1183 | 2932413703 | |||
| 1184 | 2932417763 | |||
| 1185 | 2941487860 | |||
| 1186 | 2977240852 | |||
| 1187 | 8002869633 | |||
| 1188 | 8047678866 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hxg-assembly2.cif.gz_G | pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) | 0.893 | 24 | 687 |
| 4hxf-assembly1.cif.gz_B | acylaminoacyl peptidase in complex with z-gly-gly-phe-chloromethyl ketone | 0.8922 | 33 | 687 |
| 4hxg-assembly2.cif.gz_J | pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) | 0.8917 | 24 | 687 |
| 4hxg-assembly1.cif.gz_C | pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) | 0.8884 | 24 | 687 |
| 4hxg-assembly2.cif.gz_K | pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) | 0.8879 | 24 | 687 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9P778_407_680_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9701 | 430 | 687 | 3.40.50.1820 |
| 4hxgB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9197 | 431 | 687 | 3.40.50.1820 |
| af_Q9P778_407_680_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9112 | 430 | 687 | 3.40.50.1820 |
| 4re6B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8955 | 426 | 684 | 3.40.50.1820 |
| af_Q9TYX1_461_736_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8908 | 427 | 686 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3TLR1-F1-model_v4 | S9 family peptidase | 0.9859 | 544 | 687 |
GO:0004252
GO:0006508 |
| AF-A0A2V8A6M8-F1-model_v4 | S9 family peptidase | 0.9709 | 342 | 686 |
GO:0004252
GO:0006508 |
| AF-A0A7V4U2H2-F1-model_v4 | S9 family peptidase | 0.9663 | 553 | 686 |
GO:0004252
GO:0006508 |
| AF-A0A4Q3TLR1-F1-model_v4 | S9 family peptidase | 0.966 | 544 | 687 |
GO:0004252
GO:0006508 |
| AF-A0A660ZZB7-F1-model_v4 | S9 family peptidase | 0.9617 | 511 | 685 |
GO:0004252
GO:0006508 |