F467475

General Info

Members Datasets Scaffolds Average Seq Length
595 269 1188 680

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0008881|Ga0495583_0008881_2607_4811
Length 734
Sequence MQRASASASRTAEIPGRQSTPLLQRVKLLPRSWRAVALPDDTRDTLDEESMKLRLLMLGAAVAASSAVAAPRGLTVEDLVSLERVGSPAVSPDARRVVYTVRRTDLGKNRGHTSLWIADLNGANAAPKALTDHDSSSTDPEWSPSGDAVYFLSSRSGSSQVWRQPANGGEPVQVTNLPLDVDNFRISPTGERIAFSLAVFRDCPDLACTKDRLDAQAKNKASGHVYDRLFVRHWDTWADGRNAVLFSAPIDANGRVSSAPVSLSGSLDGDVPSKPFGDREEYRFSPDGKTVVFSARIAGKTEAWSTNFDLYSVPAAGNAAPRNLTAENKAWDSKGVFSPDGRTLAYLAMARPGFEADRYQVMLMDVASGTKRKLAPNWDRSAGALQWSEDGKSLVVDAEDVGQHRLFSIDVASGKVSALTDKGSIGGFDMRRDTIAYTQATLSSPAQLYTTSLHGGTPQQLSNNNADKLADVRFGEYEQFSFKGAHGDTVYGHVMKPWNATPGVKYPIAFLVHGGPQGSFGNAWSYRWNPQVYAGAGYAAVFIDFHGSTGYGQKFTDAISGDWGGAPLVDLQKGLEAAVKKFPWLDRGRSCALGASYGGYMMNWIEGNWSDGFKCIVNHDGVFDTRGMAYSTEEQWFTDWENGGAYFSVPQQHERFNPVLHVNKWKTPMLVVQGDLDFRIPTAQGLSTFTALQRRGIESKLLVFPDENHWVLKPANSLLWHHTVIGWLDQHLKP

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
111 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
125 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
128 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
187 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
215 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
226 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
227 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
228 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
229 2643221556 Massilia sp. Root1485 Isolate Unclassified
230 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
231 2643221638 Duganella sp. Root336D2 Isolate Unclassified
232 2643221645 Massilia sp. Root351 Isolate Unclassified
233 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
234 2643221664 Massilia sp. Root418 Isolate Unclassified
235 2643221684 Massilia sp. Root133 Isolate Unclassified
236 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
237 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
238 2738541280 Massilia sp. GV090 Isolate Unclassified
239 2738541297 Duganella sp. GV083 Isolate Unclassified
240 2738541300 Massilia sp. GV016 Isolate Unclassified
241 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
242 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
243 2738541357 Duganella sp. GV053 Isolate Unclassified
244 2738543003 Duganella sp. GV066 Isolate Unclassified
245 2738543018 Massilia sp. GV045 Isolate Unclassified
246 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
247 2738543026 Duganella sp. GV089 Isolate Unclassified
248 2738543029 Duganella sp. GV039 Isolate Unclassified
249 2738543030 Massilia sp. GV097 Isolate Unclassified
250 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
251 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
252 2821131069 Duganella sp. 1224 Isolate Unclassified
253 2842711865 Duganella sp. R-73148 Isolate Unclassified
254 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
255 2857553236 Duganella sp. R-74557 Isolate Unclassified
256 2857558681 Duganella sp. R-74565 Isolate Unclassified
257 2857564685 Duganella sp. R-74599 Isolate Unclassified
258 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
259 2904424332 Duganella sp. 1411 Isolate Rhizosphere
260 2919476304 Duganella sp. 3397 Isolate Unclassified
261 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
262 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
263 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
264 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
265 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
266 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
267 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
268 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
269 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 0
Isolates 7.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.93
Nodule 0.5
Rhizoplane 2.69
Rhizosphere 75.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0008881 3300046506 Bacteria 6077
2 JGI25152J39213_1000003 3300002773 Bacteria 214804
3 JGI25150J39212_1000325 3300002774 Bacteria 23492
4 JGI25159J45721_1002066 3300002987 Bacteria 7923
5 JGI25159J45721_1002463 3300002987 Bacteria 7022
6 JGI25153J46596_10010601 3300003215 Bacteria 4151
7 rootL2_10004162 3300003322 Bacteria 10037
8 JGI25161J50226_1000830 3300003374 Bacteria 11561
9 Ga0055529_1000152 3300003763 Bacteria 98133
10 Ga0055526_1000025 3300003771 Bacteria 154279
11 Ga0055526_1000079 3300003771 Bacteria 89698
12 Ga0055526_1000467 3300003771 Bacteria 32128
13 Ga0055526_1000514 3300003771 Bacteria 30863
14 Ga0055537_1000098 3300003773 Bacteria 65302
15 Ga0055524_1000090 3300003775 Bacteria 114109
16 Ga0055524_1000696 3300003775 Bacteria 23514
17 Ga0055524_1011614 3300003775 Bacteria 3431
18 Ga0055536_1001410 3300003781 Bacteria 14516
19 Ga0055534_1000009 3300003784 Bacteria 210256
20 Ga0055534_1005698 3300003784 Bacteria 3279
21 Ga0055528_1000012 3300003790 Bacteria 182704
22 Ga0055528_1005576 3300003790 Bacteria 5827
23 Ga0055530_10001584 3300003791 Bacteria 16276
24 Ga0055543_1001111 3300004625 Bacteria 11599
25 Ga0055543_1002742 3300004625 Bacteria 5609
26 Ga0065165_1000051 3300005262 Bacteria 194844
27 Ga0065165_1005229 3300005262 Bacteria 7449
28 Ga0070658_10049742 3300005327 Bacteria 3397
29 Ga0070658_10096718 3300005327 Bacteria 2438
30 Ga0070680_100021120 3300005336 Bacteria 5171
31 Ga0070660_100036848 3300005339 Bacteria 3706
32 Ga0070689_100005216 3300005340 Bacteria 8850
33 Ga0070671_100008369 3300005355 Bacteria 8287
34 Ga0070659_100050580 3300005366 Bacteria 3266
35 Ga0070714_100054936 3300005435 Bacteria 3403
36 Ga0070710_10026745 3300005437 Bacteria 3069
37 Ga0070708_100021206 3300005445 Bacteria 5490
38 Ga0070681_10118016 3300005458 Bacteria 2590
39 Ga0070706_100008026 3300005467 Bacteria 9850
40 Ga0070698_100004950 3300005471 Bacteria 14603
41 Ga0070684_100008554 3300005535 Bacteria 8011
42 Ga0068855_100121551 3300005563 Bacteria 2988
43 Ga0070664_100073356 3300005564 Bacteria 2936
44 Ga0068852_100001921 3300005616 Bacteria 14156
45 Ga0068859_100018821 3300005617 Bacteria 6938
46 Ga0068851_10011558 3300005834 Bacteria 4142
47 Ga0068858_100014283 3300005842 Bacteria 7487
48 Ga0068860_100004026 3300005843 Bacteria 15091
49 Ga0075428_100006344 3300006844 Bacteria 13157
50 Ga0075428_100037453 3300006844 Bacteria 5339
51 Ga0075430_100045767 3300006846 Bacteria 3695
52 Ga0075431_100023523 3300006847 Bacteria 6305
53 Ga0075433_10057598 3300006852 Bacteria 3397
54 Ga0075433_10121249 3300006852 Bacteria 2322
55 Ga0075434_100004850 3300006871 Bacteria 12192
56 Ga0075434_100090191 3300006871 Bacteria 3067
57 Ga0075436_100060843 3300006914 Bacteria 2609
58 Ga0097620_100018821 3300006931 Bacteria 6938
59 Ga0099826_10000001 3300006948 Bacteria 1155201
60 Ga0105244_10000891 3300009036 Bacteria 25233
61 Ga0105244_10000981 3300009036 Bacteria 23934
62 Ga0105244_10032501 3300009036 Bacteria 2761
63 Ga0111539_10061455 3300009094 Bacteria 4450
64 Ga0105241_10005321 3300009174 Bacteria 9508
65 Ga0105242_10008974 3300009176 Bacteria 7679
66 Ga0105237_10007063 3300009545 Bacteria 12348
67 Ga0105237_10051228 3300009545 Bacteria 4146
68 Ga0157371_10000399 3300013102 Bacteria 54380
69 Ga0157371_10010317 3300013102 Bacteria 7290
70 Ga0157371_10029129 3300013102 Bacteria 3997
71 Ga0157371_10034644 3300013102 Bacteria 3620
72 Ga0157370_10010757 3300013104 Bacteria 9623
73 Ga0157369_10037576 3300013105 Bacteria 5301
74 Ga0182006_1000080 3300015261 Bacteria 122163
75 Ga0182006_1000097 3300015261 Bacteria 102186
76 Ga0182007_10000227 3300015262 Bacteria 37880
77 Ga0182005_1000016 3300015265 Bacteria 346889
78 Ga0182005_1000038 3300015265 Bacteria 160030
79 Ga0213872_10000005 3300021361 Bacteria 290165
80 Ga0209436_100099 3300025208 Bacteria 42519
81 Ga0209436_100273 3300025208 Bacteria 23718
82 Ga0209563_100015 3300025230 Bacteria 879901
83 Ga0207425_1000014 3300025245 Bacteria 481113
84 Ga0207425_1000053 3300025245 Bacteria 156878
85 Ga0209646_1000190 3300025246 Bacteria 75772
86 Ga0209677_103085 3300025253 Bacteria 5682
87 Ga0209148_1000272 3300025254 Bacteria 81330
88 Ga0209129_1000017 3300025258 Bacteria 480935
89 Ga0209565_1000015 3300025263 Bacteria 494091
90 Ga0209565_1000558 3300025263 Bacteria 25649
91 Ga0209455_1000070 3300025272 Bacteria 307867
92 Ga0209673_1000017 3300025273 Bacteria 492994
93 Ga0209673_1009290 3300025273 Bacteria 4280
94 Ga0209130_1000063 3300025284 Bacteria 198142
95 Ga0209130_1001797 3300025284 Bacteria 12595
96 Ga0209130_1001856 3300025284 Bacteria 12110
97 Ga0209675_1000012 3300025291 Bacteria 494061
98 Ga0209675_1000655 3300025291 Bacteria 24384
99 Ga0209675_1004711 3300025291 Bacteria 5971
100 Ga0209676_1000115 3300025292 Bacteria 205183
101 Ga0209025_1009248 3300025294 Bacteria 6904
102 Ga0209564_1000016 3300025295 Bacteria 613131
103 Ga0209564_1000027 3300025295 Bacteria 518458
104 Ga0209564_1000047 3300025295 Bacteria 368031
105 Ga0209564_1000184 3300025295 Bacteria 149989
106 Ga0209564_1002884 3300025295 Bacteria 12595
107 Ga0209758_1000038 3300025297 Bacteria 433771
108 Ga0209758_1009637 3300025297 Bacteria 5954
109 Ga0209050_1000011 3300025298 Bacteria 914037
110 Ga0209050_1000159 3300025298 Bacteria 157244
111 Ga0209050_1001486 3300025298 Bacteria 24922
112 Ga0209050_1005040 3300025298 Bacteria 8556
113 Ga0209256_1000005 3300025299 Bacteria 1315082
114 Ga0209256_1000138 3300025299 Bacteria 156076
115 Ga0209256_1000290 3300025299 Bacteria 88227
116 Ga0209256_1000593 3300025299 Bacteria 50391
117 Ga0209256_1005123 3300025299 Bacteria 7762
118 Ga0207426_1000654 3300025302 Bacteria 42532
119 Ga0209257_1000003 3300025304 Bacteria 1702593
120 Ga0209257_1000090 3300025304 Bacteria 274746
121 Ga0207655_1004025 3300025728 Bacteria 10605
122 Ga0207680_10028010 3300025903 Bacteria 3146
123 Ga0207705_10001666 3300025909 Bacteria 17666
124 Ga0207684_10021521 3300025910 Bacteria 5506
125 Ga0207654_10002340 3300025911 Bacteria 9727
126 Ga0207707_10113795 3300025912 Bacteria 2365
127 Ga0207657_10019062 3300025919 Bacteria 6527
128 Ga0207657_10023264 3300025919 Bacteria 5773
129 Ga0207652_10035614 3300025921 Bacteria 4203
130 Ga0207646_10009557 3300025922 Bacteria 9571
131 Ga0207664_10048689 3300025929 Bacteria 3334
132 Ga0207690_10036169 3300025932 Bacteria 3195
133 Ga0207690_10036678 3300025932 Bacteria 3176
134 Ga0207690_10038026 3300025932 Bacteria 3129
135 Ga0207686_10004244 3300025934 Bacteria 7680
136 Ga0207691_10015946 3300025940 Bacteria 7138
137 Ga0207703_10025686 3300026035 Bacteria 4634
138 Ga0207674_10009103 3300026116 Bacteria 11396
139 Ga0207674_10036681 3300026116 Bacteria 5105
140 Ga0207698_10007362 3300026142 Bacteria 6897
141 Ga0209281_1004269 3300027111 Bacteria 4336
142 Ga0209282_1000001 3300027666 Bacteria 2450367
143 Ga0268266_10001639 3300028379 Bacteria 25975
144 Ga0268264_10005333 3300028381 Bacteria 10892
145 Ga0307408_100000201 3300031548 Bacteria 64686
146 Ga0307408_100000244 3300031548 Bacteria 56961
147 Ga0307408_100021893 3300031548 Bacteria 4334
148 Ga0265314_10036835 3300031711 Bacteria 3550
149 Ga0307412_10000683 3300031911 Bacteria 19623
150 Ga0307416_100011300 3300032002 Bacteria 5941
151 Ga0307414_10011321 3300032004 Bacteria 5226
152 Ga0307414_10046584 3300032004 Bacteria 2977
153 Ga0373925_0072945 3300037068 Bacteria 2597
154 Ga0395899_0000207 3300037312 Bacteria 86182
155 Ga0395899_0014688 3300037312 Bacteria 5975
156 Ga0395899_0024233 3300037312 Bacteria 4590
157 Ga0395899_0030403 3300037312 Bacteria 4062
158 Ga0395899_0098493 3300037312 Bacteria 2112
159 Ga0395900_0001494 3300037418 Bacteria 27808
160 Ga0395900_0003169 3300037418 Bacteria 17834
161 Ga0395900_0009476 3300037418 Bacteria 9980
162 Ga0395900_0027990 3300037418 Bacteria 5771
163 Ga0395900_0057982 3300037418 Bacteria 3986
164 Ga0395905_0023707 3300037471 Bacteria 5794
165 Ga0395901_0000307 3300038443 Bacteria 60012
166 Ga0395901_0003234 3300038443 Bacteria 16383
167 Ga0436361_0153820 3300039447 Bacteria 129660
168 Ga0436361_0166253 3300039447 Bacteria 25088
169 Ga0436361_0756774 3300039447 Bacteria 7872
170 Ga0439448_0005870 3300042005 Bacteria 3510
171 Ga0450904_000237 3300042139 Bacteria 12065
172 Ga0439458_0001931 3300042157 Bacteria 5137
173 Ga0451577_0001913 3300042876 Bacteria 26387
174 Ga0451577_0012027 3300042876 Bacteria 8146
175 Ga0453683_0001881 3300044673 Bacteria 17195
176 Ga0466965_0004201 3300044683 Bacteria 6402
177 Ga0466965_0006857 3300044683 Bacteria 5206
178 Ga0466966_0002604 3300044684 Bacteria 11832
179 Ga0466966_0010985 3300044684 Bacteria 6009
180 Ga0466966_0018044 3300044684 Bacteria 4659
181 Ga0466963_0055906 3300044694 Bacteria 2625
182 Ga0466964_0000552 3300044706 Bacteria 11764
183 Ga0453684_0000080 3300044712 Bacteria 411138
184 Ga0453684_0188764 3300044712 Bacteria 2412
185 Ga0466957_0000668 3300044842 Bacteria 17441
186 Ga0466957_0010797 3300044842 Bacteria 5251
187 Ga0466959_0016008 3300045049 Bacteria 5472
188 Ga0451576_0001277 3300045051 Bacteria 43875
189 Ga0466958_0062094 3300045836 Bacteria 2277
190 Ga0466967_0018780 3300045976 Bacteria 5538
191 Ga0466967_0030102 3300045976 Bacteria 4552
192 Ga0495617_000002 3300046452 Bacteria 710121
193 Ga0495617_000075 3300046452 Bacteria 78250
194 Ga0495617_000189 3300046452 Bacteria 38970
195 Ga0495617_001824 3300046452 Bacteria 9071
196 Ga0495627_000011 3300046453 Bacteria 354522
197 Ga0495627_000915 3300046453 Bacteria 20456
198 Ga0495603_0028150 3300046455 Bacteria 3389
199 Ga0495590_0000021 3300046457 Bacteria 210878
200 Ga0495590_0000061 3300046457 Bacteria 88102
201 Ga0495590_0002112 3300046457 Bacteria 8327
202 Ga0495590_0009447 3300046457 Bacteria 3700
203 Ga0495591_000893 3300046458 Bacteria 20883
204 Ga0495638_0000096 3300046460 Bacteria 141626
205 Ga0495638_0000851 3300046460 Bacteria 31827
206 Ga0495638_0002022 3300046460 Bacteria 17279
207 Ga0495638_0018570 3300046460 Bacteria 4615
208 Ga0495653_0000044 3300046463 Bacteria 115591
209 Ga0495653_0007535 3300046463 Bacteria 8900
210 Ga0495653_0090290 3300046463 Bacteria 2242
211 Ga0495650_0000056 3300046471 Bacteria 307565
212 Ga0495650_0000100 3300046471 Bacteria 213752
213 Ga0495650_0000254 3300046471 Bacteria 103512
214 Ga0495650_0000533 3300046471 Bacteria 55008
215 Ga0495650_0000941 3300046471 Bacteria 33764
216 Ga0495650_0001000 3300046471 Bacteria 32010
217 Ga0495650_0001068 3300046471 Bacteria 30381
218 Ga0495650_0007208 3300046471 Bacteria 6738
219 Ga0495650_0013505 3300046471 Bacteria 4313
220 Ga0495582_0032410 3300046473 Bacteria 2874
221 Ga0495605_0000098 3300046474 Bacteria 109816
222 Ga0495605_0000121 3300046474 Bacteria 102560
223 Ga0495605_0000276 3300046474 Bacteria 57745
224 Ga0495605_0000402 3300046474 Bacteria 39733
225 Ga0495639_0005299 3300046475 Bacteria 5552
226 Ga0495639_0009772 3300046475 Bacteria 4116
227 Ga0495662_0000383 3300046476 Bacteria 19652
228 Ga0495584_0000011 3300046491 Bacteria 208322
229 Ga0495584_0000967 3300046491 Bacteria 18038
230 Ga0495584_0001472 3300046491 Bacteria 14115
231 Ga0495584_0002367 3300046491 Bacteria 10740
232 Ga0495584_0005137 3300046491 Bacteria 6947
233 Ga0495584_0008240 3300046491 Bacteria 5403
234 Ga0495584_0013925 3300046491 Bacteria 4097
235 Ga0495585_0000231 3300046492 Bacteria 57572
236 Ga0495585_0000661 3300046492 Bacteria 31722
237 Ga0495585_0000804 3300046492 Bacteria 27367
238 Ga0495585_0001080 3300046492 Bacteria 22474
239 Ga0495585_0003340 3300046492 Bacteria 10880
240 Ga0495585_0018152 3300046492 Bacteria 4059
241 Ga0495585_0021248 3300046492 Bacteria 3728
242 Ga0495596_0000167 3300046500 Bacteria 46189
243 Ga0495596_0001014 3300046500 Bacteria 16692
244 Ga0495596_0001079 3300046500 Bacteria 16165
245 Ga0495596_0006984 3300046500 Bacteria 5132
246 Ga0495596_0008630 3300046500 Bacteria 4524
247 Ga0495596_0008862 3300046500 Bacteria 4452
248 Ga0495607_0000541 3300046501 Bacteria 36992
249 Ga0495607_0002543 3300046501 Bacteria 14752
250 Ga0495607_0002623 3300046501 Bacteria 14447
251 Ga0495607_0002921 3300046501 Bacteria 13470
252 Ga0495607_0003644 3300046501 Bacteria 11690
253 Ga0495607_0006338 3300046501 Bacteria 8337
254 Ga0495607_0011753 3300046501 Bacteria 5807
255 Ga0495607_0038118 3300046501 Bacteria 2881
256 Ga0495583_0000150 3300046506 Bacteria 117772
257 Ga0495583_0000204 3300046506 Bacteria 99749
258 Ga0495583_0000277 3300046506 Bacteria 82954
259 Ga0495583_0000295 3300046506 Bacteria 79005
260 Ga0495583_0003003 3300046506 Bacteria 13506
261 Ga0495583_0003424 3300046506 Bacteria 12095
262 Ga0495583_0006723 3300046506 Bacteria 7440
263 Ga0495583_0006809 3300046506 Bacteria 7381
264 Ga0495583_0011338 3300046506 Bacteria 5124
265 Ga0495606_0000080 3300046507 Bacteria 161866
266 Ga0495606_0000093 3300046507 Bacteria 152281
267 Ga0495606_0000099 3300046507 Bacteria 150950
268 Ga0495606_0000208 3300046507 Bacteria 103578
269 Ga0495606_0000223 3300046507 Bacteria 100501
270 Ga0495606_0001227 3300046507 Bacteria 35902
271 Ga0495606_0002619 3300046507 Bacteria 20530
272 Ga0495606_0003499 3300046507 Bacteria 16627
273 Ga0495606_0007328 3300046507 Bacteria 9919
274 Ga0495606_0012672 3300046507 Bacteria 6731
275 Ga0495606_0046827 3300046507 Bacteria 2855
276 Ga0495610_0000017 3300046512 Bacteria 365675
277 Ga0495610_0000670 3300046512 Bacteria 33331
278 Ga0495610_0000833 3300046512 Bacteria 28846
279 Ga0495610_0015472 3300046512 Bacteria 4430
280 Ga0495616_0000513 3300046513 Bacteria 29356
281 Ga0495616_0001343 3300046513 Bacteria 17155
282 Ga0495616_0002023 3300046513 Bacteria 13637
283 Ga0495616_0003717 3300046513 Bacteria 9735
284 Ga0495616_0008346 3300046513 Bacteria 6142
285 Ga0495616_0009559 3300046513 Bacteria 5661
286 Ga0495616_0017117 3300046513 Bacteria 4000
287 Ga0495616_0024879 3300046513 Bacteria 3205
288 Ga0495630_0000083 3300046517 Bacteria 74973
289 Ga0495630_0025319 3300046517 Bacteria 4386
290 Ga0495631_0001460 3300046518 Bacteria 14333
291 Ga0495631_0006287 3300046518 Bacteria 6146
292 Ga0495632_0000648 3300046519 Bacteria 31962
293 Ga0495632_0001800 3300046519 Bacteria 17287
294 Ga0495632_0002267 3300046519 Bacteria 14828
295 Ga0495637_0000047 3300046520 Bacteria 106648
296 Ga0495637_0001447 3300046520 Bacteria 13972
297 Ga0495637_0008919 3300046520 Bacteria 4907
298 Ga0495643_0000142 3300046522 Bacteria 115533
299 Ga0495643_0000209 3300046522 Bacteria 89487
300 Ga0495643_0000672 3300046522 Bacteria 40238
301 Ga0495643_0002391 3300046522 Bacteria 14978
302 Ga0495643_0006507 3300046522 Bacteria 7685
303 Ga0495643_0013124 3300046522 Bacteria 4973
304 Ga0495643_0015589 3300046522 Bacteria 4489
305 Ga0495644_0000594 3300046523 Bacteria 15164
306 Ga0495644_0006197 3300046523 Bacteria 4648
307 Ga0495644_0007776 3300046523 Bacteria 4133
308 Ga0495648_0000017 3300046524 Bacteria 283100
309 Ga0495648_0000305 3300046524 Bacteria 54610
310 Ga0495648_0001222 3300046524 Bacteria 25744
311 Ga0495648_0001823 3300046524 Bacteria 20505
312 Ga0495648_0004635 3300046524 Bacteria 11678
313 Ga0495648_0006199 3300046524 Bacteria 9798
314 Ga0495648_0007998 3300046524 Bacteria 8385
315 Ga0495648_0020281 3300046524 Bacteria 4640
316 Ga0495648_0021344 3300046524 Bacteria 4487
317 Ga0495666_0004100 3300046526 Bacteria 7359
318 Ga0495666_0037295 3300046526 Bacteria 2364
319 Ga0495642_0001019 3300046528 Bacteria 13015
320 Ga0495642_0001727 3300046528 Bacteria 9405
321 Ga0495642_0001772 3300046528 Bacteria 9310
322 Ga0495642_0002181 3300046528 Bacteria 8041
323 Ga0495652_0004868 3300046529 Bacteria 12746
324 Ga0495654_0000030 3300046530 Bacteria 216715
325 Ga0495654_0008889 3300046530 Bacteria 5523
326 Ga0495654_0011932 3300046530 Bacteria 4685
327 Ga0495654_0018310 3300046530 Bacteria 3672
328 Ga0495665_0006843 3300046531 Bacteria 6150
329 Ga0495586_0011094 3300046535 Bacteria 4788
330 Ga0495586_0017583 3300046535 Bacteria 3801
331 Ga0495587_0025234 3300046536 Bacteria 3632
332 Ga0495587_0034417 3300046536 Bacteria 3055
333 Ga0495609_0000028 3300046538 Bacteria 219908
334 Ga0495609_0000235 3300046538 Bacteria 52774
335 Ga0495609_0000240 3300046538 Bacteria 52192
336 Ga0495609_0000872 3300046538 Bacteria 22122
337 Ga0495609_0007111 3300046538 Bacteria 5629
338 Ga0495609_0007725 3300046538 Bacteria 5330
339 Ga0495597_0000017 3300046542 Bacteria 165491
340 Ga0495597_0000257 3300046542 Bacteria 48447
341 Ga0495597_0002408 3300046542 Bacteria 11907
342 Ga0495597_0004838 3300046542 Bacteria 7265
343 Ga0495597_0005826 3300046542 Bacteria 6448
344 Ga0495597_0010618 3300046542 Bacteria 4492
345 Ga0495622_0000044 3300046557 Bacteria 115528
346 Ga0495622_0000058 3300046557 Bacteria 97458
347 Ga0495622_0019659 3300046557 Bacteria 3144
348 Ga0495633_0000070 3300046558 Bacteria 133333
349 Ga0495633_0000394 3300046558 Bacteria 45904
350 Ga0495633_0000415 3300046558 Bacteria 44389
351 Ga0495633_0001217 3300046558 Bacteria 20751
352 Ga0495633_0001238 3300046558 Bacteria 20442
353 Ga0495633_0002108 3300046558 Bacteria 14289
354 Ga0495633_0005389 3300046558 Bacteria 7839
355 Ga0495668_0000101 3300046616 Bacteria 137289
356 Ga0495668_0000143 3300046616 Bacteria 107442
357 Ga0495668_0000286 3300046616 Bacteria 69771
358 Ga0495668_0000647 3300046616 Bacteria 41830
359 Ga0495668_0002087 3300046616 Bacteria 17292
360 Ga0495668_0002663 3300046616 Bacteria 14338
361 Ga0495668_0003929 3300046616 Bacteria 10853
362 Ga0495668_0006324 3300046616 Bacteria 7787
363 Ga0495668_0007058 3300046616 Bacteria 7235
364 Ga0495668_0009671 3300046616 Bacteria 5895
365 Ga0495668_0012953 3300046616 Bacteria 4936
366 Ga0495668_0015524 3300046616 Bacteria 4444
367 Ga0495668_0038616 3300046616 Bacteria 2667
368 Ga0495634_0014674 3300046642 Bacteria 5640
369 Ga0495611_0004010 3300046648 Bacteria 6412
370 Ga0495611_0005790 3300046648 Bacteria 5273
371 Ga0495611_0007547 3300046648 Bacteria 4612
372 Ga0495611_0011654 3300046648 Bacteria 3729
373 Ga0495611_0013886 3300046648 Bacteria 3435
374 Ga0495611_0018727 3300046648 Bacteria 2970
375 Ga0495625_0000338 3300046660 Bacteria 71524
376 Ga0495625_0000556 3300046660 Bacteria 54663
377 Ga0495625_0002771 3300046660 Bacteria 18506
378 Ga0495625_0003853 3300046660 Bacteria 14496
379 Ga0495625_0014887 3300046660 Bacteria 6186
380 Ga0495625_0016511 3300046660 Bacteria 5807
381 Ga0495625_0045337 3300046660 Bacteria 3178
382 Ga0495625_0047241 3300046660 Bacteria 3104
383 Ga0495635_0049909 3300046663 Bacteria 2885
384 Ga0495659_0000064 3300046664 Bacteria 47646
385 Ga0495659_0000308 3300046664 Bacteria 19457
386 Ga0495661_0000862 3300046665 Bacteria 28269
387 Ga0495661_0002077 3300046665 Bacteria 15719
388 Ga0495661_0002137 3300046665 Bacteria 15482
389 Ga0495661_0004303 3300046665 Bacteria 10329
390 Ga0495661_0004545 3300046665 Bacteria 9994
391 Ga0495661_0010939 3300046665 Bacteria 6170
392 Ga0495661_0010992 3300046665 Bacteria 6148
393 Ga0495661_0026485 3300046665 Bacteria 3735
394 Ga0495661_0031596 3300046665 Bacteria 3357
395 Ga0495661_0033983 3300046665 Bacteria 3212
396 Ga0495588_0000070 3300046674 Bacteria 227611
397 Ga0495588_0003187 3300046674 Bacteria 7102
398 Ga0495669_0001025 3300046684 Bacteria 11649
399 Ga0495669_0001424 3300046684 Bacteria 9846
400 Ga0495613_0022050 3300046689 Bacteria 4747
401 Ga0495670_0010706 3300046691 Bacteria 4507
402 Ga0495671_0000026 3300046692 Bacteria 237110
403 Ga0495671_0000093 3300046692 Bacteria 83958
404 Ga0495671_0004255 3300046692 Bacteria 8610
405 Ga0495671_0006818 3300046692 Bacteria 6562
406 Ga0495649_0001152 3300046694 Bacteria 20593
407 Ga0495649_0001587 3300046694 Bacteria 17010
408 Ga0495649_0001686 3300046694 Bacteria 16376
409 Ga0495649_0002639 3300046694 Bacteria 12495
410 Ga0495649_0006769 3300046694 Bacteria 7100
411 Ga0495589_0000218 3300046794 Bacteria 48625
412 Ga0495589_0001502 3300046794 Bacteria 13425
413 Ga0495589_0002489 3300046794 Bacteria 10306
414 Ga0495589_0003933 3300046794 Bacteria 7973
415 Ga0495589_0010022 3300046794 Bacteria 4923
416 Ga0495660_0000113 3300046810 Bacteria 86593
417 Ga0495660_0000538 3300046810 Bacteria 31032
418 Ga0495660_0000631 3300046810 Bacteria 27411
419 Ga0495660_0001129 3300046810 Bacteria 19041
420 Ga0495660_0003212 3300046810 Bacteria 10154
421 Ga0495660_0005091 3300046810 Bacteria 7897
422 Ga0495660_0013362 3300046810 Bacteria 4758
423 Ga0495660_0018625 3300046810 Bacteria 3991
424 Ga0495660_0032229 3300046810 Bacteria 2942
425 Ga0495581_0021886 3300047315 Bacteria 3706
426 Ga0495636_0000880 3300047318 Bacteria 11120
427 Ga0495636_0003298 3300047318 Bacteria 6252
428 Ga0495636_0005337 3300047318 Bacteria 5050
429 Ga0495674_0015016 3300047319 Bacteria 7248
430 Ga0495672_0000013 3300047320 Bacteria 511827
431 Ga0495672_0000245 3300047320 Bacteria 76419
432 Ga0495672_0000566 3300047320 Bacteria 41811
433 Ga0495672_0001524 3300047320 Bacteria 22682
434 Ga0495672_0001701 3300047320 Bacteria 21332
435 Ga0495672_0003873 3300047320 Bacteria 12581
436 Ga0495672_0004351 3300047320 Bacteria 11644
437 Ga0495672_0010490 3300047320 Bacteria 6599
438 Ga0495672_0026359 3300047320 Bacteria 3710
439 Ga0495676_0000635 3300047321 Bacteria 29072
440 Ga0495676_0003661 3300047321 Bacteria 13942
441 Ga0495676_0089939 3300047321 Bacteria 2299
442 Ga0495680_0031285 3300047322 Bacteria 4333
443 Ga0495680_0062296 3300047322 Bacteria 2868
444 Ga0495683_0000088 3300047323 Bacteria 92118
445 Ga0495683_0001399 3300047323 Bacteria 15929
446 Ga0495683_0003839 3300047323 Bacteria 8664
447 Ga0495683_0021370 3300047323 Bacteria 3335
448 Ga0495683_0027698 3300047323 Bacteria 2897
449 Ga0495687_000057 3300047443 Bacteria 186224
450 Ga0495687_000256 3300047443 Bacteria 71778
451 Ga0495687_000288 3300047443 Bacteria 66346
452 Ga0495687_001662 3300047443 Bacteria 19944
453 Ga0495687_002171 3300047443 Bacteria 16339
454 Ga0495687_004834 3300047443 Bacteria 8866
455 Ga0495687_005242 3300047443 Bacteria 8330
456 Ga0495687_006298 3300047443 Bacteria 7312
457 Ga0495687_010266 3300047443 Bacteria 5146
458 Ga0495687_010547 3300047443 Bacteria 5060
459 Ga0495675_0009848 3300047444 Bacteria 5960
460 Ga0495677_0000161 3300047445 Bacteria 32173
461 Ga0495677_0000285 3300047445 Bacteria 22182
462 Ga0495677_0000526 3300047445 Bacteria 16029
463 Ga0495677_0001852 3300047445 Bacteria 8456
464 Ga0495677_0004724 3300047445 Bacteria 5191
465 Ga0495677_0005155 3300047445 Bacteria 4971
466 Ga0495679_004809 3300047446 Bacteria 6109
467 Ga0495685_000044 3300047447 Bacteria 50670
468 Ga0495673_0000069 3300047469 Bacteria 218170
469 Ga0495673_0000080 3300047469 Bacteria 201831
470 Ga0495673_0000203 3300047469 Bacteria 89918
471 Ga0495673_0003510 3300047469 Bacteria 10315
472 Ga0495681_0002303 3300047470 Bacteria 13735
473 Ga0495681_0002335 3300047470 Bacteria 13627
474 Ga0495681_0007296 3300047470 Bacteria 7089
475 Ga0495681_0012714 3300047470 Bacteria 4929
476 Ga0495686_0000212 3300047472 Bacteria 107418
477 Ga0495686_0000612 3300047472 Bacteria 49335
478 Ga0495686_0000722 3300047472 Bacteria 44277
479 Ga0495686_0000799 3300047472 Bacteria 40834
480 Ga0495686_0015576 3300047472 Bacteria 5185
481 Ga0495593_0026008 3300047673 Bacteria 3235
482 Ga0495602_0006516 3300048088 Bacteria 12245
483 Ga0495626_0000030 3300048091 Bacteria 202562
484 Ga0495626_0001112 3300048091 Bacteria 22702
485 Ga0495626_0001336 3300048091 Bacteria 19967
486 Ga0495626_0001875 3300048091 Bacteria 15726
487 Ga0495626_0019683 3300048091 Bacteria 3372
488 Ga0495626_0025480 3300048091 Bacteria 2892
489 Ga0496102_0000196 3300048905 Bacteria 82747
490 Ga0496102_0002399 3300048905 Bacteria 15993
491 Ga0496102_0086971 3300048905 Bacteria 2887
492 Ga0496102_0103906 3300048905 Bacteria 2642
493 Ga0496103_0029922 3300048906 Bacteria 3311
494 Ga0496105_0098473 3300048908 Bacteria 2415
495 Ga0496107_0047232 3300048910 Bacteria 3101
496 Ga0496109_0083296 3300048912 Bacteria 2949
497 Ga0496110_0002992 3300048913 Bacteria 12821
498 Ga0496110_0006313 3300048913 Bacteria 9361
499 Ga0496111_0005490 3300048914 Bacteria 8136
500 Ga0496111_0047101 3300048914 Bacteria 3104
501 Ga0496112_0054585 3300048915 Bacteria 3926
502 Ga0496114_0051371 3300048917 Bacteria 3432
503 Ga0496115_0062264 3300048918 Bacteria 3009
504 Ga0496116_0037327 3300048919 Bacteria 3390
505 Ga0496117_0000132 3300048920 Bacteria 162117
506 Ga0496118_0000099 3300048921 Bacteria 160412
507 Ga0496120_0017696 3300048923 Bacteria 4609
508 Ga0496122_0004240 3300048925 Bacteria 17984
509 Ga0496122_0005480 3300048925 Bacteria 15100
510 Ga0496122_0009038 3300048925 Bacteria 10577
511 Ga0496122_0023073 3300048925 Bacteria 5503
512 Ga0496122_0054954 3300048925 Bacteria 2984
513 Ga0496123_0003509 3300048926 Bacteria 17468
514 Ga0496123_0003741 3300048926 Bacteria 16678
515 Ga0496123_0004584 3300048926 Bacteria 14394
516 Ga0496123_0014552 3300048926 Bacteria 6512
517 Ga0496123_0022761 3300048926 Bacteria 4818
518 Ga0496124_0011144 3300048927 Bacteria 9020
519 Ga0496124_0020367 3300048927 Bacteria 6132
520 Ga0496124_0024495 3300048927 Bacteria 5484
521 Ga0496124_0026152 3300048927 Bacteria 5268
522 Ga0496124_0047348 3300048927 Bacteria 3679
523 Ga0496124_0147220 3300048927 Bacteria 1852
524 Ga0496125_0002623 3300048928 Bacteria 23045
525 Ga0496125_0005966 3300048928 Bacteria 13335
526 Ga0496125_0034264 3300048928 Bacteria 4478
527 Ga0495678_000010 3300049459 Bacteria 357896
528 Ga0495678_000200 3300049459 Bacteria 70334
529 Ga0495678_000230 3300049459 Bacteria 64445
530 Ga0495678_000523 3300049459 Bacteria 37505
531 Ga0495678_001473 3300049459 Bacteria 18420
532 Ga0495678_001481 3300049459 Bacteria 18350
533 Ga0495678_002815 3300049459 Bacteria 11286
534 Ga0495678_002857 3300049459 Bacteria 11183
535 Ga0495682_0001242 3300049460 Bacteria 14423
536 Ga0495682_0001674 3300049460 Bacteria 11313
537 Ga0501227_001645 3300049665 Bacteria 4982
538 Ga0501269_000096 3300049766 Bacteria 27393
539 Ga0501035_0004391 3300049822 Bacteria 13383
540 nmdc:mga0qj67_54920_c1 3300050509 Bacteria 3154
541 nmdc:mga0n895_2750_c1 3300050512 Bacteria 13887
542 nmdc:mga0rr50_38275_c1 3300050513 Bacteria 3469
543 nmdc:mga08x19_34190_c1 3300050514 Bacteria 3212
544 nmdc:mga0a205_68281_c1 3300050515 Bacteria 3433
545 nmdc:mga0a205_9670_c1 3300050515 Bacteria 8829
546 Ga0500644_0000924 3300053088 Bacteria 9347
547 Ga0500651_0013897 3300053093 Bacteria 4916
548 Ga0500641_0003080 3300053096 Bacteria 5909
549 Ga0500618_001070 3300053125 Bacteria 13517
550 Ga0500586_000020 3300053145 Bacteria 30971
551 Ga0500586_002907 3300053145 Bacteria 3964
552 2601670196 2600255292 Bacteria 6300551
553 2643791037 2643221554 Bacteria 6603920
554 2643797571 2643221556 Bacteria 7251154
555 2643884606 2643221574 Bacteria 2789653
556 2644215243 2643221638 Bacteria 6579467
557 2644254615 2643221645 Bacteria 7207331
558 2644351446 2643221663 Bacteria 3425771
559 2644360163 2643221664 Bacteria 7272945
560 2644470647 2643221684 Bacteria 7145183
561 2644553261 2643221699 Bacteria 5731501
562 2738710464 2738541275 Bacteria 4830863
563 2738741918 2738541280 Bacteria 6630198
564 2738827021 2738541297 Bacteria 6549566
565 2738845901 2738541300 Bacteria 6675882
566 2738848889 2738541301 Bacteria 4834102
567 2738864618 2738541304 Bacteria 4833665
568 2739150818 2738541357 Bacteria 6549408
569 2739192737 2738543003 Bacteria 6549560
570 2739276796 2738543018 Bacteria 6718814
571 2739297136 2738543022 Bacteria 4835059
572 2739319214 2738543026 Bacteria 6549408
573 2739337455 2738543029 Bacteria 6549249
574 2739345840 2738543030 Bacteria 6719714
575 2739358814 2738543033 Bacteria 4833336
576 2809144071 2808606418 Bacteria 6724496
577 2821136439 2821131069 Bacteria 6108407
578 2842712125 2842711865 Bacteria 7155354
579 2857553074 2857547612 Bacteria 6179999
580 2857557792 2857553236 Bacteria 6166726
581 2857559661 2857558681 Bacteria 6617694
582 2857568236 2857564685 Bacteria 6290584
583 2885084278 2885080285 Bacteria 6355622
584 2904428598 2904424332 Bacteria 7633521
585 2919477170 2919476304 Bacteria 5888696
586 2928100564 2928100450 Bacteria 4837635
587 2928960627 2928959182 Bacteria 4725774
588 2928974185 2928972540 Bacteria 3058286
589 2932413703 2932410948 Bacteria 6312192
590 2932417763 2932416698 Bacteria 6315112
591 2941487860 2941485952 Bacteria 3591484
592 2977240852 2977240413 Bacteria 3191065
593 8002869633 8002869464 Bacteria 3588529
594 8047678866 8047673197 Bacteria 7395230
595 Ga0495583_0008881
596 JGI25152J39213_1000003
597 JGI25150J39212_1000325
598 JGI25159J45721_1002066
599 JGI25159J45721_1002463
600 JGI25153J46596_10010601
601 rootL2_10004162
602 JGI25161J50226_1000830
603 Ga0055529_1000152
604 Ga0055526_1000025
605 Ga0055526_1000079
606 Ga0055526_1000467
607 Ga0055526_1000514
608 Ga0055537_1000098
609 Ga0055524_1000090
610 Ga0055524_1000696
611 Ga0055524_1011614
612 Ga0055536_1001410
613 Ga0055534_1000009
614 Ga0055534_1005698
615 Ga0055528_1000012
616 Ga0055528_1005576
617 Ga0055530_10001584
618 Ga0055543_1001111
619 Ga0055543_1002742
620 Ga0065165_1000051
621 Ga0065165_1005229
622 Ga0070658_10049742
623 Ga0070658_10096718
624 Ga0070680_100021120
625 Ga0070660_100036848
626 Ga0070689_100005216
627 Ga0070671_100008369
628 Ga0070659_100050580
629 Ga0070714_100054936
630 Ga0070710_10026745
631 Ga0070708_100021206
632 Ga0070681_10118016
633 Ga0070706_100008026
634 Ga0070698_100004950
635 Ga0070684_100008554
636 Ga0068855_100121551
637 Ga0070664_100073356
638 Ga0068852_100001921
639 Ga0068859_100018821
640 Ga0068851_10011558
641 Ga0068858_100014283
642 Ga0068860_100004026
643 Ga0075428_100006344
644 Ga0075428_100037453
645 Ga0075430_100045767
646 Ga0075431_100023523
647 Ga0075433_10057598
648 Ga0075433_10121249
649 Ga0075434_100004850
650 Ga0075434_100090191
651 Ga0075436_100060843
652 Ga0097620_100018821
653 Ga0099826_10000001
654 Ga0105244_10000891
655 Ga0105244_10000981
656 Ga0105244_10032501
657 Ga0111539_10061455
658 Ga0105241_10005321
659 Ga0105242_10008974
660 Ga0105237_10007063
661 Ga0105237_10051228
662 Ga0157371_10000399
663 Ga0157371_10010317
664 Ga0157371_10029129
665 Ga0157371_10034644
666 Ga0157370_10010757
667 Ga0157369_10037576
668 Ga0182006_1000080
669 Ga0182006_1000097
670 Ga0182007_10000227
671 Ga0182005_1000016
672 Ga0182005_1000038
673 Ga0213872_10000005
674 Ga0209436_100099
675 Ga0209436_100273
676 Ga0209563_100015
677 Ga0207425_1000014
678 Ga0207425_1000053
679 Ga0209646_1000190
680 Ga0209677_103085
681 Ga0209148_1000272
682 Ga0209129_1000017
683 Ga0209565_1000015
684 Ga0209565_1000558
685 Ga0209455_1000070
686 Ga0209673_1000017
687 Ga0209673_1009290
688 Ga0209130_1000063
689 Ga0209130_1001797
690 Ga0209130_1001856
691 Ga0209675_1000012
692 Ga0209675_1000655
693 Ga0209675_1004711
694 Ga0209676_1000115
695 Ga0209025_1009248
696 Ga0209564_1000016
697 Ga0209564_1000027
698 Ga0209564_1000047
699 Ga0209564_1000184
700 Ga0209564_1002884
701 Ga0209758_1000038
702 Ga0209758_1009637
703 Ga0209050_1000011
704 Ga0209050_1000159
705 Ga0209050_1001486
706 Ga0209050_1005040
707 Ga0209256_1000005
708 Ga0209256_1000138
709 Ga0209256_1000290
710 Ga0209256_1000593
711 Ga0209256_1005123
712 Ga0207426_1000654
713 Ga0209257_1000003
714 Ga0209257_1000090
715 Ga0207655_1004025
716 Ga0207680_10028010
717 Ga0207705_10001666
718 Ga0207684_10021521
719 Ga0207654_10002340
720 Ga0207707_10113795
721 Ga0207657_10019062
722 Ga0207657_10023264
723 Ga0207652_10035614
724 Ga0207646_10009557
725 Ga0207664_10048689
726 Ga0207690_10036169
727 Ga0207690_10036678
728 Ga0207690_10038026
729 Ga0207686_10004244
730 Ga0207691_10015946
731 Ga0207703_10025686
732 Ga0207674_10009103
733 Ga0207674_10036681
734 Ga0207698_10007362
735 Ga0209281_1004269
736 Ga0209282_1000001
737 Ga0268266_10001639
738 Ga0268264_10005333
739 Ga0307408_100000201
740 Ga0307408_100000244
741 Ga0307408_100021893
742 Ga0265314_10036835
743 Ga0307412_10000683
744 Ga0307416_100011300
745 Ga0307414_10011321
746 Ga0307414_10046584
747 Ga0373925_0072945
748 Ga0395899_0000207
749 Ga0395899_0014688
750 Ga0395899_0024233
751 Ga0395899_0030403
752 Ga0395899_0098493
753 Ga0395900_0001494
754 Ga0395900_0003169
755 Ga0395900_0009476
756 Ga0395900_0027990
757 Ga0395900_0057982
758 Ga0395905_0023707
759 Ga0395901_0000307
760 Ga0395901_0003234
761 Ga0436361_0153820
762 Ga0436361_0166253
763 Ga0436361_0756774
764 Ga0439448_0005870
765 Ga0450904_000237
766 Ga0439458_0001931
767 Ga0451577_0001913
768 Ga0451577_0012027
769 Ga0453683_0001881
770 Ga0466965_0004201
771 Ga0466965_0006857
772 Ga0466966_0002604
773 Ga0466966_0010985
774 Ga0466966_0018044
775 Ga0466963_0055906
776 Ga0466964_0000552
777 Ga0453684_0000080
778 Ga0453684_0188764
779 Ga0466957_0000668
780 Ga0466957_0010797
781 Ga0466959_0016008
782 Ga0451576_0001277
783 Ga0466958_0062094
784 Ga0466967_0018780
785 Ga0466967_0030102
786 Ga0495617_000002
787 Ga0495617_000075
788 Ga0495617_000189
789 Ga0495617_001824
790 Ga0495627_000011
791 Ga0495627_000915
792 Ga0495603_0028150
793 Ga0495590_0000021
794 Ga0495590_0000061
795 Ga0495590_0002112
796 Ga0495590_0009447
797 Ga0495591_000893
798 Ga0495638_0000096
799 Ga0495638_0000851
800 Ga0495638_0002022
801 Ga0495638_0018570
802 Ga0495653_0000044
803 Ga0495653_0007535
804 Ga0495653_0090290
805 Ga0495650_0000056
806 Ga0495650_0000100
807 Ga0495650_0000254
808 Ga0495650_0000533
809 Ga0495650_0000941
810 Ga0495650_0001000
811 Ga0495650_0001068
812 Ga0495650_0007208
813 Ga0495650_0013505
814 Ga0495582_0032410
815 Ga0495605_0000098
816 Ga0495605_0000121
817 Ga0495605_0000276
818 Ga0495605_0000402
819 Ga0495639_0005299
820 Ga0495639_0009772
821 Ga0495662_0000383
822 Ga0495584_0000011
823 Ga0495584_0000967
824 Ga0495584_0001472
825 Ga0495584_0002367
826 Ga0495584_0005137
827 Ga0495584_0008240
828 Ga0495584_0013925
829 Ga0495585_0000231
830 Ga0495585_0000661
831 Ga0495585_0000804
832 Ga0495585_0001080
833 Ga0495585_0003340
834 Ga0495585_0018152
835 Ga0495585_0021248
836 Ga0495596_0000167
837 Ga0495596_0001014
838 Ga0495596_0001079
839 Ga0495596_0006984
840 Ga0495596_0008630
841 Ga0495596_0008862
842 Ga0495607_0000541
843 Ga0495607_0002543
844 Ga0495607_0002623
845 Ga0495607_0002921
846 Ga0495607_0003644
847 Ga0495607_0006338
848 Ga0495607_0011753
849 Ga0495607_0038118
850 Ga0495583_0000150
851 Ga0495583_0000204
852 Ga0495583_0000277
853 Ga0495583_0000295
854 Ga0495583_0003003
855 Ga0495583_0003424
856 Ga0495583_0006723
857 Ga0495583_0006809
858 Ga0495583_0011338
859 Ga0495606_0000080
860 Ga0495606_0000093
861 Ga0495606_0000099
862 Ga0495606_0000208
863 Ga0495606_0000223
864 Ga0495606_0001227
865 Ga0495606_0002619
866 Ga0495606_0003499
867 Ga0495606_0007328
868 Ga0495606_0012672
869 Ga0495606_0046827
870 Ga0495610_0000017
871 Ga0495610_0000670
872 Ga0495610_0000833
873 Ga0495610_0015472
874 Ga0495616_0000513
875 Ga0495616_0001343
876 Ga0495616_0002023
877 Ga0495616_0003717
878 Ga0495616_0008346
879 Ga0495616_0009559
880 Ga0495616_0017117
881 Ga0495616_0024879
882 Ga0495630_0000083
883 Ga0495630_0025319
884 Ga0495631_0001460
885 Ga0495631_0006287
886 Ga0495632_0000648
887 Ga0495632_0001800
888 Ga0495632_0002267
889 Ga0495637_0000047
890 Ga0495637_0001447
891 Ga0495637_0008919
892 Ga0495643_0000142
893 Ga0495643_0000209
894 Ga0495643_0000672
895 Ga0495643_0002391
896 Ga0495643_0006507
897 Ga0495643_0013124
898 Ga0495643_0015589
899 Ga0495644_0000594
900 Ga0495644_0006197
901 Ga0495644_0007776
902 Ga0495648_0000017
903 Ga0495648_0000305
904 Ga0495648_0001222
905 Ga0495648_0001823
906 Ga0495648_0004635
907 Ga0495648_0006199
908 Ga0495648_0007998
909 Ga0495648_0020281
910 Ga0495648_0021344
911 Ga0495666_0004100
912 Ga0495666_0037295
913 Ga0495642_0001019
914 Ga0495642_0001727
915 Ga0495642_0001772
916 Ga0495642_0002181
917 Ga0495652_0004868
918 Ga0495654_0000030
919 Ga0495654_0008889
920 Ga0495654_0011932
921 Ga0495654_0018310
922 Ga0495665_0006843
923 Ga0495586_0011094
924 Ga0495586_0017583
925 Ga0495587_0025234
926 Ga0495587_0034417
927 Ga0495609_0000028
928 Ga0495609_0000235
929 Ga0495609_0000240
930 Ga0495609_0000872
931 Ga0495609_0007111
932 Ga0495609_0007725
933 Ga0495597_0000017
934 Ga0495597_0000257
935 Ga0495597_0002408
936 Ga0495597_0004838
937 Ga0495597_0005826
938 Ga0495597_0010618
939 Ga0495622_0000044
940 Ga0495622_0000058
941 Ga0495622_0019659
942 Ga0495633_0000070
943 Ga0495633_0000394
944 Ga0495633_0000415
945 Ga0495633_0001217
946 Ga0495633_0001238
947 Ga0495633_0002108
948 Ga0495633_0005389
949 Ga0495668_0000101
950 Ga0495668_0000143
951 Ga0495668_0000286
952 Ga0495668_0000647
953 Ga0495668_0002087
954 Ga0495668_0002663
955 Ga0495668_0003929
956 Ga0495668_0006324
957 Ga0495668_0007058
958 Ga0495668_0009671
959 Ga0495668_0012953
960 Ga0495668_0015524
961 Ga0495668_0038616
962 Ga0495634_0014674
963 Ga0495611_0004010
964 Ga0495611_0005790
965 Ga0495611_0007547
966 Ga0495611_0011654
967 Ga0495611_0013886
968 Ga0495611_0018727
969 Ga0495625_0000338
970 Ga0495625_0000556
971 Ga0495625_0002771
972 Ga0495625_0003853
973 Ga0495625_0014887
974 Ga0495625_0016511
975 Ga0495625_0045337
976 Ga0495625_0047241
977 Ga0495635_0049909
978 Ga0495659_0000064
979 Ga0495659_0000308
980 Ga0495661_0000862
981 Ga0495661_0002077
982 Ga0495661_0002137
983 Ga0495661_0004303
984 Ga0495661_0004545
985 Ga0495661_0010939
986 Ga0495661_0010992
987 Ga0495661_0026485
988 Ga0495661_0031596
989 Ga0495661_0033983
990 Ga0495588_0000070
991 Ga0495588_0003187
992 Ga0495669_0001025
993 Ga0495669_0001424
994 Ga0495613_0022050
995 Ga0495670_0010706
996 Ga0495671_0000026
997 Ga0495671_0000093
998 Ga0495671_0004255
999 Ga0495671_0006818
1000 Ga0495649_0001152
1001 Ga0495649_0001587
1002 Ga0495649_0001686
1003 Ga0495649_0002639
1004 Ga0495649_0006769
1005 Ga0495589_0000218
1006 Ga0495589_0001502
1007 Ga0495589_0002489
1008 Ga0495589_0003933
1009 Ga0495589_0010022
1010 Ga0495660_0000113
1011 Ga0495660_0000538
1012 Ga0495660_0000631
1013 Ga0495660_0001129
1014 Ga0495660_0003212
1015 Ga0495660_0005091
1016 Ga0495660_0013362
1017 Ga0495660_0018625
1018 Ga0495660_0032229
1019 Ga0495581_0021886
1020 Ga0495636_0000880
1021 Ga0495636_0003298
1022 Ga0495636_0005337
1023 Ga0495674_0015016
1024 Ga0495672_0000013
1025 Ga0495672_0000245
1026 Ga0495672_0000566
1027 Ga0495672_0001524
1028 Ga0495672_0001701
1029 Ga0495672_0003873
1030 Ga0495672_0004351
1031 Ga0495672_0010490
1032 Ga0495672_0026359
1033 Ga0495676_0000635
1034 Ga0495676_0003661
1035 Ga0495676_0089939
1036 Ga0495680_0031285
1037 Ga0495680_0062296
1038 Ga0495683_0000088
1039 Ga0495683_0001399
1040 Ga0495683_0003839
1041 Ga0495683_0021370
1042 Ga0495683_0027698
1043 Ga0495687_000057
1044 Ga0495687_000256
1045 Ga0495687_000288
1046 Ga0495687_001662
1047 Ga0495687_002171
1048 Ga0495687_004834
1049 Ga0495687_005242
1050 Ga0495687_006298
1051 Ga0495687_010266
1052 Ga0495687_010547
1053 Ga0495675_0009848
1054 Ga0495677_0000161
1055 Ga0495677_0000285
1056 Ga0495677_0000526
1057 Ga0495677_0001852
1058 Ga0495677_0004724
1059 Ga0495677_0005155
1060 Ga0495679_004809
1061 Ga0495685_000044
1062 Ga0495673_0000069
1063 Ga0495673_0000080
1064 Ga0495673_0000203
1065 Ga0495673_0003510
1066 Ga0495681_0002303
1067 Ga0495681_0002335
1068 Ga0495681_0007296
1069 Ga0495681_0012714
1070 Ga0495686_0000212
1071 Ga0495686_0000612
1072 Ga0495686_0000722
1073 Ga0495686_0000799
1074 Ga0495686_0015576
1075 Ga0495593_0026008
1076 Ga0495602_0006516
1077 Ga0495626_0000030
1078 Ga0495626_0001112
1079 Ga0495626_0001336
1080 Ga0495626_0001875
1081 Ga0495626_0019683
1082 Ga0495626_0025480
1083 Ga0496102_0000196
1084 Ga0496102_0002399
1085 Ga0496102_0086971
1086 Ga0496102_0103906
1087 Ga0496103_0029922
1088 Ga0496105_0098473
1089 Ga0496107_0047232
1090 Ga0496109_0083296
1091 Ga0496110_0002992
1092 Ga0496110_0006313
1093 Ga0496111_0005490
1094 Ga0496111_0047101
1095 Ga0496112_0054585
1096 Ga0496114_0051371
1097 Ga0496115_0062264
1098 Ga0496116_0037327
1099 Ga0496117_0000132
1100 Ga0496118_0000099
1101 Ga0496120_0017696
1102 Ga0496122_0004240
1103 Ga0496122_0005480
1104 Ga0496122_0009038
1105 Ga0496122_0023073
1106 Ga0496122_0054954
1107 Ga0496123_0003509
1108 Ga0496123_0003741
1109 Ga0496123_0004584
1110 Ga0496123_0014552
1111 Ga0496123_0022761
1112 Ga0496124_0011144
1113 Ga0496124_0020367
1114 Ga0496124_0024495
1115 Ga0496124_0026152
1116 Ga0496124_0047348
1117 Ga0496124_0147220
1118 Ga0496125_0002623
1119 Ga0496125_0005966
1120 Ga0496125_0034264
1121 Ga0495678_000010
1122 Ga0495678_000200
1123 Ga0495678_000230
1124 Ga0495678_000523
1125 Ga0495678_001473
1126 Ga0495678_001481
1127 Ga0495678_002815
1128 Ga0495678_002857
1129 Ga0495682_0001242
1130 Ga0495682_0001674
1131 Ga0501227_001645
1132 Ga0501269_000096
1133 Ga0501035_0004391
1134 nmdc:mga0qj67_54920_c1
1135 nmdc:mga0n895_2750_c1
1136 nmdc:mga0rr50_38275_c1
1137 nmdc:mga08x19_34190_c1
1138 nmdc:mga0a205_68281_c1
1139 nmdc:mga0a205_9670_c1
1140 Ga0500644_0000924
1141 Ga0500651_0013897
1142 Ga0500641_0003080
1143 Ga0500618_001070
1144 Ga0500586_000020
1145 Ga0500586_002907
1146 2601670196
1147 2643791037
1148 2643797571
1149 2643884606
1150 2644215243
1151 2644254615
1152 2644351446
1153 2644360163
1154 2644470647
1155 2644553261
1156 2738710464
1157 2738741918
1158 2738827021
1159 2738845901
1160 2738848889
1161 2738864618
1162 2739150818
1163 2739192737
1164 2739276796
1165 2739297136
1166 2739319214
1167 2739337455
1168 2739345840
1169 2739358814
1170 2809144071
1171 2821136439
1172 2842712125
1173 2857553074
1174 2857557792
1175 2857559661
1176 2857568236
1177 2885084278
1178 2904428598
1179 2919477170
1180 2928100564
1181 2928960627
1182 2928974185
1183 2932413703
1184 2932417763
1185 2941487860
1186 2977240852
1187 8002869633
1188 8047678866

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

524

734

0.97

PF07676

PD40

WD40-like Beta Propeller Repeat

127

163

0.95

PF07676

PD40

WD40-like Beta Propeller Repeat

275

312

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hxg-assembly2.cif.gz_G pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.893 24 687
4hxf-assembly1.cif.gz_B acylaminoacyl peptidase in complex with z-gly-gly-phe-chloromethyl ketone 0.8922 33 687
4hxg-assembly2.cif.gz_J pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.8917 24 687
4hxg-assembly1.cif.gz_C pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.8884 24 687
4hxg-assembly2.cif.gz_K pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.8879 24 687
ID Description Score Start End Superfamily
af_Q9P778_407_680_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9701 430 687 3.40.50.1820
4hxgB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9197 431 687 3.40.50.1820
af_Q9P778_407_680_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9112 430 687 3.40.50.1820
4re6B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8955 426 684 3.40.50.1820
af_Q9TYX1_461_736_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8908 427 686 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q3TLR1-F1-model_v4 S9 family peptidase 0.9859 544 687 GO:0004252
GO:0006508
AF-A0A2V8A6M8-F1-model_v4 S9 family peptidase 0.9709 342 686 GO:0004252
GO:0006508
AF-A0A7V4U2H2-F1-model_v4 S9 family peptidase 0.9663 553 686 GO:0004252
GO:0006508
AF-A0A4Q3TLR1-F1-model_v4 S9 family peptidase 0.966 544 687 GO:0004252
GO:0006508
AF-A0A660ZZB7-F1-model_v4 S9 family peptidase 0.9617 511 685 GO:0004252
GO:0006508

Map