F467482

General Info

Members Datasets Scaffolds Average Seq Length
595 263 590 174

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0101494|Ga0496100_0101494_1308_1904
Length 198
Sequence VSPEPDPPEATAGDDGTGHDDSGLDLARSIARGLARPGVRKRRAGSSDSGRYSPTRSAQRGDPQLSGAHPDDRDPQPLDATIGRLIDEQGWGTDVRVHGVFSRWDHIVGREVAQHCRPESFRQADDGPRPGGRLLVRTDSTAWATQMKLLAPQVVRRLNEELGDDTVTMIDVEGPHGPSWKRGRRSVRDGRGPRDTYG

Samples

Sample ID Description Type Environment
1 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
2 2643221696 Nocardioides sp. Root140 Isolate Unclassified
3 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
4 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
5 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
260 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.26
Nodule 0
Rhizoplane 8.74
Rhizosphere 78.99
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1024464 3300002070 Bacteria 861
2 rootH2_10147828 3300003320 Bacteria 1030
3 Ga0070658_10074664 3300005327 Bacteria 2781
4 Ga0070658_10082113 3300005327 Bacteria 2648
5 Ga0070683_100047670 3300005329 Bacteria 3960
6 Ga0070683_100072973 3300005329 Bacteria 3205
7 Ga0070683_100108192 3300005329 Bacteria 2622
8 Ga0070683_100594686 3300005329 Bacteria 1059
9 Ga0070670_100456163 3300005331 Bacteria 1133
10 Ga0070670_100528283 3300005331 Bacteria 1051
11 Ga0070680_100076152 3300005336 Bacteria 2762
12 Ga0070682_100007506 3300005337 Bacteria 6146
13 Ga0070682_100007958 3300005337 Bacteria 5964
14 Ga0070682_100071488 3300005337 Bacteria 2221
15 Ga0070682_100492900 3300005337 Bacteria 948
16 Ga0068868_100358725 3300005338 Bacteria 1250
17 Ga0068868_100435844 3300005338 Unclassified 1137
18 Ga0070660_100201644 3300005339 Bacteria 1614
19 Ga0070687_100107415 3300005343 Bacteria 1573
20 Ga0070661_100137564 3300005344 Bacteria 1839
21 Ga0070661_100808921 3300005344 Bacteria 769
22 Ga0070692_10239873 3300005345 Bacteria 1080
23 Ga0070668_100020104 3300005347 Bacteria 5034
24 Ga0070668_100064106 3300005347 Bacteria 2848
25 Ga0070675_100218338 3300005354 Bacteria 1660
26 Ga0070674_100419240 3300005356 Bacteria 1098
27 Ga0070674_100938516 3300005356 Bacteria 756
28 Ga0070688_101243859 3300005365 Bacteria 599
29 Ga0070659_100053664 3300005366 Bacteria 3173
30 Ga0070659_100129682 3300005366 Bacteria 2047
31 Ga0070667_100087977 3300005367 Bacteria 2667
32 Ga0070667_100461244 3300005367 Bacteria 1162
33 Ga0070700_100899308 3300005441 Unclassified 721
34 Ga0070700_101407190 3300005441 Bacteria 590
35 Ga0070694_101192762 3300005444 Unclassified 638
36 Ga0070663_100158337 3300005455 Bacteria 1742
37 Ga0070663_100690086 3300005455 Bacteria 867
38 Ga0070678_100343155 3300005456 Bacteria 1282
39 Ga0070662_100007456 3300005457 Bacteria 7091
40 Ga0070681_10072610 3300005458 Bacteria 3404
41 Ga0068867_100214439 3300005459 Bacteria 1548
42 Ga0070679_100012937 3300005530 Bacteria 7992
43 Ga0070679_100398125 3300005530 Bacteria 1323
44 Ga0070684_100006247 3300005535 Bacteria 9196
45 Ga0070684_100109597 3300005535 Bacteria 2474
46 Ga0070684_100306076 3300005535 Bacteria 1459
47 Ga0070684_100803075 3300005535 Bacteria 880
48 Ga0068853_100220972 3300005539 Bacteria 1730
49 Ga0068853_101065335 3300005539 Bacteria 779
50 Ga0070672_100159650 3300005543 Bacteria 1869
51 Ga0070693_100120212 3300005547 Bacteria 1628
52 Ga0070693_100984770 3300005547 Bacteria 637
53 Ga0070665_100030238 3300005548 Bacteria 5451
54 Ga0070665_100117286 3300005548 Bacteria 2665
55 Ga0070704_100543216 3300005549 Unclassified 1014
56 Ga0068855_100436885 3300005563 Bacteria 1430
57 Ga0068855_101979286 3300005563 Unclassified 589
58 Ga0068857_100015038 3300005577 Bacteria 6752
59 Ga0068857_100751769 3300005577 Bacteria 929
60 Ga0068854_100043348 3300005578 Bacteria 3189
61 Ga0068856_100126727 3300005614 Bacteria 2557
62 Ga0070702_100218423 3300005615 Bacteria 1273
63 Ga0070702_100330155 3300005615 Bacteria 1066
64 Ga0068852_100067112 3300005616 Bacteria 3136
65 Ga0068852_100073152 3300005616 Bacteria 3015
66 Ga0068852_100133184 3300005616 Unclassified 2291
67 Ga0068852_100277723 3300005616 Bacteria 1614
68 Ga0068852_101303306 3300005616 Bacteria 748
69 Ga0068864_100007822 3300005618 Bacteria 8809
70 Ga0068864_101033587 3300005618 Bacteria 816
71 Ga0068866_10040192 3300005718 Bacteria 2314
72 Ga0068866_10268303 3300005718 Bacteria 1052
73 Ga0068861_100196885 3300005719 Bacteria 1689
74 Ga0068861_100485395 3300005719 Bacteria 1114
75 Ga0068851_10232860 3300005834 Bacteria 1039
76 Ga0068863_100865560 3300005841 Bacteria 903
77 Ga0068858_101352622 3300005842 Bacteria 701
78 Ga0068860_100000169 3300005843 Bacteria 107281
79 Ga0068860_100135251 3300005843 Bacteria 2367
80 Ga0068860_100875642 3300005843 Bacteria 913
81 Ga0068862_100294402 3300005844 Bacteria 1492
82 Ga0068862_100791796 3300005844 Bacteria 925
83 Ga0081455_10012750 3300005937 Bacteria 8360
84 Ga0081455_10039656 3300005937 Bacteria 4160
85 Ga0081455_10074614 3300005937 Bacteria 2801
86 Ga0081455_10548664 3300005937 Bacteria 765
87 Ga0081538_10001122 3300005981 Bacteria 28365
88 Ga0081538_10123301 3300005981 Unclassified 1239
89 Ga0075365_10006726 3300006038 Bacteria 6359
90 Ga0075365_10016342 3300006038 Bacteria 4512
91 Ga0075365_10047312 3300006038 Bacteria 2827
92 Ga0075365_10061813 3300006038 Bacteria 2502
93 Ga0075365_10064304 3300006038 Bacteria 2457
94 Ga0075365_10082947 3300006038 Bacteria 2174
95 Ga0075365_10151026 3300006038 Bacteria 1616
96 Ga0075365_10232178 3300006038 Bacteria 1295
97 Ga0075365_10242724 3300006038 Bacteria 1265
98 Ga0075365_10283149 3300006038 Bacteria 1166
99 Ga0075365_10627585 3300006038 Bacteria 760
100 Ga0075365_10735762 3300006038 Bacteria 696
101 Ga0075368_10001586 3300006042 Bacteria 7296
102 Ga0075363_100000345 3300006048 Bacteria 13918
103 Ga0075363_100005271 3300006048 Bacteria 5737
104 Ga0075363_100009618 3300006048 Bacteria 4551
105 Ga0075363_100028665 3300006048 Bacteria 2866
106 Ga0075363_100110077 3300006048 Bacteria 1530
107 Ga0075363_100111770 3300006048 Bacteria 1519
108 Ga0075363_100202029 3300006048 Bacteria 1136
109 Ga0075364_10012942 3300006051 Bacteria 5120
110 Ga0075364_10055277 3300006051 Bacteria 2597
111 Ga0075364_10070518 3300006051 Bacteria 2301
112 Ga0075364_10079144 3300006051 Bacteria 2171
113 Ga0075364_10140259 3300006051 Bacteria 1625
114 Ga0075364_10167921 3300006051 Bacteria 1483
115 Ga0075364_10749874 3300006051 Bacteria 666
116 Ga0075432_10002266 3300006058 Bacteria 6398
117 Ga0075362_10007420 3300006177 Bacteria 4152
118 Ga0075367_10012972 3300006178 Bacteria 4465
119 Ga0075367_10020721 3300006178 Bacteria 3666
120 Ga0075367_10057610 3300006178 Bacteria 2310
121 Ga0097621_100583027 3300006237 Bacteria 1021
122 Ga0075370_10007923 3300006353 Bacteria 5439
123 Ga0075370_10026260 3300006353 Bacteria 3225
124 Ga0075370_10153352 3300006353 Bacteria 1350
125 Ga0075370_10257159 3300006353 Bacteria 1035
126 Ga0075428_100014025 3300006844 Bacteria 8919
127 Ga0075428_101288312 3300006844 Bacteria 769
128 Ga0075431_100710670 3300006847 Unclassified 982
129 Ga0075433_10010549 3300006852 Bacteria 7424
130 Ga0075433_10013070 3300006852 Bacteria 6734
131 Ga0075434_100004227 3300006871 Bacteria 12872
132 Ga0075434_100064387 3300006871 Bacteria 3650
133 Ga0068865_100108008 3300006881 Bacteria 2047
134 Ga0068865_100287623 3300006881 Bacteria 1311
135 Ga0075436_100009075 3300006914 Bacteria 6804
136 Ga0075436_100165065 3300006914 Bacteria 1562
137 Ga0075435_100002623 3300007076 Bacteria 11975
138 Ga0075435_100020712 3300007076 Bacteria 5046
139 Ga0105245_10029848 3300009098 Bacteria 4820
140 Ga0105245_10047452 3300009098 Bacteria 3840
141 Ga0105245_10700452 3300009098 Bacteria 1046
142 Ga0105245_11117090 3300009098 Bacteria 835
143 Ga0114129_10005929 3300009147 Bacteria 17292
144 Ga0114129_10595970 3300009147 Bacteria 1432
145 Ga0105243_10038740 3300009148 Bacteria 3713
146 Ga0105243_10051455 3300009148 Unclassified 3258
147 Ga0105243_10057005 3300009148 Bacteria 3110
148 Ga0105243_10334532 3300009148 Bacteria 1385
149 Ga0105243_10492838 3300009148 Bacteria 1159
150 Ga0105242_10023969 3300009176 Bacteria 4816
151 Ga0105242_10440641 3300009176 Bacteria 1225
152 Ga0105248_10100498 3300009177 Bacteria 3259
153 Ga0105237_10489548 3300009545 Bacteria 1236
154 Ga0105238_10078331 3300009551 Bacteria 3295
155 Ga0105238_10757339 3300009551 Unclassified 985
156 Ga0105238_10834770 3300009551 Bacteria 938
157 Ga0105249_10042287 3300009553 Bacteria 4144
158 Ga0105249_10411955 3300009553 Bacteria 1384
159 Ga0105249_10720702 3300009553 Bacteria 1058
160 Ga0105239_10023970 3300010375 Bacteria 6721
161 Ga0105239_10040949 3300010375 Bacteria 5077
162 Ga0105239_10186601 3300010375 Bacteria 2321
163 Ga0105246_10259121 3300011119 Bacteria 1385
164 Ga0105246_10791727 3300011119 Bacteria 840
165 Ga0105246_11366826 3300011119 Bacteria 659
166 Ga0157322_1008725 3300012490 Bacteria 781
167 Ga0157371_10038724 3300013102 Bacteria 3410
168 Ga0157371_10319388 3300013102 Bacteria 1127
169 Ga0157369_10380293 3300013105 Bacteria 1465
170 Ga0157374_11537217 3300013296 Bacteria 689
171 Ga0157378_10552020 3300013297 Bacteria 1157
172 Ga0163162_10036679 3300013306 Bacteria 4888
173 Ga0163162_10752636 3300013306 Bacteria 1093
174 Ga0157372_10035876 3300013307 Bacteria 5461
175 Ga0157372_10036668 3300013307 Bacteria 5405
176 Ga0157372_10251503 3300013307 Bacteria 2051
177 Ga0157372_10257516 3300013307 Bacteria 2026
178 Ga0157372_10585674 3300013307 Bacteria 1300
179 Ga0157372_11001790 3300013307 Bacteria 968
180 Ga0157375_10082072 3300013308 Bacteria 3265
181 Ga0157375_10142598 3300013308 Bacteria 2524
182 Ga0157375_10419804 3300013308 Bacteria 1504
183 Ga0157375_12026513 3300013308 Bacteria 684
184 Ga0163163_10048030 3300014325 Bacteria 4196
185 Ga0157380_10291892 3300014326 Bacteria 1498
186 Ga0157380_11159117 3300014326 Bacteria 815
187 Ga0157377_10026002 3300014745 Bacteria 3127
188 Ga0157377_10144192 3300014745 Bacteria 1466
189 Ga0157379_10107519 3300014968 Bacteria 2504
190 Ga0157376_11095400 3300014969 Bacteria 822
191 Ga0163161_10070947 3300017792 Bacteria 2548
192 Ga0163161_10262634 3300017792 Bacteria 1349
193 Ga0163161_10380416 3300017792 Unclassified 1128
194 Ga0207642_10011993 3300025899 Unclassified 3114
195 Ga0207688_10042479 3300025901 Bacteria 2531
196 Ga0207688_10075733 3300025901 Bacteria 1916
197 Ga0207688_10342596 3300025901 Bacteria 920
198 Ga0207688_10529962 3300025901 Bacteria 739
199 Ga0207647_10053537 3300025904 Bacteria 2486
200 Ga0207705_10036835 3300025909 Bacteria 3500
201 Ga0207707_10190058 3300025912 Bacteria 1791
202 Ga0207707_10260544 3300025912 Bacteria 1505
203 Ga0207660_10333446 3300025917 Bacteria 1213
204 Ga0207662_10116696 3300025918 Bacteria 1669
205 Ga0207662_10123208 3300025918 Bacteria 1627
206 Ga0207657_10202790 3300025919 Bacteria 1595
207 Ga0207649_10603269 3300025920 Bacteria 844
208 Ga0207649_10819848 3300025920 Bacteria 727
209 Ga0207652_10030146 3300025921 Bacteria 4540
210 Ga0207652_10351981 3300025921 Bacteria 1329
211 Ga0207694_10249025 3300025924 Unclassified 1453
212 Ga0207694_10620239 3300025924 Unclassified 910
213 Ga0207659_10329689 3300025926 Bacteria 1261
214 Ga0207687_10027949 3300025927 Bacteria 3787
215 Ga0207687_10029485 3300025927 Bacteria 3692
216 Ga0207687_10877334 3300025927 Bacteria 767
217 Ga0207664_10027585 3300025929 Bacteria 4307
218 Ga0207690_10033049 3300025932 Bacteria 3324
219 Ga0207706_10006460 3300025933 Bacteria 10886
220 Ga0207686_10314558 3300025934 Bacteria 1167
221 Ga0207709_10044866 3300025935 Bacteria 2674
222 Ga0207709_10045632 3300025935 Bacteria 2655
223 Ga0207709_10211824 3300025935 Bacteria 1391
224 Ga0207704_10102678 3300025938 Bacteria 1910
225 Ga0207691_10237328 3300025940 Bacteria 1577
226 Ga0207711_10156993 3300025941 Bacteria 2057
227 Ga0207661_10011093 3300025944 Bacteria 6512
228 Ga0207661_10032139 3300025944 Bacteria 4063
229 Ga0207661_10056173 3300025944 Bacteria 3160
230 Ga0207661_10083113 3300025944 Bacteria 2649
231 Ga0207667_10356748 3300025949 Bacteria 1491
232 Ga0207667_10557602 3300025949 Bacteria 1158
233 Ga0207712_10409437 3300025961 Bacteria 1142
234 Ga0207640_10034839 3300025981 Bacteria 3146
235 Ga0207658_10022763 3300025986 Bacteria 4365
236 Ga0207658_10520173 3300025986 Bacteria 1062
237 Ga0207677_10069906 3300026023 Bacteria 2471
238 Ga0207677_10328135 3300026023 Bacteria 1274
239 Ga0207677_10637622 3300026023 Unclassified 939
240 Ga0207703_10369188 3300026035 Bacteria 1325
241 Ga0207639_10096120 3300026041 Bacteria 2383
242 Ga0207678_10227403 3300026067 Bacteria 1597
243 Ga0207641_10662352 3300026088 Bacteria 1026
244 Ga0207648_10048534 3300026089 Bacteria 3716
245 Ga0207676_10013119 3300026095 Bacteria 5949
246 Ga0207674_10010236 3300026116 Bacteria 10652
247 Ga0207675_100008587 3300026118 Bacteria 9607
248 Ga0207675_100101448 3300026118 Bacteria 2711
249 Ga0207675_100520964 3300026118 Bacteria 1185
250 Ga0207683_10177755 3300026121 Bacteria 1929
251 Ga0207683_11298442 3300026121 Bacteria 674
252 Ga0207698_10093955 3300026142 Bacteria 2464
253 Ga0207698_10936799 3300026142 Bacteria 875
254 Ga0209813_10000696 3300027866 Bacteria 7671
255 Ga0209813_10000702 3300027866 Bacteria 7653
256 Ga0207428_10000752 3300027907 Bacteria 37021
257 Ga0207428_10003453 3300027907 Bacteria 15343
258 Ga0268266_10019890 3300028379 Bacteria 5721
259 Ga0268266_10514816 3300028379 Bacteria 1144
260 Ga0268265_10723060 3300028380 Unclassified 964
261 Ga0268264_10000808 3300028381 Bacteria 33720
262 Ga0268264_10360629 3300028381 Bacteria 1386
263 Ga0316182_1003868 3300030745 Bacteria 6985
264 Ga0307408_100003697 3300031548 Bacteria 10418
265 Ga0307408_100304926 3300031548 Bacteria 1335
266 Ga0307408_100820160 3300031548 Bacteria 846
267 Ga0307405_10024951 3300031731 Bacteria 3425
268 Ga0307405_10057693 3300031731 Bacteria 2440
269 Ga0307405_10766433 3300031731 Bacteria 805
270 Ga0307413_10045218 3300031824 Unclassified 2608
271 Ga0307410_10000663 3300031852 Bacteria 14246
272 Ga0307410_10128330 3300031852 Bacteria 1859
273 Ga0307410_10492931 3300031852 Bacteria 1007
274 Ga0307410_10783151 3300031852 Bacteria 810
275 Ga0307406_10000224 3300031901 Bacteria 34452
276 Ga0307406_10160341 3300031901 Unclassified 1616
277 Ga0307406_10549294 3300031901 Bacteria 945
278 Ga0307407_10004352 3300031903 Bacteria 5996
279 Ga0307407_10018417 3300031903 Bacteria 3532
280 Ga0307407_10046151 3300031903 Bacteria 2466
281 Ga0307407_10071474 3300031903 Bacteria 2066
282 Ga0307407_10120743 3300031903 Bacteria 1661
283 Ga0307412_10025099 3300031911 Bacteria 3687
284 Ga0307412_10084909 3300031911 Bacteria 2199
285 Ga0307409_100000129 3300031995 Bacteria 28229
286 Ga0307409_100138708 3300031995 Bacteria 2091
287 Ga0307409_100314247 3300031995 Bacteria 1463
288 Ga0307409_100491339 3300031995 Bacteria 1193
289 Ga0307416_100000359 3300032002 Bacteria 23730
290 Ga0307416_100665207 3300032002 Unclassified 1127
291 Ga0307416_101630508 3300032002 Unclassified 750
292 Ga0307414_10035195 3300032004 Bacteria 3330
293 Ga0307414_10311232 3300032004 Bacteria 1337
294 Ga0307414_10377065 3300032004 Bacteria 1225
295 Ga0307411_10020714 3300032005 Bacteria 3832
296 Ga0307411_10063692 3300032005 Bacteria 2465
297 Ga0307411_10146817 3300032005 Bacteria 1747
298 Ga0307411_10396845 3300032005 Bacteria 1139
299 Ga0307411_10634526 3300032005 Bacteria 923
300 Ga0307411_10655069 3300032005 Bacteria 910
301 Ga0307415_100001245 3300032126 Bacteria 11957
302 Ga0307415_100001778 3300032126 Bacteria 10544
303 Ga0307415_100010319 3300032126 Bacteria 5284
304 Ga0307415_100014784 3300032126 Bacteria 4601
305 Ga0307415_100090012 3300032126 Bacteria 2218
306 Ga0307415_100607739 3300032126 Bacteria 974
307 Ga0373947_0398232 3300035725 Bacteria 928
308 Ga0395900_0381602 3300037418 Bacteria 1377
309 Ga0395898_0524526 3300037466 Bacteria 1126
310 Ga0395898_0631245 3300037466 Bacteria 1014
311 Ga0395905_0665340 3300037471 Bacteria 943
312 Ga0395901_0632415 3300038443 Bacteria 1076
313 Ga0436365_0251476 3300039437 Bacteria 1041
314 Ga0439438_017240 3300041405 Bacteria 2083
315 Ga0439461_0026859 3300041410 Bacteria 1177
316 Ga0439465_0040075 3300041413 Bacteria 1513
317 Ga0451793_1004716 3300041452 Bacteria 2302
318 Ga0439431_0008722 3300041997 Bacteria 2283
319 Ga0439448_0080023 3300042005 Bacteria 1097
320 Ga0439457_026846 3300042014 Bacteria 1275
321 Ga0439463_005203 3300042016 Bacteria 3233
322 Ga0439434_0036133 3300042435 Bacteria 1511
323 Ga0439444_0011056 3300042437 Bacteria 1455
324 Ga0439460_0026855 3300042461 Bacteria 1613
325 Ga0439460_0038136 3300042461 Bacteria 1400
326 Ga0450893_0088616 3300042532 Bacteria 619
327 Ga0439440_0001382 3300042993 Bacteria 4404
328 Ga0439440_0001652 3300042993 Bacteria 4098
329 Ga0439440_0016115 3300042993 Bacteria 1631
330 Ga0466961_0135127 3300044693 Bacteria 1545
331 Ga0466961_0340977 3300044693 Bacteria 913
332 Ga0466963_0384072 3300044694 Bacteria 990
333 Ga0466968_0162668 3300044735 Bacteria 1031
334 Ga0466970_0002325 3300044765 Bacteria 9197
335 Ga0466970_0150429 3300044765 Bacteria 1285
336 Ga0466957_0014224 3300044842 Bacteria 4632
337 Ga0466957_0205601 3300044842 Bacteria 1295
338 Ga0466960_0182246 3300044901 Bacteria 1139
339 Ga0466967_0019964 3300045976 Bacteria 5402
340 Ga0466967_0026332 3300045976 Bacteria 4815
341 Ga0466967_0073352 3300045976 Bacteria 3070
342 Ga0466967_0127732 3300045976 Bacteria 2356
343 Ga0466967_0334583 3300045976 Bacteria 1463
344 Ga0466967_0382938 3300045976 Bacteria 1366
345 Ga0466967_1021491 3300045976 Bacteria 823
346 Ga0495651_0068460 3300046462 Bacteria 2706
347 Ga0495653_0026341 3300046463 Bacteria 4662
348 Ga0495582_0345802 3300046473 Bacteria 856
349 Ga0495596_0096887 3300046500 Bacteria 1145
350 Ga0495608_0368325 3300046511 Bacteria 882
351 Ga0495616_0202441 3300046513 Bacteria 872
352 Ga0495620_0225011 3300046515 Unclassified 718
353 Ga0495645_0464315 3300046543 Bacteria 796
354 Ga0495668_0286285 3300046616 Bacteria 903
355 Ga0495661_0372192 3300046665 Bacteria 699
356 Ga0495657_0242648 3300046675 Bacteria 1087
357 Ga0495657_0420929 3300046675 Bacteria 784
358 Ga0495613_0501432 3300046689 Bacteria 817
359 Ga0495670_0555561 3300046691 Bacteria 625
360 Ga0495600_0066467 3300046809 Bacteria 2357
361 Ga0495674_0778327 3300047319 Bacteria 746
362 Ga0495680_0217112 3300047322 Bacteria 1367
363 Ga0495677_0250729 3300047445 Bacteria 692
364 Ga0495593_0702190 3300047673 Bacteria 508
365 Ga0496100_0007513 3300048903 Bacteria 6020
366 Ga0496100_0022343 3300048903 Bacteria 3828
367 Ga0496100_0101494 3300048903 Bacteria 1984
368 Ga0496100_0619397 3300048903 Bacteria 841
369 Ga0496100_0622415 3300048903 Bacteria 839
370 Ga0496100_0835778 3300048903 Bacteria 722
371 Ga0496101_0035400 3300048904 Bacteria 3531
372 Ga0496101_0146183 3300048904 Bacteria 1805
373 Ga0496101_0207333 3300048904 Bacteria 1517
374 Ga0496101_0882358 3300048904 Bacteria 704
375 Ga0496102_0019212 3300048905 Bacteria 6017
376 Ga0496102_0019720 3300048905 Bacteria 5943
377 Ga0496102_0073035 3300048905 Bacteria 3153
378 Ga0496103_0271757 3300048906 Bacteria 1090
379 Ga0496104_0007844 3300048907 Bacteria 9461
380 Ga0496104_0579649 3300048907 Bacteria 1032
381 Ga0496105_0020857 3300048908 Bacteria 5298
382 Ga0496105_0417679 3300048908 Bacteria 1062
383 Ga0496106_0005742 3300048909 Bacteria 9179
384 Ga0496106_0595741 3300048909 Bacteria 885
385 Ga0496107_0027174 3300048910 Bacteria 4063
386 Ga0496107_0485331 3300048910 Bacteria 917
387 Ga0496108_0091957 3300048911 Bacteria 2579
388 Ga0496108_0092330 3300048911 Bacteria 2574
389 Ga0496108_0223957 3300048911 Bacteria 1634
390 Ga0496108_0319918 3300048911 Bacteria 1353
391 Ga0496108_0328774 3300048911 Bacteria 1333
392 Ga0496108_1276852 3300048911 Bacteria 618
393 Ga0496109_0062182 3300048912 Bacteria 3414
394 Ga0496109_0078844 3300048912 Bacteria 3033
395 Ga0496109_0120944 3300048912 Bacteria 2439
396 Ga0496109_0796043 3300048912 Bacteria 883
397 Ga0496109_0927109 3300048912 Bacteria 809
398 Ga0496110_0020063 3300048913 Bacteria 5637
399 Ga0496110_0113340 3300048913 Bacteria 2439
400 Ga0496110_0139986 3300048913 Bacteria 2187
401 Ga0496110_0290978 3300048913 Bacteria 1488
402 Ga0496111_0026551 3300048914 Bacteria 4090
403 Ga0496111_0731838 3300048914 Bacteria 718
404 Ga0496112_0129754 3300048915 Bacteria 2492
405 Ga0496113_0010415 3300048916 Bacteria 6147
406 Ga0496113_0143336 3300048916 Bacteria 1881
407 Ga0496113_0154388 3300048916 Bacteria 1812
408 Ga0496113_0183069 3300048916 Bacteria 1661
409 Ga0496114_0011613 3300048917 Bacteria 7042
410 Ga0496114_0021705 3300048917 Bacteria 5226
411 Ga0496114_0055122 3300048917 Bacteria 3315
412 Ga0496114_0157288 3300048917 Bacteria 1974
413 Ga0496114_0351741 3300048917 Bacteria 1303
414 Ga0496115_0004989 3300048918 Bacteria 9637
415 Ga0496115_0043621 3300048918 Bacteria 3577
416 Ga0501031_0000577 3300049568 Bacteria 21539
417 Ga0501031_0013758 3300049568 Bacteria 5275
418 Ga0501031_0014464 3300049568 Bacteria 5128
419 Ga0501032_0000432 3300049569 Bacteria 34501
420 Ga0501032_0071553 3300049569 Bacteria 2311
421 Ga0501033_0001452 3300049570 Bacteria 20996
422 Ga0501033_0030820 3300049570 Bacteria 4031
423 Ga0501033_0051478 3300049570 Bacteria 3052
424 Ga0501033_0145734 3300049570 Bacteria 1710
425 Ga0501034_0005805 3300049571 Bacteria 13423
426 Ga0501034_0007308 3300049571 Bacteria 11772
427 Ga0501034_0026056 3300049571 Bacteria 5956
428 Ga0501036_0000108 3300049572 Bacteria 51067
429 Ga0501036_0003611 3300049572 Bacteria 12365
430 Ga0501036_0007232 3300049572 Bacteria 9040
431 Ga0501036_0030081 3300049572 Bacteria 4588
432 Ga0501036_0422952 3300049572 Bacteria 1111
433 Ga0501037_0001254 3300049573 Bacteria 18693
434 Ga0501037_0002261 3300049573 Bacteria 13916
435 Ga0501037_0295735 3300049573 Bacteria 1125
436 Ga0501038_0000130 3300049574 Bacteria 63940
437 Ga0501038_0021356 3300049574 Bacteria 5811
438 Ga0501038_0023173 3300049574 Bacteria 5554
439 Ga0501038_0180089 3300049574 Bacteria 1706
440 Ga0501039_0001896 3300049575 Bacteria 15463
441 Ga0501039_0008612 3300049575 Bacteria 7775
442 Ga0501039_0036336 3300049575 Bacteria 3801
443 Ga0501040_0004213 3300049576 Bacteria 9362
444 Ga0501040_0046839 3300049576 Bacteria 2952
445 Ga0501040_0186858 3300049576 Bacteria 1470
446 Ga0501041_0003615 3300049577 Bacteria 8891
447 Ga0501042_0067467 3300049578 Bacteria 2557
448 Ga0501042_0102282 3300049578 Bacteria 2061
449 Ga0501043_0000147 3300049579 Bacteria 65326
450 Ga0501043_0006882 3300049579 Bacteria 9074
451 Ga0501043_0015526 3300049579 Bacteria 5968
452 Ga0501043_0324872 3300049579 Bacteria 1172
453 Ga0501046_0000067 3300049580 Bacteria 114617
454 Ga0501046_0012682 3300049580 Bacteria 7167
455 Ga0501046_0015083 3300049580 Bacteria 6498
456 Ga0501046_0040387 3300049580 Bacteria 3728
457 Ga0501046_0424858 3300049580 Bacteria 958
458 Ga0501047_0003345 3300049581 Bacteria 15193
459 Ga0501047_0048868 3300049581 Bacteria 4085
460 Ga0501047_0188880 3300049581 Bacteria 1924
461 Ga0501047_0291326 3300049581 Bacteria 1476
462 Ga0501047_0464717 3300049581 Bacteria 1094
463 Ga0501048_0000007 3300049582 Bacteria 86855
464 Ga0501048_0005697 3300049582 Bacteria 9468
465 Ga0501048_0568896 3300049582 Bacteria 813
466 Ga0501067_0001510 3300049583 Bacteria 12667
467 Ga0501067_0003198 3300049583 Bacteria 9034
468 Ga0501067_0013543 3300049583 Bacteria 4517
469 Ga0501067_0107170 3300049583 Bacteria 1553
470 Ga0501067_0117375 3300049583 Bacteria 1480
471 Ga0501067_0242696 3300049583 Bacteria 1003
472 Ga0501068_0003848 3300049584 Bacteria 8146
473 Ga0501068_0016683 3300049584 Bacteria 4236
474 Ga0501068_0019942 3300049584 Bacteria 3901
475 Ga0501068_0048280 3300049584 Bacteria 2569
476 Ga0501069_0013428 3300049585 Bacteria 4368
477 Ga0501069_0028927 3300049585 Bacteria 3039
478 Ga0501069_0164193 3300049585 Bacteria 1279
479 Ga0501069_0183438 3300049585 Bacteria 1210
480 Ga0501069_0235607 3300049585 Bacteria 1066
481 Ga0501069_0244219 3300049585 Bacteria 1047
482 Ga0501069_0292616 3300049585 Bacteria 954
483 Ga0501070_0000171 3300049586 Bacteria 59820
484 Ga0501070_0001780 3300049586 Bacteria 19033
485 Ga0501070_0110273 3300049586 Bacteria 2274
486 Ga0501070_0191067 3300049586 Bacteria 1683
487 Ga0501070_0280913 3300049586 Bacteria 1358
488 Ga0501070_0444701 3300049586 Bacteria 1045
489 Ga0501070_0525199 3300049586 Bacteria 949
490 Ga0501070_0552686 3300049586 Bacteria 921
491 Ga0501071_0016265 3300049587 Bacteria 5115
492 Ga0501071_0025850 3300049587 Bacteria 4115
493 Ga0501071_0110951 3300049587 Bacteria 2027
494 Ga0501071_0249317 3300049587 Bacteria 1340
495 Ga0501071_0493140 3300049587 Bacteria 939
496 Ga0501072_0010378 3300049588 Bacteria 7096
497 Ga0501072_0022214 3300049588 Bacteria 4922
498 Ga0501072_0052360 3300049588 Bacteria 3214
499 Ga0501072_0168204 3300049588 Bacteria 1749
500 Ga0501073_0002199 3300049589 Bacteria 14595
501 Ga0501073_0003368 3300049589 Bacteria 12012
502 Ga0501074_0000506 3300049590 Bacteria 23867
503 Ga0501074_0002964 3300049590 Bacteria 11931
504 Ga0501074_0013200 3300049590 Bacteria 6006
505 Ga0501074_0040715 3300049590 Bacteria 3364
506 Ga0501074_0085786 3300049590 Bacteria 2256
507 Ga0501074_0640748 3300049590 Bacteria 751
508 Ga0501075_0035642 3300049591 Bacteria 3711
509 Ga0501076_0085822 3300049592 Bacteria 2530
510 Ga0501077_0011204 3300049593 Bacteria 5594
511 Ga0501077_0016695 3300049593 Bacteria 4628
512 Ga0501079_0012719 3300049741 Bacteria 6429
513 Ga0501079_0021752 3300049741 Bacteria 4909
514 Ga0501079_0047850 3300049741 Bacteria 3300
515 Ga0501079_0184389 3300049741 Bacteria 1629
516 Ga0501080_0001760 3300049742 Bacteria 18573
517 Ga0501080_0023405 3300049742 Bacteria 5726
518 Ga0501080_0024281 3300049742 Bacteria 5620
519 Ga0501080_0059601 3300049742 Bacteria 3552
520 Ga0501080_0065119 3300049742 Bacteria 3390
521 Ga0501081_0043273 3300049743 Bacteria 3088
522 Ga0501083_0002246 3300049744 Bacteria 13197
523 Ga0501083_0010565 3300049744 Bacteria 6498
524 Ga0501083_0043393 3300049744 Bacteria 3047
525 Ga0501083_0071511 3300049744 Bacteria 2306
526 Ga0501035_0009180 3300049822 Bacteria 9195
527 Ga0501035_0051210 3300049822 Bacteria 3697
528 Ga0501044_0013089 3300049823 Bacteria 8979
529 Ga0501044_0290144 3300049823 Bacteria 1567
530 Ga0501044_0307034 3300049823 Bacteria 1514
531 Ga0501044_0857125 3300049823 Bacteria 785
532 Ga0501045_0010906 3300049824 Bacteria 6364
533 Ga0501045_0232056 3300049824 Bacteria 1374
534 Ga0501045_0388349 3300049824 Bacteria 1039
535 nmdc:mga03n38_26870_c1 3300050490 Bacteria 2382
536 nmdc:mga03n38_39398_c1 3300050490 Bacteria 2049
537 nmdc:mga03n38_47666_c1 3300050490 Bacteria 1898
538 nmdc:mga03n38_49207_c1 3300050490 Bacteria 1873
539 nmdc:mga03n38_64501_c1 3300050490 Bacteria 1677
540 nmdc:mga00v17_163187_c1 3300050491 Bacteria 1435
541 nmdc:mga00v17_17529_c1 3300050491 Bacteria 4056
542 nmdc:mga00v17_38058_c1 3300050491 Bacteria 2875
543 nmdc:mga00v17_49351_c1 3300050491 Bacteria 2553
544 nmdc:mga00v17_51722_c1 3300050491 Bacteria 2498
545 nmdc:mga00v17_80096_c1 3300050491 Bacteria 2038
546 nmdc:mga0yw44_141364_c1 3300050492 Bacteria 1565
547 nmdc:mga0yw44_148222_c1 3300050492 Bacteria 1090
548 nmdc:mga0yw44_202946_c1 3300050492 Bacteria 1310
549 nmdc:mga0yw44_22909_c1 3300050492 Bacteria 3510
550 nmdc:mga0yw44_241705_c1 3300050492 Bacteria 1200
551 nmdc:mga0yw44_30434_c1 3300050492 Bacteria 3128
552 nmdc:mga0yw44_359232_c1 3300050492 Bacteria 981
553 nmdc:mga0yw44_367359_c1 3300050492 Bacteria 970
554 nmdc:mga0yw44_37743_c1 3300050492 Bacteria 2854
555 nmdc:mga0yw44_48376_c1 3300050492 Bacteria 2564
556 nmdc:mga06z11_55283_c1 3300050494 Bacteria 2049
557 nmdc:mga04h51_19179_c1 3300050495 Bacteria 2025
558 nmdc:mga04h51_749_c1 3300050495 Bacteria 7517
559 nmdc:mga07m45_320399_c1 3300050496 Bacteria 901
560 nmdc:mga07m45_390685_c1 3300050496 Bacteria 808
561 nmdc:mga07m45_47117_c1 3300050496 Bacteria 2423
562 nmdc:mga07m45_84712_c1 3300050496 Bacteria 1812
563 nmdc:mga05p37_98688_c1 3300050507 Bacteria 3598
564 nmdc:mga09592_63443_c1 3300050508 Bacteria 3127
565 nmdc:mga0qj67_249487_c1 3300050509 Bacteria 1440
566 nmdc:mga08y16_199676_c1 3300050511 Bacteria 2073
567 nmdc:mga0n895_102349_c1 3300050512 Bacteria 2875
568 nmdc:mga0rr50_95590_c1 3300050513 Bacteria 2323
569 nmdc:mga08x19_67908_c1 3300050514 Bacteria 2319
570 nmdc:mga0a205_88277_c1 3300050515 Bacteria 2997
571 Ga0495601_0276996 3300053077 Bacteria 1094
572 Ga0495595_0078876 3300053084 Bacteria 1566
573 Ga0495595_0161347 3300053084 Bacteria 1106
574 Ga0495619_0632131 3300053085 Bacteria 731
575 Ga0500593_000024 3300053117 Bacteria 52015
576 Ga0500573_0009020 3300053140 Bacteria 5517
577 Ga0501084_0001403 3300054114 Bacteria 19059
578 Ga0501084_0020970 3300054114 Bacteria 5449
579 Ga0501084_0028061 3300054114 Bacteria 4704
580 Ga0501084_0063790 3300054114 Bacteria 3085
581 Ga0501084_0079069 3300054114 Bacteria 2756
582 Ga0501084_0279503 3300054114 Bacteria 1410
583 Ga0501082_0008218 3300060353 Bacteria 9001
584 Ga0501082_0035626 3300060353 Bacteria 4289
585 Ga0501082_0038695 3300060353 Bacteria 4113
586 Ga0501082_1030576 3300060353 Bacteria 720
587 Ga0530510_0065272 3300061734 Bacteria 2637
588 Ga0530510_0186293 3300061734 Bacteria 1540
589 Ga0530510_0200408 3300061734 Bacteria 1482
590 Ga0530510_0473578 3300061734 Bacteria 948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100492900 Ga0070682_1004929001 139
2 3300006038 Ga0075365_10082947 Ga0075365_100829472 144
3 3300050492 nmdc:mga0yw44_241705_c1 nmdc:mga0yw44_241705_c1_555_1079 144
4 3300030745 Ga0316182_1003868 Ga0316182_10038685 145
5 3300031903 Ga0307407_10071474 Ga0307407_100714742 145
6 3300032004 Ga0307414_10311232 Ga0307414_103112322 145
7 3300046675 Ga0495657_0420929 Ga0495657_0420929_194_766 145
8 3300048913 Ga0496110_0113340 Ga0496110_0113340_1448_2041 145
9 3300061734 Ga0530510_0473578 Ga0530510_0473578_59_634 145
10 3300047319 Ga0495674_0778327 Ga0495674_0778327_229_702 146
11 3300044842 Ga0466957_0205601 Ga0466957_0205601_323_940 147
12 3300006038 Ga0075365_10006726 Ga0075365_100067262 149
13 3300006048 Ga0075363_100009618 Ga0075363_1000096184 149
14 3300006051 Ga0075364_10012942 Ga0075364_100129424 149
15 3300006051 Ga0075364_10167921 Ga0075364_101679212 149
16 3300006177 Ga0075362_10007420 Ga0075362_100074203 149
17 3300006178 Ga0075367_10020721 Ga0075367_100207212 149
18 3300027866 Ga0209813_10000702 Ga0209813_100007024 149
19 3300044765 Ga0466970_0150429 Ga0466970_0150429_112_729 149
20 3300050490 nmdc:mga03n38_64501_c1 nmdc:mga03n38_64501_c1_442_960 149
21 3300050491 nmdc:mga00v17_163187_c1 nmdc:mga00v17_163187_c1_451_963 149
22 3300050495 nmdc:mga04h51_749_c1 nmdc:mga04h51_749_c1_5593_6111 149
23 3300005329 Ga0070683_100594686 Ga0070683_1005946863 150
24 3300005535 Ga0070684_100803075 Ga0070684_1008030751 150
25 3300006038 Ga0075365_10047312 Ga0075365_100473122 150
26 3300006038 Ga0075365_10242724 Ga0075365_102427241 150
27 3300013308 Ga0157375_12026513 Ga0157375_120265131 150
28 3300049586 Ga0501070_0552686 Ga0501070_0552686_247_768 150
29 3300049588 Ga0501072_0168204 Ga0501072_0168204_636_1157 150
30 3300050492 nmdc:mga0yw44_148222_c1 nmdc:mga0yw44_148222_c1_542_1069 150
31 3300041405 Ga0439438_017240 Ga0439438_017240_697_1257 151
32 3300041410 Ga0439461_0026859 Ga0439461_0026859_485_1045 151
33 3300041413 Ga0439465_0040075 Ga0439465_0040075_65_625 151
34 3300041452 Ga0451793_1004716 Ga0451793_1004716_846_1343 151
35 3300041997 Ga0439431_0008722 Ga0439431_0008722_324_884 151
36 3300042014 Ga0439457_026846 Ga0439457_026846_29_589 151
37 3300005455 Ga0070663_100690086 Ga0070663_1006900861 152
38 3300005535 Ga0070684_100109597 Ga0070684_1001095972 152
39 3300005614 Ga0068856_100126727 Ga0068856_1001267273 152
40 3300026023 Ga0207677_10069906 Ga0207677_100699061 152
41 3300032005 Ga0307411_10634526 Ga0307411_106345261 152
42 3300037466 Ga0395898_0631245 Ga0395898_0631245_278_808 152
43 3300048903 Ga0496100_0007513 Ga0496100_0007513_3617_4219 152
44 3300048903 Ga0496100_0835778 Ga0496100_0835778_19_645 152
45 3300048904 Ga0496101_0207333 Ga0496101_0207333_623_1225 152
46 3300048905 Ga0496102_0019212 Ga0496102_0019212_2291_2893 152
47 3300048908 Ga0496105_0417679 Ga0496105_0417679_20_622 152
48 3300048909 Ga0496106_0005742 Ga0496106_0005742_3251_3853 152
49 3300048910 Ga0496107_0485331 Ga0496107_0485331_100_702 152
50 3300048911 Ga0496108_0223957 Ga0496108_0223957_766_1368 152
51 3300048912 Ga0496109_0062182 Ga0496109_0062182_1996_2622 152
52 3300048913 Ga0496110_0139986 Ga0496110_0139986_97_699 152
53 3300048916 Ga0496113_0143336 Ga0496113_0143336_36_662 152
54 3300048917 Ga0496114_0021705 Ga0496114_0021705_3923_4525 152
55 3300049585 Ga0501069_0235607 Ga0501069_0235607_238_840 152
56 3300049586 Ga0501070_0444701 Ga0501070_0444701_211_741 152
57 3300049586 Ga0501070_0525199 Ga0501070_0525199_208_738 152
58 3300006852 Ga0075433_10013070 Ga0075433_100130702 153
59 3300006871 Ga0075434_100064387 Ga0075434_1000643872 153
60 3300006914 Ga0075436_100009075 Ga0075436_1000090753 153
61 3300007076 Ga0075435_100002623 Ga0075435_1000026237 153
62 3300027907 Ga0207428_10003453 Ga0207428_100034533 153
63 3300032126 Ga0307415_100607739 Ga0307415_1006077392 153
64 3300042435 Ga0439434_0036133 Ga0439434_0036133_224_736 153
65 3300045976 Ga0466967_0026332 Ga0466967_0026332_185_745 153
66 3300050492 nmdc:mga0yw44_141364_c1 nmdc:mga0yw44_141364_c1_926_1438 153
67 3300009098 Ga0105245_10700452 Ga0105245_107004522 154
68 3300011119 Ga0105246_11366826 Ga0105246_113668262 154
69 3300031901 Ga0307406_10160341 Ga0307406_101603412 154
70 3300031995 Ga0307409_100491339 Ga0307409_1004913392 154
71 3300048917 Ga0496114_0157288 Ga0496114_0157288_185_649 154
72 3300053117 Ga0500593_000024 Ga0500593_000024_16055_16597 154
73 3300003320 rootH2_10147828 rootH2_101478282 155
74 3300031903 Ga0307407_10018417 Ga0307407_100184171 155
75 3300032002 Ga0307416_101630508 Ga0307416_1016305081 155
76 3300032126 Ga0307415_100010319 Ga0307415_1000103191 155
77 3300035725 Ga0373947_0398232 Ga0373947_0398232_72_542 155
78 3300046473 Ga0495582_0345802 Ga0495582_0345802_362_832 155
79 3300046689 Ga0495613_0501432 Ga0495613_0501432_128_598 155
80 3300047673 Ga0495593_0702190 Ga0495593_0702190_18_488 155
81 3300049586 Ga0501070_0110273 Ga0501070_0110273_727_1272 155
82 3300009147 Ga0114129_10595970 Ga0114129_105959702 156
83 3300042993 Ga0439440_0016115 Ga0439440_0016115_915_1451 156
84 3300044694 Ga0466963_0384072 Ga0466963_0384072_390_911 156
85 3300048912 Ga0496109_0927109 Ga0496109_0927109_136_738 156
86 3300048916 Ga0496113_0183069 Ga0496113_0183069_249_833 156
87 3300005548 Ga0070665_100030238 Ga0070665_1000302382 157
88 3300025944 Ga0207661_10056173 Ga0207661_100561732 157
89 3300028379 Ga0268266_10019890 Ga0268266_100198905 157
90 3300032005 Ga0307411_10396845 Ga0307411_103968451 157
91 3300045976 Ga0466967_0019964 Ga0466967_0019964_817_1359 157
92 3300048911 Ga0496108_0092330 Ga0496108_0092330_454_1008 157
93 3300048915 Ga0496112_0129754 Ga0496112_0129754_861_1445 157
94 3300005937 Ga0081455_10012750 Ga0081455_100127508 158
95 3300005937 Ga0081455_10074614 Ga0081455_100746143 158
96 3300037466 Ga0395898_0524526 Ga0395898_0524526_156_680 158
97 iso_pu_bacteria 2643221657 2644322104 158
98 3300031911 Ga0307412_10025099 Ga0307412_100250992 159
99 3300032005 Ga0307411_10655069 Ga0307411_106550691 159
100 3300046462 Ga0495651_0068460 Ga0495651_0068460_2163_2687 159
101 3300046543 Ga0495645_0464315 Ga0495645_0464315_43_612 159
102 3300046675 Ga0495657_0242648 Ga0495657_0242648_259_783 159
103 3300047322 Ga0495680_0217112 Ga0495680_0217112_404_928 159
104 3300049823 Ga0501044_0307034 Ga0501044_0307034_260_844 159
105 3300053077 Ga0495601_0276996 Ga0495601_0276996_123_692 159
106 3300053084 Ga0495595_0161347 Ga0495595_0161347_72_596 159
107 3300005843 Ga0068860_100875642 Ga0068860_1008756422 160
108 3300005981 Ga0081538_10001122 Ga0081538_1000112219 160
109 3300006038 Ga0075365_10627585 Ga0075365_106275851 160
110 3300009553 Ga0105249_10720702 Ga0105249_107207022 160
111 3300025986 Ga0207658_10520173 Ga0207658_105201732 160
112 3300039437 Ga0436365_0251476 Ga0436365_0251476_41_583 160
113 3300042005 Ga0439448_0080023 Ga0439448_0080023_168_659 160
114 3300044901 Ga0466960_0182246 Ga0466960_0182246_102_770 160
115 3300046515 Ga0495620_0225011 Ga0495620_0225011_21_512 160
116 3300049590 Ga0501074_0640748 Ga0501074_0640748_52_609 160
117 3300050492 nmdc:mga0yw44_48376_c1 nmdc:mga0yw44_48376_c1_126_650 160
118 3300013307 Ga0157372_10251503 Ga0157372_102515032 161
119 3300005937 Ga0081455_10039656 Ga0081455_100396563 162
120 3300031548 Ga0307408_100003697 Ga0307408_1000036975 163
121 3300031731 Ga0307405_10057693 Ga0307405_100576932 163
122 3300031824 Ga0307413_10045218 Ga0307413_100452183 163
123 3300031852 Ga0307410_10000663 Ga0307410_100006636 163
124 3300031852 Ga0307410_10492931 Ga0307410_104929312 163
125 3300031901 Ga0307406_10000224 Ga0307406_100002243 163
126 3300031903 Ga0307407_10004352 Ga0307407_100043522 163
127 3300031911 Ga0307412_10084909 Ga0307412_100849092 163
128 3300031995 Ga0307409_100000129 Ga0307409_10000012929 163
129 3300032002 Ga0307416_100000359 Ga0307416_10000035920 163
130 3300032004 Ga0307414_10377065 Ga0307414_103770652 163
131 3300032005 Ga0307411_10063692 Ga0307411_100636922 163
132 3300032126 Ga0307415_100001245 Ga0307415_10000124514 163
133 3300049824 Ga0501045_0232056 Ga0501045_0232056_201_701 163
134 3300005345 Ga0070692_10239873 Ga0070692_102398731 164
135 3300009098 Ga0105245_11117090 Ga0105245_111170902 164
136 3300050492 nmdc:mga0yw44_37743_c1 nmdc:mga0yw44_37743_c1_278_817 164
137 3300005337 Ga0070682_100007506 Ga0070682_1000075064 165
138 3300005347 Ga0070668_100064106 Ga0070668_1000641062 165
139 3300005441 Ga0070700_100899308 Ga0070700_1008993081 165
140 3300005444 Ga0070694_101192762 Ga0070694_1011927621 165
141 3300005455 Ga0070663_100158337 Ga0070663_1001583371 165
142 3300005457 Ga0070662_100007456 Ga0070662_1000074565 165
143 3300005459 Ga0068867_100214439 Ga0068867_1002144392 165
144 3300005547 Ga0070693_100984770 Ga0070693_1009847701 165
145 3300005549 Ga0070704_100543216 Ga0070704_1005432162 165
146 3300005563 Ga0068855_101979286 Ga0068855_1019792861 165
147 3300005578 Ga0068854_100043348 Ga0068854_1000433482 165
148 3300005615 Ga0070702_100218423 Ga0070702_1002184232 165
149 3300005616 Ga0068852_100067112 Ga0068852_1000671122 165
150 3300005718 Ga0068866_10040192 Ga0068866_100401922 165
151 3300005844 Ga0068862_100294402 Ga0068862_1002944022 165
152 3300009148 Ga0105243_10051455 Ga0105243_100514552 165
153 3300009148 Ga0105243_10492838 Ga0105243_104928381 165
154 3300009176 Ga0105242_10023969 Ga0105242_100239695 165
155 3300009551 Ga0105238_10757339 Ga0105238_107573392 165
156 3300010375 Ga0105239_10186601 Ga0105239_101866012 165
157 3300013102 Ga0157371_10038724 Ga0157371_100387243 165
158 3300013297 Ga0157378_10552020 Ga0157378_105520201 165
159 3300013307 Ga0157372_10257516 Ga0157372_102575162 165
160 3300013307 Ga0157372_10585674 Ga0157372_105856741 165
161 3300014326 Ga0157380_10291892 Ga0157380_102918923 165
162 3300014969 Ga0157376_11095400 Ga0157376_110954002 165
163 3300017792 Ga0163161_10380416 Ga0163161_103804162 165
164 3300025899 Ga0207642_10011993 Ga0207642_100119932 165
165 3300025901 Ga0207688_10042479 Ga0207688_100424792 165
166 3300025924 Ga0207694_10620239 Ga0207694_106202392 165
167 3300025927 Ga0207687_10029485 Ga0207687_100294854 165
168 3300025933 Ga0207706_10006460 Ga0207706_100064605 165
169 3300025934 Ga0207686_10314558 Ga0207686_103145582 165
170 3300025935 Ga0207709_10211824 Ga0207709_102118242 165
171 3300025949 Ga0207667_10557602 Ga0207667_105576022 165
172 3300025981 Ga0207640_10034839 Ga0207640_100348392 165
173 3300026067 Ga0207678_10227403 Ga0207678_102274031 165
174 3300026089 Ga0207648_10048534 Ga0207648_100485344 165
175 3300026118 Ga0207675_100008587 Ga0207675_1000085873 165
176 3300028380 Ga0268265_10723060 Ga0268265_107230602 165
177 3300037471 Ga0395905_0665340 Ga0395905_0665340_239_817 165
178 3300044693 Ga0466961_0135127 Ga0466961_0135127_776_1360 165
179 3300044693 Ga0466961_0340977 Ga0466961_0340977_82_651 165
180 3300044735 Ga0466968_0162668 Ga0466968_0162668_210_794 165
181 3300044765 Ga0466970_0002325 Ga0466970_0002325_4312_4896 165
182 3300044842 Ga0466957_0014224 Ga0466957_0014224_2975_3559 165
183 3300045976 Ga0466967_1021491 Ga0466967_1021491_38_622 165
184 3300048903 Ga0496100_0022343 Ga0496100_0022343_2672_3205 165
185 3300048903 Ga0496100_0619397 Ga0496100_0619397_112_645 165
186 3300048904 Ga0496101_0035400 Ga0496101_0035400_2505_3038 165
187 3300048904 Ga0496101_0146183 Ga0496101_0146183_1057_1590 165
188 3300048905 Ga0496102_0019720 Ga0496102_0019720_2131_2664 165
189 3300048906 Ga0496103_0271757 Ga0496103_0271757_510_1043 165
190 3300048907 Ga0496104_0007844 Ga0496104_0007844_5810_6343 165
191 3300048908 Ga0496105_0020857 Ga0496105_0020857_4625_5158 165
192 3300048909 Ga0496106_0595741 Ga0496106_0595741_150_683 165
193 3300048910 Ga0496107_0027174 Ga0496107_0027174_2143_2676 165
194 3300048911 Ga0496108_0319918 Ga0496108_0319918_339_872 165
195 3300048911 Ga0496108_0328774 Ga0496108_0328774_580_1113 165
196 3300048912 Ga0496109_0796043 Ga0496109_0796043_207_740 165
197 3300048917 Ga0496114_0011613 Ga0496114_0011613_3175_3708 165
198 3300048917 Ga0496114_0055122 Ga0496114_0055122_1189_1722 165
199 3300048918 Ga0496115_0004989 Ga0496115_0004989_4227_4760 165
200 3300048918 Ga0496115_0043621 Ga0496115_0043621_2303_2836 165
201 3300053085 Ga0495619_0632131 Ga0495619_0632131_69_602 165
202 3300005327 Ga0070658_10082113 Ga0070658_100821132 166
203 3300005336 Ga0070680_100076152 Ga0070680_1000761522 166
204 3300005337 Ga0070682_100071488 Ga0070682_1000714881 166
205 3300005458 Ga0070681_10072610 Ga0070681_100726102 166
206 3300005530 Ga0070679_100012937 Ga0070679_1000129375 166
207 3300005563 Ga0068855_100436885 Ga0068855_1004368852 166
208 3300005981 Ga0081538_10123301 Ga0081538_101233012 166
209 3300006038 Ga0075365_10016342 Ga0075365_100163422 166
210 3300013102 Ga0157371_10319388 Ga0157371_103193882 166
211 3300013307 Ga0157372_11001790 Ga0157372_110017901 166
212 3300025909 Ga0207705_10036835 Ga0207705_100368353 166
213 3300025912 Ga0207707_10190058 Ga0207707_101900582 166
214 3300025917 Ga0207660_10333446 Ga0207660_103334462 166
215 3300025921 Ga0207652_10030146 Ga0207652_100301462 166
216 3300025929 Ga0207664_10027585 Ga0207664_100275853 166
217 3300025949 Ga0207667_10356748 Ga0207667_103567482 166
218 3300031548 Ga0307408_100304926 Ga0307408_1003049262 166
219 3300031731 Ga0307405_10766433 Ga0307405_107664331 166
220 3300031852 Ga0307410_10128330 Ga0307410_101283302 166
221 3300031852 Ga0307410_10783151 Ga0307410_107831511 166
222 3300031995 Ga0307409_100138708 Ga0307409_1001387082 166
223 3300032002 Ga0307416_100665207 Ga0307416_1006652072 166
224 3300032004 Ga0307414_10035195 Ga0307414_100351953 166
225 3300032005 Ga0307411_10020714 Ga0307411_100207142 166
226 3300032126 Ga0307415_100014784 Ga0307415_1000147843 166
227 3300032126 Ga0307415_100090012 Ga0307415_1000900121 166
228 3300045976 Ga0466967_0382938 Ga0466967_0382938_191_748 166
229 3300046511 Ga0495608_0368325 Ga0495608_0368325_164_703 166
230 3300046809 Ga0495600_0066467 Ga0495600_0066467_133_672 166
231 3300048903 Ga0496100_0101494 Ga0496100_0101494_1308_1904 166
232 3300048907 Ga0496104_0579649 Ga0496104_0579649_356_952 166
233 3300048911 Ga0496108_1276852 Ga0496108_1276852_30_569 166
234 3300048914 Ga0496111_0731838 Ga0496111_0731838_168_707 166
235 3300048916 Ga0496113_0010415 Ga0496113_0010415_1723_2262 166
236 3300048916 Ga0496113_0154388 Ga0496113_0154388_1187_1726 166
237 3300049568 Ga0501031_0013758 Ga0501031_0013758_1432_1941 166
238 3300049568 Ga0501031_0014464 Ga0501031_0014464_2913_3440 166
239 3300049569 Ga0501032_0071553 Ga0501032_0071553_429_938 166
240 3300049570 Ga0501033_0030820 Ga0501033_0030820_2519_3046 166
241 3300049570 Ga0501033_0145734 Ga0501033_0145734_999_1508 166
242 3300049571 Ga0501034_0026056 Ga0501034_0026056_1246_1755 166
243 3300049572 Ga0501036_0003611 Ga0501036_0003611_9891_10418 166
244 3300049572 Ga0501036_0007232 Ga0501036_0007232_5579_6088 166
245 3300049573 Ga0501037_0002261 Ga0501037_0002261_3572_4081 166
246 3300049574 Ga0501038_0021356 Ga0501038_0021356_577_1104 166
247 3300049574 Ga0501038_0023173 Ga0501038_0023173_1426_1935 166
248 3300049574 Ga0501038_0180089 Ga0501038_0180089_496_1089 166
249 3300049575 Ga0501039_0008612 Ga0501039_0008612_778_1305 166
250 3300049575 Ga0501039_0036336 Ga0501039_0036336_3065_3574 166
251 3300049576 Ga0501040_0004213 Ga0501040_0004213_3577_4104 166
252 3300049576 Ga0501040_0186858 Ga0501040_0186858_111_704 166
253 3300049577 Ga0501041_0003615 Ga0501041_0003615_3550_4077 166
254 3300049578 Ga0501042_0067467 Ga0501042_0067467_334_843 166
255 3300049579 Ga0501043_0006882 Ga0501043_0006882_4054_4563 166
256 3300049579 Ga0501043_0015526 Ga0501043_0015526_1523_2050 166
257 3300049580 Ga0501046_0012682 Ga0501046_0012682_1932_2459 166
258 3300049580 Ga0501046_0040387 Ga0501046_0040387_464_973 166
259 3300049581 Ga0501047_0188880 Ga0501047_0188880_675_1184 166
260 3300049582 Ga0501048_0005697 Ga0501048_0005697_5579_6088 166
261 3300049584 Ga0501068_0019942 Ga0501068_0019942_1282_1809 166
262 3300049585 Ga0501069_0164193 Ga0501069_0164193_489_1016 166
263 3300049585 Ga0501069_0292616 Ga0501069_0292616_212_721 166
264 3300049586 Ga0501070_0191067 Ga0501070_0191067_774_1283 166
265 3300049587 Ga0501071_0025850 Ga0501071_0025850_777_1304 166
266 3300049588 Ga0501072_0022214 Ga0501072_0022214_650_1177 166
267 3300049590 Ga0501074_0040715 Ga0501074_0040715_1625_2152 166
268 3300049591 Ga0501075_0035642 Ga0501075_0035642_1371_1898 166
269 3300049592 Ga0501076_0085822 Ga0501076_0085822_1199_1795 166
270 3300049593 Ga0501077_0011204 Ga0501077_0011204_1967_2494 166
271 3300049741 Ga0501079_0012719 Ga0501079_0012719_1836_2363 166
272 3300049742 Ga0501080_0023405 Ga0501080_0023405_4736_5245 166
273 3300049743 Ga0501081_0043273 Ga0501081_0043273_1785_2312 166
274 3300049744 Ga0501083_0043393 Ga0501083_0043393_687_1214 166
275 3300049822 Ga0501035_0051210 Ga0501035_0051210_2696_3205 166
276 3300049823 Ga0501044_0290144 Ga0501044_0290144_904_1413 166
277 3300049824 Ga0501045_0010906 Ga0501045_0010906_1942_2469 166
278 3300050492 nmdc:mga0yw44_22909_c1 nmdc:mga0yw44_22909_c1_2742_3263 166
279 3300053084 Ga0495595_0078876 Ga0495595_0078876_278_817 166
280 3300054114 Ga0501084_0020970 Ga0501084_0020970_2251_2778 166
281 3300054114 Ga0501084_0063790 Ga0501084_0063790_1127_1636 166
282 3300060353 Ga0501082_0035626 Ga0501082_0035626_840_1367 166
283 3300060353 Ga0501082_1030576 Ga0501082_1030576_95_688 166
284 3300061734 Ga0530510_0065272 Ga0530510_0065272_778_1305 166
285 iso_pu_bacteria 2883821847 2883822158 166
286 3300005338 Ga0068868_100435844 Ga0068868_1004358442 167
287 3300005347 Ga0070668_100020104 Ga0070668_1000201043 167
288 3300005366 Ga0070659_100053664 Ga0070659_1000536642 167
289 3300005539 Ga0068853_101065335 Ga0068853_1010653352 167
290 3300005616 Ga0068852_100133184 Ga0068852_1001331843 167
291 3300005719 Ga0068861_100196885 Ga0068861_1001968852 167
292 3300005719 Ga0068861_100485395 Ga0068861_1004853951 167
293 3300005937 Ga0081455_10548664 Ga0081455_105486642 167
294 3300006058 Ga0075432_10002266 Ga0075432_100022666 167
295 3300006844 Ga0075428_100014025 Ga0075428_1000140252 167
296 3300006844 Ga0075428_101288312 Ga0075428_1012883122 167
297 3300006847 Ga0075431_100710670 Ga0075431_1007106702 167
298 3300006852 Ga0075433_10010549 Ga0075433_100105495 167
299 3300006871 Ga0075434_100004227 Ga0075434_1000042274 167
300 3300006881 Ga0068865_100287623 Ga0068865_1002876232 167
301 3300006914 Ga0075436_100165065 Ga0075436_1001650652 167
302 3300007076 Ga0075435_100020712 Ga0075435_1000207122 167
303 3300009098 Ga0105245_10047452 Ga0105245_100474524 167
304 3300009147 Ga0114129_10005929 Ga0114129_100059294 167
305 3300009148 Ga0105243_10038740 Ga0105243_100387402 167
306 3300009148 Ga0105243_10057005 Ga0105243_100570052 167
307 3300009551 Ga0105238_10078331 Ga0105238_100783312 167
308 3300009553 Ga0105249_10042287 Ga0105249_100422872 167
309 3300010375 Ga0105239_10023970 Ga0105239_100239701 167
310 3300012490 Ga0157322_1008725 Ga0157322_10087252 167
311 3300013307 Ga0157372_10035876 Ga0157372_100358763 167
312 3300014326 Ga0157380_11159117 Ga0157380_111591172 167
313 3300017792 Ga0163161_10262634 Ga0163161_102626342 167
314 3300025924 Ga0207694_10249025 Ga0207694_102490252 167
315 3300025927 Ga0207687_10877334 Ga0207687_108773341 167
316 3300025935 Ga0207709_10044866 Ga0207709_100448661 167
317 3300025935 Ga0207709_10045632 Ga0207709_100456322 167
318 3300026023 Ga0207677_10637622 Ga0207677_106376222 167
319 3300026118 Ga0207675_100101448 Ga0207675_1001014484 167
320 3300026118 Ga0207675_100520964 Ga0207675_1005209642 167
321 3300026142 Ga0207698_10093955 Ga0207698_100939552 167
322 3300027907 Ga0207428_10000752 Ga0207428_1000075220 167
323 3300038443 Ga0395901_0632415 Ga0395901_0632415_98_625 167
324 3300042016 Ga0439463_005203 Ga0439463_005203_941_1468 167
325 3300042437 Ga0439444_0011056 Ga0439444_0011056_44_577 167
326 3300042461 Ga0439460_0026855 Ga0439460_0026855_817_1344 167
327 3300042461 Ga0439460_0038136 Ga0439460_0038136_787_1320 167
328 3300042532 Ga0450893_0088616 Ga0450893_0088616_34_567 167
329 3300042993 Ga0439440_0001382 Ga0439440_0001382_3763_4296 167
330 3300042993 Ga0439440_0001652 Ga0439440_0001652_923_1450 167
331 3300046463 Ga0495653_0026341 Ga0495653_0026341_2590_3249 167
332 3300046513 Ga0495616_0202441 Ga0495616_0202441_214_747 167
333 3300046616 Ga0495668_0286285 Ga0495668_0286285_265_798 167
334 3300046665 Ga0495661_0372192 Ga0495661_0372192_117_650 167
335 3300046691 Ga0495670_0555561 Ga0495670_0555561_36_569 167
336 3300047445 Ga0495677_0250729 Ga0495677_0250729_26_559 167
337 3300049568 Ga0501031_0000577 Ga0501031_0000577_11255_11800 167
338 3300049569 Ga0501032_0000432 Ga0501032_0000432_10172_10717 167
339 3300049570 Ga0501033_0001452 Ga0501033_0001452_18593_19138 167
340 3300049571 Ga0501034_0007308 Ga0501034_0007308_136_681 167
341 3300049572 Ga0501036_0000108 Ga0501036_0000108_1818_2363 167
342 3300049572 Ga0501036_0422952 Ga0501036_0422952_122_640 167
343 3300049573 Ga0501037_0001254 Ga0501037_0001254_10933_11478 167
344 3300049574 Ga0501038_0000130 Ga0501038_0000130_52463_53008 167
345 3300049575 Ga0501039_0001896 Ga0501039_0001896_11819_12364 167
346 3300049576 Ga0501040_0046839 Ga0501040_0046839_1132_1677 167
347 3300049578 Ga0501042_0102282 Ga0501042_0102282_1186_1731 167
348 3300049579 Ga0501043_0000147 Ga0501043_0000147_1352_1897 167
349 3300049580 Ga0501046_0000067 Ga0501046_0000067_38847_39392 167
350 3300049581 Ga0501047_0003345 Ga0501047_0003345_10933_11478 167
351 3300049582 Ga0501048_0000007 Ga0501048_0000007_29732_30277 167
352 3300049582 Ga0501048_0568896 Ga0501048_0568896_97_660 167
353 3300049583 Ga0501067_0003198 Ga0501067_0003198_2719_3264 167
354 3300049584 Ga0501068_0048280 Ga0501068_0048280_1014_1559 167
355 3300049585 Ga0501069_0013428 Ga0501069_0013428_935_1480 167
356 3300049586 Ga0501070_0000171 Ga0501070_0000171_11379_11924 167
357 3300049586 Ga0501070_0280913 Ga0501070_0280913_311_874 167
358 3300049587 Ga0501071_0249317 Ga0501071_0249317_302_847 167
359 3300049590 Ga0501074_0000506 Ga0501074_0000506_1573_2118 167
360 3300049742 Ga0501080_0001760 Ga0501080_0001760_10122_10667 167
361 3300049744 Ga0501083_0002246 Ga0501083_0002246_3463_4008 167
362 3300049822 Ga0501035_0009180 Ga0501035_0009180_6564_7109 167
363 3300049823 Ga0501044_0013089 Ga0501044_0013089_7216_7761 167
364 3300050507 nmdc:mga05p37_98688_c1 nmdc:mga05p37_98688_c1_1003_1554 167
365 3300050508 nmdc:mga09592_63443_c1 nmdc:mga09592_63443_c1_1378_1929 167
366 3300050509 nmdc:mga0qj67_249487_c1 nmdc:mga0qj67_249487_c1_831_1382 167
367 3300050511 nmdc:mga08y16_199676_c1 nmdc:mga08y16_199676_c1_1013_1564 167
368 3300050512 nmdc:mga0n895_102349_c1 nmdc:mga0n895_102349_c1_415_966 167
369 3300050513 nmdc:mga0rr50_95590_c1 nmdc:mga0rr50_95590_c1_1012_1563 167
370 3300050514 nmdc:mga08x19_67908_c1 nmdc:mga08x19_67908_c1_718_1269 167
371 3300050515 nmdc:mga0a205_88277_c1 nmdc:mga0a205_88277_c1_1904_2455 167
372 3300054114 Ga0501084_0001403 Ga0501084_0001403_10314_10859 167
373 3300005441 Ga0070700_101407190 Ga0070700_1014071901 168
374 3300005616 Ga0068852_101303306 Ga0068852_1013033061 168
375 3300005844 Ga0068862_100791796 Ga0068862_1007917962 168
376 3300006048 Ga0075363_100000345 Ga0075363_1000003453 168
377 3300006353 Ga0075370_10026260 Ga0075370_100262602 168
378 3300026121 Ga0207683_11298442 Ga0207683_112984421 168
379 3300026142 Ga0207698_10936799 Ga0207698_109367991 168
380 3300031903 Ga0307407_10120743 Ga0307407_101207432 168
381 3300049583 Ga0501067_0107170 Ga0501067_0107170_629_1147 168
382 3300049583 Ga0501067_0242696 Ga0501067_0242696_281_799 168
383 3300049585 Ga0501069_0183438 Ga0501069_0183438_62_583 168
384 3300049585 Ga0501069_0244219 Ga0501069_0244219_165_683 168
385 3300049590 Ga0501074_0085786 Ga0501074_0085786_271_792 168
386 3300050490 nmdc:mga03n38_26870_c1 nmdc:mga03n38_26870_c1_337_858 168
387 3300050491 nmdc:mga00v17_38058_c1 nmdc:mga00v17_38058_c1_1677_2198 168
388 3300050496 nmdc:mga07m45_47117_c1 nmdc:mga07m45_47117_c1_944_1465 168
389 3300061734 Ga0530510_0200408 Ga0530510_0200408_410_1066 168
390 3300006038 Ga0075365_10064304 Ga0075365_100643042 169
391 3300006042 Ga0075368_10001586 Ga0075368_100015863 169
392 3300006048 Ga0075363_100005271 Ga0075363_1000052713 169
393 3300006048 Ga0075363_100111770 Ga0075363_1001117702 169
394 3300006048 Ga0075363_100202029 Ga0075363_1002020292 169
395 3300006178 Ga0075367_10012972 Ga0075367_100129724 169
396 3300006353 Ga0075370_10153352 Ga0075370_101533522 169
397 3300013308 Ga0157375_10419804 Ga0157375_104198042 169
398 3300027866 Ga0209813_10000696 Ga0209813_100006963 169
399 3300031731 Ga0307405_10024951 Ga0307405_100249512 169
400 3300031901 Ga0307406_10549294 Ga0307406_105492942 169
401 3300031903 Ga0307407_10046151 Ga0307407_100461512 169
402 3300031995 Ga0307409_100314247 Ga0307409_1003142471 169
403 3300032005 Ga0307411_10146817 Ga0307411_101468172 169
404 3300032126 Ga0307415_100001778 Ga0307415_1000017784 169
405 3300037418 Ga0395900_0381602 Ga0395900_0381602_551_1072 169
406 3300046500 Ga0495596_0096887 Ga0495596_0096887_359_910 169
407 3300048904 Ga0496101_0882358 Ga0496101_0882358_68_589 169
408 3300048917 Ga0496114_0351741 Ga0496114_0351741_555_1076 169
409 3300049579 Ga0501043_0324872 Ga0501043_0324872_268_795 169
410 3300049580 Ga0501046_0015083 Ga0501046_0015083_2737_3264 169
411 3300049823 Ga0501044_0857125 Ga0501044_0857125_165_692 169
412 3300050490 nmdc:mga03n38_47666_c1 nmdc:mga03n38_47666_c1_632_1156 169
413 3300050492 nmdc:mga0yw44_30434_c1 nmdc:mga0yw44_30434_c1_1623_2144 169
414 3300050495 nmdc:mga04h51_19179_c1 nmdc:mga04h51_19179_c1_1356_1880 169
415 3300050496 nmdc:mga07m45_320399_c1 nmdc:mga07m45_320399_c1_358_882 169
416 3300005367 Ga0070667_100087977 Ga0070667_1000879772 170
417 3300006038 Ga0075365_10061813 Ga0075365_100618132 170
418 3300006038 Ga0075365_10151026 Ga0075365_101510262 170
419 3300006038 Ga0075365_10283149 Ga0075365_102831492 170
420 3300006048 Ga0075363_100028665 Ga0075363_1000286652 170
421 3300006048 Ga0075363_100110077 Ga0075363_1001100772 170
422 3300006051 Ga0075364_10055277 Ga0075364_100552772 170
423 3300006051 Ga0075364_10070518 Ga0075364_100705181 170
424 3300006051 Ga0075364_10749874 Ga0075364_107498742 170
425 3300006178 Ga0075367_10057610 Ga0075367_100576102 170
426 3300006353 Ga0075370_10007923 Ga0075370_100079234 170
427 3300025986 Ga0207658_10022763 Ga0207658_100227632 170
428 3300031548 Ga0307408_100820160 Ga0307408_1008201601 170
429 3300050490 nmdc:mga03n38_39398_c1 nmdc:mga03n38_39398_c1_601_1131 170
430 3300050490 nmdc:mga03n38_49207_c1 nmdc:mga03n38_49207_c1_390_920 170
431 3300050491 nmdc:mga00v17_17529_c1 nmdc:mga00v17_17529_c1_1612_2139 170
432 3300050491 nmdc:mga00v17_80096_c1 nmdc:mga00v17_80096_c1_1393_1923 170
433 3300050492 nmdc:mga0yw44_359232_c1 nmdc:mga0yw44_359232_c1_245_775 170
434 3300050492 nmdc:mga0yw44_367359_c1 nmdc:mga0yw44_367359_c1_232_762 170
435 3300050494 nmdc:mga06z11_55283_c1 nmdc:mga06z11_55283_c1_934_1461 170
436 3300050496 nmdc:mga07m45_390685_c1 nmdc:mga07m45_390685_c1_174_704 170
437 iso_pu_bacteria 2855386786 2855388493 170
438 3300005356 Ga0070674_100419240 Ga0070674_1004192402 171
439 3300005365 Ga0070688_101243859 Ga0070688_1012438591 171
440 3300005367 Ga0070667_100461244 Ga0070667_1004612442 171
441 3300005456 Ga0070678_100343155 Ga0070678_1003431551 171
442 3300005543 Ga0070672_100159650 Ga0070672_1001596502 171
443 3300005548 Ga0070665_100117286 Ga0070665_1001172862 171
444 3300005616 Ga0068852_100277723 Ga0068852_1002777232 171
445 3300005618 Ga0068864_101033587 Ga0068864_1010335872 171
446 3300005718 Ga0068866_10268303 Ga0068866_102683032 171
447 3300006353 Ga0075370_10257159 Ga0075370_102571591 171
448 3300009148 Ga0105243_10334532 Ga0105243_103345322 171
449 3300009176 Ga0105242_10440641 Ga0105242_104406412 171
450 3300011119 Ga0105246_10791727 Ga0105246_107917271 171
451 3300013306 Ga0163162_10752636 Ga0163162_107526362 171
452 3300013308 Ga0157375_10082072 Ga0157375_100820722 171
453 3300014745 Ga0157377_10144192 Ga0157377_101441922 171
454 3300017792 Ga0163161_10070947 Ga0163161_100709472 171
455 3300025901 Ga0207688_10075733 Ga0207688_100757332 171
456 3300025918 Ga0207662_10123208 Ga0207662_101232082 171
457 3300025940 Ga0207691_10237328 Ga0207691_102373282 171
458 3300026121 Ga0207683_10177755 Ga0207683_101777551 171
459 3300028379 Ga0268266_10514816 Ga0268266_105148162 171
460 3300048913 Ga0496110_0290978 Ga0496110_0290978_156_692 171
461 3300049570 Ga0501033_0051478 Ga0501033_0051478_504_1085 171
462 3300049581 Ga0501047_0464717 Ga0501047_0464717_16_597 171
463 3300049583 Ga0501067_0117375 Ga0501067_0117375_287_862 171
464 3300050496 nmdc:mga07m45_84712_c1 nmdc:mga07m45_84712_c1_719_1249 171
465 iso_pu_bacteria 2857481737 2857483727 171
466 3300005329 Ga0070683_100072973 Ga0070683_1000729732 172
467 3300005331 Ga0070670_100456163 Ga0070670_1004561631 172
468 3300005356 Ga0070674_100938516 Ga0070674_1009385161 172
469 3300005843 Ga0068860_100000169 Ga0068860_10000016977 172
470 3300006038 Ga0075365_10232178 Ga0075365_102321782 172
471 3300006038 Ga0075365_10735762 Ga0075365_107357621 172
472 3300006051 Ga0075364_10079144 Ga0075364_100791442 172
473 3300006051 Ga0075364_10140259 Ga0075364_101402592 172
474 3300025944 Ga0207661_10032139 Ga0207661_100321391 172
475 3300028381 Ga0268264_10000808 Ga0268264_1000080815 172
476 3300049585 Ga0501069_0028927 Ga0501069_0028927_304_837 172
477 3300049741 Ga0501079_0184389 Ga0501079_0184389_40_573 172
478 3300049742 Ga0501080_0059601 Ga0501080_0059601_853_1386 172
479 3300050491 nmdc:mga00v17_49351_c1 nmdc:mga00v17_49351_c1_309_848 172
480 3300050491 nmdc:mga00v17_51722_c1 nmdc:mga00v17_51722_c1_113_652 172
481 3300050492 nmdc:mga0yw44_202946_c1 nmdc:mga0yw44_202946_c1_481_1020 172
482 3300053140 Ga0500573_0009020 Ga0500573_0009020_3483_4037 172
483 3300049587 Ga0501071_0493140 Ga0501071_0493140_295_852 173
484 3300049824 Ga0501045_0388349 Ga0501045_0388349_23_580 173
485 3300054114 Ga0501084_0279503 Ga0501084_0279503_159_716 173
486 3300061734 Ga0530510_0186293 Ga0530510_0186293_247_804 173
487 3300013105 Ga0157369_10380293 Ga0157369_103802932 174
488 3300045976 Ga0466967_0073352 Ga0466967_0073352_896_1429 174
489 3300005615 Ga0070702_100330155 Ga0070702_1003301551 175
490 3300011119 Ga0105246_10259121 Ga0105246_102591211 175
491 3300025901 Ga0207688_10529962 Ga0207688_105299621 175
492 3300025912 Ga0207707_10260544 Ga0207707_102605442 175
493 3300048912 Ga0496109_0120944 Ga0496109_0120944_1594_2133 175
494 3300048913 Ga0496110_0020063 Ga0496110_0020063_2402_2929 175
495 iso_pu_bacteria 2643221696 2644534494 175
496 3300005329 Ga0070683_100108192 Ga0070683_1001081923 176
497 3300005339 Ga0070660_100201644 Ga0070660_1002016442 176
498 3300005344 Ga0070661_100808921 Ga0070661_1008089211 176
499 3300005354 Ga0070675_100218338 Ga0070675_1002183382 176
500 3300005530 Ga0070679_100398125 Ga0070679_1003981252 176
501 3300005535 Ga0070684_100306076 Ga0070684_1003060762 176
502 3300005577 Ga0068857_100015038 Ga0068857_1000150386 176
503 3300005577 Ga0068857_100751769 Ga0068857_1007517691 176
504 3300009551 Ga0105238_10834770 Ga0105238_108347702 176
505 3300013296 Ga0157374_11537217 Ga0157374_115372172 176
506 3300014325 Ga0163163_10048030 Ga0163163_100480303 176
507 3300014745 Ga0157377_10026002 Ga0157377_100260022 176
508 3300025920 Ga0207649_10819848 Ga0207649_108198482 176
509 3300025921 Ga0207652_10351981 Ga0207652_103519812 176
510 3300025926 Ga0207659_10329689 Ga0207659_103296892 176
511 3300025944 Ga0207661_10083113 Ga0207661_100831132 176
512 3300026116 Ga0207674_10010236 Ga0207674_100102362 176
513 3300045976 Ga0466967_0127732 Ga0466967_0127732_282_815 176
514 3300045976 Ga0466967_0334583 Ga0466967_0334583_458_1006 176
515 3300048903 Ga0496100_0622415 Ga0496100_0622415_219_749 176
516 3300049571 Ga0501034_0005805 Ga0501034_0005805_12344_12883 176
517 3300049572 Ga0501036_0030081 Ga0501036_0030081_2143_2682 176
518 3300049573 Ga0501037_0295735 Ga0501037_0295735_135_674 176
519 3300049580 Ga0501046_0424858 Ga0501046_0424858_156_707 176
520 3300049581 Ga0501047_0048868 Ga0501047_0048868_1963_2502 176
521 3300049581 Ga0501047_0291326 Ga0501047_0291326_204_755 176
522 3300049583 Ga0501067_0001510 Ga0501067_0001510_9712_10263 176
523 3300049583 Ga0501067_0013543 Ga0501067_0013543_2432_2971 176
524 3300049584 Ga0501068_0003848 Ga0501068_0003848_1044_1595 176
525 3300049584 Ga0501068_0016683 Ga0501068_0016683_1627_2166 176
526 3300049586 Ga0501070_0001780 Ga0501070_0001780_11739_12278 176
527 3300049587 Ga0501071_0016265 Ga0501071_0016265_2534_3073 176
528 3300049587 Ga0501071_0110951 Ga0501071_0110951_1131_1682 176
529 3300049588 Ga0501072_0010378 Ga0501072_0010378_4714_5253 176
530 3300049588 Ga0501072_0052360 Ga0501072_0052360_2560_3111 176
531 3300049589 Ga0501073_0002199 Ga0501073_0002199_2405_2956 176
532 3300049589 Ga0501073_0003368 Ga0501073_0003368_8557_9096 176
533 3300049590 Ga0501074_0002964 Ga0501074_0002964_4461_5000 176
534 3300049590 Ga0501074_0013200 Ga0501074_0013200_1143_1694 176
535 3300049593 Ga0501077_0016695 Ga0501077_0016695_1752_2303 176
536 3300049741 Ga0501079_0021752 Ga0501079_0021752_4303_4854 176
537 3300049741 Ga0501079_0047850 Ga0501079_0047850_755_1294 176
538 3300049742 Ga0501080_0024281 Ga0501080_0024281_4324_4863 176
539 3300049742 Ga0501080_0065119 Ga0501080_0065119_1060_1611 176
540 3300049744 Ga0501083_0010565 Ga0501083_0010565_2867_3418 176
541 3300049744 Ga0501083_0071511 Ga0501083_0071511_342_881 176
542 3300054114 Ga0501084_0028061 Ga0501084_0028061_2570_3121 176
543 3300054114 Ga0501084_0079069 Ga0501084_0079069_90_629 176
544 3300060353 Ga0501082_0008218 Ga0501082_0008218_4093_4644 176
545 3300060353 Ga0501082_0038695 Ga0501082_0038695_1608_2147 176
546 3300002070 JGI24750J21931_1024464 JGI24750J21931_10244642 177
547 3300005327 Ga0070658_10074664 Ga0070658_100746642 177
548 3300005329 Ga0070683_100047670 Ga0070683_1000476703 177
549 3300005331 Ga0070670_100528283 Ga0070670_1005282831 177
550 3300005337 Ga0070682_100007958 Ga0070682_1000079584 177
551 3300005338 Ga0068868_100358725 Ga0068868_1003587252 177
552 3300005343 Ga0070687_100107415 Ga0070687_1001074152 177
553 3300005344 Ga0070661_100137564 Ga0070661_1001375642 177
554 3300005366 Ga0070659_100129682 Ga0070659_1001296823 177
555 3300005535 Ga0070684_100006247 Ga0070684_1000062472 177
556 3300005539 Ga0068853_100220972 Ga0068853_1002209722 177
557 3300005547 Ga0070693_100120212 Ga0070693_1001202122 177
558 3300005616 Ga0068852_100073152 Ga0068852_1000731523 177
559 3300005618 Ga0068864_100007822 Ga0068864_1000078227 177
560 3300005834 Ga0068851_10232860 Ga0068851_102328602 177
561 3300005841 Ga0068863_100865560 Ga0068863_1008655602 177
562 3300005842 Ga0068858_101352622 Ga0068858_1013526221 177
563 3300005843 Ga0068860_100135251 Ga0068860_1001352513 177
564 3300006237 Ga0097621_100583027 Ga0097621_1005830273 177
565 3300006881 Ga0068865_100108008 Ga0068865_1001080082 177
566 3300009098 Ga0105245_10029848 Ga0105245_100298483 177
567 3300009177 Ga0105248_10100498 Ga0105248_101004983 177
568 3300009545 Ga0105237_10489548 Ga0105237_104895482 177
569 3300009553 Ga0105249_10411955 Ga0105249_104119552 177
570 3300010375 Ga0105239_10040949 Ga0105239_100409495 177
571 3300013306 Ga0163162_10036679 Ga0163162_100366792 177
572 3300013307 Ga0157372_10036668 Ga0157372_100366684 177
573 3300013308 Ga0157375_10142598 Ga0157375_101425982 177
574 3300014968 Ga0157379_10107519 Ga0157379_101075193 177
575 3300025901 Ga0207688_10342596 Ga0207688_103425961 177
576 3300025904 Ga0207647_10053537 Ga0207647_100535372 177
577 3300025918 Ga0207662_10116696 Ga0207662_101166961 177
578 3300025919 Ga0207657_10202790 Ga0207657_102027901 177
579 3300025920 Ga0207649_10603269 Ga0207649_106032692 177
580 3300025927 Ga0207687_10027949 Ga0207687_100279492 177
581 3300025932 Ga0207690_10033049 Ga0207690_100330494 177
582 3300025938 Ga0207704_10102678 Ga0207704_101026782 177
583 3300025941 Ga0207711_10156993 Ga0207711_101569933 177
584 3300025944 Ga0207661_10011093 Ga0207661_100110935 177
585 3300025961 Ga0207712_10409437 Ga0207712_104094372 177
586 3300026023 Ga0207677_10328135 Ga0207677_103281352 177
587 3300026035 Ga0207703_10369188 Ga0207703_103691881 177
588 3300026041 Ga0207639_10096120 Ga0207639_100961202 177
589 3300026088 Ga0207641_10662352 Ga0207641_106623522 177
590 3300026095 Ga0207676_10013119 Ga0207676_100131195 177
591 3300028381 Ga0268264_10360629 Ga0268264_103606292 177
592 3300048905 Ga0496102_0073035 Ga0496102_0073035_164_697 177
593 3300048911 Ga0496108_0091957 Ga0496108_0091957_1785_2318 177
594 3300048912 Ga0496109_0078844 Ga0496109_0078844_171_704 177
595 3300048914 Ga0496111_0026551 Ga0496111_0026551_3330_3863 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05258

DciA

Dna[CI] antecedent, DciA

77

172

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.8033 79 155
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.7618 79 155
8a3v-assembly1.cif.gz_C crystal structure of the vibrio cholerae replicative helicase (vcdnab) in complex with its loader protein (vcdcia) 0.7238 65 153
7mrv-assembly1.cif.gz_A f100a mutant structure of mif2 (d-dt) 0.7216 112 153
4tps-assembly1.cif.gz_B sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa 0.7196 84 154
ID Description Score Start End Superfamily
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8375 64 150 3.30.300.180
af_P9WNW3_9_100_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8242 98 152 3.30.300.180
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8211 64 150 3.30.300.180
af_Q2G2H5_2_79_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8057 103 152 3.30.300.180
4tpsB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7196 84 154 3.30.300.180
ID Description Score Start End GO Terms
AF-A0A1W1HV20-F1-model_v4 DUF721 domain-containing protein 0.9603 85 153
AF-A0A0K2RKS3-F1-model_v4 UPF0232 protein SCO3875 0.9301 84 156
AF-A0A7V9IBD7-F1-model_v4 DUF721 domain-containing protein 0.9125 82 153
AF-A0A7V2TVS4-F1-model_v4 DUF721 domain-containing protein 0.9111 81 153
AF-A0A1F2X971-F1-model_v4 RNA-binding protein 0.9107 83 153

Feature Viewer

pLDDT pTM Quality
73.07 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map