F467530

General Info

Members Datasets Scaffolds Average Seq Length
596 186 595 146

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100413864|Ga0068861_1004138642
Length 159
Sequence MKPKNQRLVLVGAALVAVLAAVLLAMWGLRDRASYFYTPAEVVAGKAEALKAIRLGGMVERGSIHRGADGVTTSFVVTDGQARVMVDYRGITPDLFREGSGVVAEGHVQPLATAIDANSRTVGPIFVADTILAKHDERYMPPELGNLAAEHKAGKTLQR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
136 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
137 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
138 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
139 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
182 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
183 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
184 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
185 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 3.02
Rhizosphere 96.48
Stem 0
Stem Tuber 0.17
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9705856 2162886012 Bacteria 849
2 JGI24739J22299_10000218 3300001989 Bacteria 19232
3 JGI24737J22298_10001076 3300001990 Bacteria 9605
4 JGI24748J21848_1018694 3300002074 Bacteria 832
5 JGI24738J21930_10000923 3300002075 Bacteria 8451
6 JGI24034J26672_10010046 3300002239 Bacteria 1403
7 JGI24034J26672_10060621 3300002239 Bacteria 664
8 Ga0065712_10047667 3300005290 Bacteria 861
9 Ga0065715_10107215 3300005293 Bacteria 2783
10 Ga0065715_10195841 3300005293 Bacteria 1388
11 Ga0070658_10076626 3300005327 Bacteria 2743
12 Ga0070658_10087145 3300005327 Bacteria 2569
13 Ga0070658_10092445 3300005327 Bacteria 2494
14 Ga0070658_11057996 3300005327 Bacteria 706
15 Ga0070683_100242098 3300005329 Bacteria 1716
16 Ga0070690_100009606 3300005330 Bacteria 5609
17 Ga0070670_100000600 3300005331 Bacteria 28387
18 Ga0070670_100082684 3300005331 Bacteria 2759
19 Ga0070670_100084867 3300005331 Bacteria 2721
20 Ga0070670_100161352 3300005331 Bacteria 1943
21 Ga0070670_100223884 3300005331 Bacteria 1637
22 Ga0070670_100261891 3300005331 Bacteria 1507
23 Ga0070670_100641795 3300005331 Bacteria 952
24 Ga0070677_10000735 3300005333 Bacteria 10923
25 Ga0068869_100025580 3300005334 Bacteria 4100
26 Ga0070666_10000731 3300005335 Bacteria 19890
27 Ga0070666_10004646 3300005335 Bacteria 8385
28 Ga0070666_10006870 3300005335 Bacteria 7009
29 Ga0070666_10049326 3300005335 Bacteria 2829
30 Ga0070666_10426083 3300005335 Bacteria 956
31 Ga0068868_100002334 3300005338 Bacteria 13125
32 Ga0068868_100008603 3300005338 Bacteria 7310
33 Ga0070660_100005952 3300005339 Bacteria 8432
34 Ga0070660_100150517 3300005339 Bacteria 1871
35 Ga0070660_100437784 3300005339 Bacteria 1084
36 Ga0070689_100071123 3300005340 Bacteria 2717
37 Ga0070689_100103921 3300005340 Bacteria 2252
38 Ga0070661_100024235 3300005344 Bacteria 4352
39 Ga0070661_100115994 3300005344 Bacteria 2003
40 Ga0070661_100144635 3300005344 Bacteria 1794
41 Ga0070661_100228128 3300005344 Bacteria 1431
42 Ga0070661_100254758 3300005344 Bacteria 1355
43 Ga0070692_10105896 3300005345 Bacteria 1548
44 Ga0070692_10210669 3300005345 Bacteria 1143
45 Ga0070668_100010572 3300005347 Bacteria 6865
46 Ga0070668_100252244 3300005347 Bacteria 1465
47 Ga0070668_100365151 3300005347 Bacteria 1225
48 Ga0070668_100617548 3300005347 Bacteria 950
49 Ga0070668_101697458 3300005347 Bacteria 580
50 Ga0070669_100046775 3300005353 Bacteria 3155
51 Ga0070669_100231701 3300005353 Bacteria 1464
52 Ga0070669_100258269 3300005353 Bacteria 1389
53 Ga0070669_100483375 3300005353 Bacteria 1025
54 Ga0070675_100007982 3300005354 Bacteria 8201
55 Ga0070675_100009299 3300005354 Bacteria 7641
56 Ga0070675_100029253 3300005354 Bacteria 4442
57 Ga0070675_100201119 3300005354 Bacteria 1729
58 Ga0070675_100277498 3300005354 Bacteria 1472
59 Ga0070671_100000190 3300005355 Bacteria 41368
60 Ga0070671_100022674 3300005355 Bacteria 5129
61 Ga0070671_100038838 3300005355 Bacteria 3951
62 Ga0070671_100177804 3300005355 Bacteria 1801
63 Ga0070671_100525222 3300005355 Bacteria 1019
64 Ga0070674_100027796 3300005356 Bacteria 3710
65 Ga0070674_100038592 3300005356 Bacteria 3219
66 Ga0070674_100082966 3300005356 Bacteria 2294
67 Ga0070674_100169129 3300005356 Bacteria 1665
68 Ga0070674_101168194 3300005356 Bacteria 682
69 Ga0070673_100003726 3300005364 Bacteria 9552
70 Ga0070673_100005750 3300005364 Bacteria 7979
71 Ga0070673_100007428 3300005364 Bacteria 7226
72 Ga0070673_100007601 3300005364 Bacteria 7169
73 Ga0070673_100040011 3300005364 Bacteria 3593
74 Ga0070673_100405584 3300005364 Bacteria 1220
75 Ga0070688_100207246 3300005365 Bacteria 1375
76 Ga0070659_100011923 3300005366 Bacteria 6434
77 Ga0070659_100016545 3300005366 Bacteria 5537
78 Ga0070659_100062773 3300005366 Bacteria 2938
79 Ga0070659_100069696 3300005366 Bacteria 2792
80 Ga0070659_100098728 3300005366 Bacteria 2348
81 Ga0070659_100366747 3300005366 Bacteria 1211
82 Ga0070659_100759079 3300005366 Bacteria 842
83 Ga0070667_100001536 3300005367 Bacteria 20668
84 Ga0070667_100003165 3300005367 Bacteria 14103
85 Ga0070667_100007076 3300005367 Bacteria 9324
86 Ga0070667_100008296 3300005367 Bacteria 8609
87 Ga0070667_100012023 3300005367 Bacteria 7165
88 Ga0070667_100018727 3300005367 Bacteria 5742
89 Ga0070667_100060546 3300005367 Bacteria 3203
90 Ga0070667_100116502 3300005367 Bacteria 2320
91 Ga0070667_100306389 3300005367 Bacteria 1431
92 Ga0070667_101198628 3300005367 Bacteria 711
93 Ga0070705_100389785 3300005440 Bacteria 1028
94 Ga0070663_100063708 3300005455 Bacteria 2663
95 Ga0070663_100770920 3300005455 Bacteria 823
96 Ga0070678_100040855 3300005456 Bacteria 3284
97 Ga0070678_100165462 3300005456 Bacteria 1796
98 Ga0070662_100001246 3300005457 Bacteria 15625
99 Ga0070662_100001439 3300005457 Bacteria 14660
100 Ga0070662_100003210 3300005457 Bacteria 10163
101 Ga0070662_100007707 3300005457 Bacteria 6987
102 Ga0070662_100018517 3300005457 Bacteria 4712
103 Ga0070662_100109329 3300005457 Bacteria 2104
104 Ga0070662_100862266 3300005457 Bacteria 771
105 Ga0068867_100154687 3300005459 Bacteria 1804
106 Ga0070685_10759879 3300005466 Bacteria 711
107 Ga0070679_100211094 3300005530 Bacteria 1905
108 Ga0070684_100989450 3300005535 Bacteria 789
109 Ga0068853_100004667 3300005539 Bacteria 10623
110 Ga0068853_100067399 3300005539 Bacteria 3110
111 Ga0068853_100431661 3300005539 Bacteria 1237
112 Ga0068853_100480797 3300005539 Bacteria 1171
113 Ga0070672_100001644 3300005543 Bacteria 13918
114 Ga0070672_100012803 3300005543 Bacteria 5906
115 Ga0070672_100097586 3300005543 Bacteria 2379
116 Ga0070686_100008017 3300005544 Bacteria 5903
117 Ga0070693_100273675 3300005547 Bacteria 1128
118 Ga0070665_100002886 3300005548 Bacteria 18572
119 Ga0070665_101005447 3300005548 Bacteria 846
120 Ga0068855_100451650 3300005563 Bacteria 1402
121 Ga0068855_100572682 3300005563 Bacteria 1220
122 Ga0068855_100642406 3300005563 Bacteria 1140
123 Ga0068855_100903964 3300005563 Bacteria 932
124 Ga0070664_100004638 3300005564 Bacteria 11035
125 Ga0070664_100024252 3300005564 Bacteria 5016
126 Ga0070664_100055243 3300005564 Bacteria 3370
127 Ga0070664_100126489 3300005564 Bacteria 2242
128 Ga0070664_100277295 3300005564 Bacteria 1511
129 Ga0068857_100010833 3300005577 Bacteria 7939
130 Ga0068857_100047147 3300005577 Bacteria 3825
131 Ga0068857_100208455 3300005577 Bacteria 1783
132 Ga0068854_100000334 3300005578 Bacteria 30834
133 Ga0068854_100020970 3300005578 Bacteria 4428
134 Ga0068854_100056441 3300005578 Bacteria 2830
135 Ga0068854_100392135 3300005578 Bacteria 1147
136 Ga0068854_100406344 3300005578 Bacteria 1128
137 Ga0068852_100001072 3300005616 Bacteria 18069
138 Ga0068852_100028203 3300005616 Bacteria 4590
139 Ga0068852_100266476 3300005616 Bacteria 1647
140 Ga0068852_100391942 3300005616 Bacteria 1364
141 Ga0068852_100530991 3300005616 Bacteria 1175
142 Ga0068852_101012207 3300005616 Bacteria 850
143 Ga0068859_100000377 3300005617 Bacteria 44438
144 Ga0068859_100016908 3300005617 Bacteria 7322
145 Ga0068859_100099693 3300005617 Bacteria 2960
146 Ga0068859_100157669 3300005617 Bacteria 2348
147 Ga0068859_100960594 3300005617 Bacteria 937
148 Ga0068864_100000074 3300005618 Bacteria 109458
149 Ga0068864_100006328 3300005618 Bacteria 9710
150 Ga0068864_100008279 3300005618 Bacteria 8577
151 Ga0068864_100071812 3300005618 Bacteria 3015
152 Ga0068864_100112080 3300005618 Bacteria 2431
153 Ga0068861_100409769 3300005719 Bacteria 1205
154 Ga0068861_100413864 3300005719 Bacteria 1199
155 Ga0068851_10090118 3300005834 Bacteria 1613
156 Ga0068851_10292740 3300005834 Bacteria 934
157 Ga0068851_10736228 3300005834 Bacteria 609
158 Ga0068863_100000887 3300005841 Bacteria 30122
159 Ga0068863_100007439 3300005841 Bacteria 10717
160 Ga0068863_100007887 3300005841 Bacteria 10414
161 Ga0068863_100714491 3300005841 Bacteria 996
162 Ga0068858_100003534 3300005842 Bacteria 15479
163 Ga0068858_100003796 3300005842 Bacteria 14940
164 Ga0068858_100008153 3300005842 Bacteria 10069
165 Ga0068858_100178461 3300005842 Bacteria 2005
166 Ga0068858_100203941 3300005842 Bacteria 1871
167 Ga0068860_100001585 3300005843 Bacteria 24476
168 Ga0068860_100008637 3300005843 Bacteria 10152
169 Ga0068860_100114405 3300005843 Bacteria 2580
170 Ga0068860_100117583 3300005843 Bacteria 2544
171 Ga0068862_100035335 3300005844 Bacteria 4232
172 Ga0068862_100043504 3300005844 Bacteria 3830
173 Ga0068862_100110345 3300005844 Bacteria 2414
174 Ga0068862_100131235 3300005844 Bacteria 2216
175 Ga0068862_100369060 3300005844 Bacteria 1335
176 Ga0068862_101178552 3300005844 Bacteria 764
177 Ga0097621_100005924 3300006237 Bacteria 8639
178 Ga0097621_100146324 3300006237 Bacteria 2023
179 Ga0097621_100571759 3300006237 Bacteria 1030
180 Ga0068871_100234764 3300006358 Bacteria 1593
181 Ga0068871_100308670 3300006358 Bacteria 1390
182 Ga0068865_100214151 3300006881 Bacteria 1503
183 Ga0068865_100706214 3300006881 Bacteria 862
184 Ga0097620_100000377 3300006931 Bacteria 44438
185 Ga0097620_100016909 3300006931 Bacteria 7322
186 Ga0097620_100099689 3300006931 Bacteria 2960
187 Ga0097620_100157660 3300006931 Bacteria 2348
188 Ga0097620_100960564 3300006931 Bacteria 937
189 Ga0105251_10122200 3300009011 Bacteria 1182
190 Ga0105240_10008099 3300009093 Bacteria 15093
191 Ga0105240_10098562 3300009093 Bacteria 3559
192 Ga0105240_10267544 3300009093 Bacteria 1969
193 Ga0105240_10300764 3300009093 Bacteria 1835
194 Ga0105245_10002347 3300009098 Bacteria 17117
195 Ga0105243_10411516 3300009148 Bacteria 1259
196 Ga0105243_10708098 3300009148 Bacteria 982
197 Ga0105241_10043853 3300009174 Bacteria 3388
198 Ga0105241_10631779 3300009174 Bacteria 971
199 Ga0105242_10493663 3300009176 Bacteria 1163
200 Ga0105242_12032593 3300009176 Bacteria 617
201 Ga0105248_10000071 3300009177 Bacteria 118281
202 Ga0105248_10000268 3300009177 Bacteria 61070
203 Ga0105248_10002245 3300009177 Bacteria 21383
204 Ga0105248_10003138 3300009177 Bacteria 18284
205 Ga0105248_10003624 3300009177 Bacteria 17137
206 Ga0105248_10020222 3300009177 Bacteria 7374
207 Ga0105248_11071219 3300009177 Bacteria 911
208 Ga0105238_10112662 3300009551 Bacteria 2700
209 Ga0105238_10623051 3300009551 Bacteria 1088
210 Ga0105249_10196393 3300009553 Bacteria 1972
211 Ga0105239_10137250 3300010375 Bacteria 2723
212 Ga0157315_1051510 3300012508 Bacteria 554
213 Ga0157373_10078699 3300013100 Bacteria 2325
214 Ga0157373_10079845 3300013100 Bacteria 2307
215 Ga0157373_10102090 3300013100 Bacteria 2018
216 Ga0157373_10187149 3300013100 Bacteria 1459
217 Ga0157371_10000867 3300013102 Bacteria 34332
218 Ga0157371_10033139 3300013102 Bacteria 3713
219 Ga0157371_10131647 3300013102 Bacteria 1780
220 Ga0157371_10292786 3300013102 Bacteria 1177
221 Ga0157370_10034625 3300013104 Bacteria 4915
222 Ga0157370_10666620 3300013104 Bacteria 950
223 Ga0157369_10000298 3300013105 Bacteria 66393
224 Ga0157369_10014983 3300013105 Bacteria 8751
225 Ga0157369_10117618 3300013105 Bacteria 2821
226 Ga0157374_10065892 3300013296 Bacteria 3403
227 Ga0157374_10072915 3300013296 Bacteria 3240
228 Ga0157374_10343064 3300013296 Bacteria 1483
229 Ga0157378_10150614 3300013297 Bacteria 2167
230 Ga0157378_10166858 3300013297 Bacteria 2063
231 Ga0157378_10642401 3300013297 Bacteria 1076
232 Ga0163162_10421611 3300013306 Bacteria 1467
233 Ga0163162_10524248 3300013306 Bacteria 1314
234 Ga0163162_10667118 3300013306 Bacteria 1163
235 Ga0163162_10691809 3300013306 Bacteria 1142
236 Ga0163162_10795134 3300013306 Bacteria 1063
237 Ga0157372_10146967 3300013307 Bacteria 2718
238 Ga0157372_10189843 3300013307 Bacteria 2380
239 Ga0157375_10104424 3300013308 Bacteria 2922
240 Ga0157375_10133983 3300013308 Bacteria 2599
241 Ga0157375_10499304 3300013308 Bacteria 1381
242 Ga0157375_10655380 3300013308 Bacteria 1206
243 Ga0163163_10000219 3300014325 Bacteria 59481
244 Ga0163163_10032124 3300014325 Bacteria 5071
245 Ga0163163_10522218 3300014325 Bacteria 1250
246 Ga0157380_11598218 3300014326 Bacteria 707
247 Ga0157379_10001730 3300014968 Bacteria 18065
248 Ga0157379_11334728 3300014968 Bacteria 693
249 Ga0157379_11565274 3300014968 Bacteria 643
250 Ga0163161_10094721 3300017792 Bacteria 2214
251 Ga0163161_10823597 3300017792 Bacteria 782
252 Ga0207697_10133848 3300025315 Bacteria 1072
253 Ga0207656_10080598 3300025321 Bacteria 1462
254 Ga0207656_10259336 3300025321 Bacteria 853
255 Ga0207682_10002976 3300025893 Bacteria 7434
256 Ga0207688_10119830 3300025901 Bacteria 1535
257 Ga0207680_10074654 3300025903 Bacteria 2112
258 Ga0207680_10357290 3300025903 Bacteria 1027
259 Ga0207680_10446184 3300025903 Bacteria 918
260 Ga0207647_10002939 3300025904 Bacteria 12824
261 Ga0207647_10020274 3300025904 Bacteria 4459
262 Ga0207647_10026341 3300025904 Bacteria 3806
263 Ga0207647_10046968 3300025904 Bacteria 2687
264 Ga0207647_10150032 3300025904 Bacteria 1363
265 Ga0207647_10174148 3300025904 Unclassified 1252
266 Ga0207645_10004867 3300025907 Bacteria 9849
267 Ga0207645_10044351 3300025907 Bacteria 2846
268 Ga0207645_10977966 3300025907 Bacteria 574
269 Ga0207705_10000070 3300025909 Bacteria 130733
270 Ga0207705_10046559 3300025909 Bacteria 3117
271 Ga0207705_10062537 3300025909 Bacteria 2689
272 Ga0207705_10148670 3300025909 Bacteria 1754
273 Ga0207654_10033771 3300025911 Bacteria 2838
274 Ga0207695_10011780 3300025913 Bacteria 10560
275 Ga0207695_10015034 3300025913 Bacteria 9133
276 Ga0207695_10082120 3300025913 Bacteria 3260
277 Ga0207657_10014072 3300025919 Bacteria 7828
278 Ga0207657_10030981 3300025919 Bacteria 4849
279 Ga0207657_10387675 3300025919 Bacteria 1100
280 Ga0207649_10000816 3300025920 Bacteria 20025
281 Ga0207649_10036981 3300025920 Bacteria 2945
282 Ga0207649_10042328 3300025920 Bacteria 2778
283 Ga0207649_10042888 3300025920 Bacteria 2762
284 Ga0207681_10038332 3300025923 Bacteria 3175
285 Ga0207681_10046614 3300025923 Bacteria 2916
286 Ga0207681_10176987 3300025923 Bacteria 1622
287 Ga0207681_10235535 3300025923 Bacteria 1423
288 Ga0207694_10036679 3300025924 Bacteria 3763
289 Ga0207650_10027429 3300025925 Bacteria 4077
290 Ga0207650_10028803 3300025925 Bacteria 3985
291 Ga0207650_10100644 3300025925 Bacteria 2224
292 Ga0207650_10200526 3300025925 Bacteria 1598
293 Ga0207650_10258436 3300025925 Bacteria 1412
294 Ga0207650_10268366 3300025925 Bacteria 1386
295 Ga0207650_10465970 3300025925 Bacteria 1053
296 Ga0207659_10006496 3300025926 Bacteria 7166
297 Ga0207659_10168394 3300025926 Bacteria 1726
298 Ga0207659_10293770 3300025926 Bacteria 1332
299 Ga0207659_10622559 3300025926 Bacteria 921
300 Ga0207687_10027837 3300025927 Bacteria 3794
301 Ga0207644_10001850 3300025931 Bacteria 13771
302 Ga0207644_10012706 3300025931 Bacteria 5598
303 Ga0207644_10014933 3300025931 Bacteria 5207
304 Ga0207644_10017372 3300025931 Bacteria 4857
305 Ga0207644_10160822 3300025931 Bacteria 1745
306 Ga0207690_10016994 3300025932 Bacteria 4436
307 Ga0207690_10078948 3300025932 Bacteria 2292
308 Ga0207690_10101506 3300025932 Bacteria 2055
309 Ga0207690_10149356 3300025932 Bacteria 1731
310 Ga0207690_10293706 3300025932 Bacteria 1269
311 Ga0207690_10406543 3300025932 Bacteria 1086
312 Ga0207706_10002227 3300025933 Bacteria 18932
313 Ga0207706_10004069 3300025933 Bacteria 13822
314 Ga0207706_10027529 3300025933 Bacteria 5082
315 Ga0207706_10027660 3300025933 Bacteria 5070
316 Ga0207706_10033378 3300025933 Bacteria 4582
317 Ga0207706_10034743 3300025933 Bacteria 4486
318 Ga0207706_10039836 3300025933 Bacteria 4166
319 Ga0207706_10121902 3300025933 Bacteria 2293
320 Ga0207706_10338918 3300025933 Bacteria 1308
321 Ga0207706_10495613 3300025933 Bacteria 1055
322 Ga0207686_10469579 3300025934 Bacteria 971
323 Ga0207709_10336050 3300025935 Bacteria 1135
324 Ga0207670_10085406 3300025936 Bacteria 2218
325 Ga0207670_10087665 3300025936 Bacteria 2193
326 Ga0207670_10821504 3300025936 Bacteria 775
327 Ga0207669_10024485 3300025937 Bacteria 3245
328 Ga0207669_10638982 3300025937 Bacteria 869
329 Ga0207704_10014745 3300025938 Bacteria 3958
330 Ga0207704_10238480 3300025938 Bacteria 1357
331 Ga0207704_10385835 3300025938 Bacteria 1101
332 Ga0207691_10001285 3300025940 Bacteria 25027
333 Ga0207691_10048439 3300025940 Bacteria 3896
334 Ga0207711_10000333 3300025941 Bacteria 50088
335 Ga0207711_10000450 3300025941 Bacteria 42929
336 Ga0207711_10000999 3300025941 Bacteria 27105
337 Ga0207711_10001758 3300025941 Bacteria 19856
338 Ga0207711_10019305 3300025941 Bacteria 5677
339 Ga0207711_10037411 3300025941 Bacteria 4122
340 Ga0207689_10363956 3300025942 Bacteria 1203
341 Ga0207679_10115156 3300025945 Bacteria 2129
342 Ga0207679_10184968 3300025945 Bacteria 1727
343 Ga0207679_10321886 3300025945 Bacteria 1339
344 Ga0207679_10485651 3300025945 Bacteria 1100
345 Ga0207667_10162795 3300025949 Bacteria 2294
346 Ga0207667_10277377 3300025949 Bacteria 1713
347 Ga0207667_10281897 3300025949 Bacteria 1698
348 Ga0207667_10475364 3300025949 Bacteria 1269
349 Ga0207651_10004576 3300025960 Bacteria 7002
350 Ga0207651_10013579 3300025960 Bacteria 4667
351 Ga0207651_10069150 3300025960 Bacteria 2492
352 Ga0207651_10085712 3300025960 Bacteria 2286
353 Ga0207651_10137652 3300025960 Bacteria 1881
354 Ga0207712_10155406 3300025961 Bacteria 1771
355 Ga0207712_10622951 3300025961 Bacteria 935
356 Ga0207668_10122667 3300025972 Bacteria 1970
357 Ga0207668_10255571 3300025972 Bacteria 1425
358 Ga0207668_10409508 3300025972 Bacteria 1148
359 Ga0207668_10732742 3300025972 Bacteria 871
360 Ga0207668_11894195 3300025972 Bacteria 538
361 Ga0207640_10000344 3300025981 Bacteria 30468
362 Ga0207640_10006924 3300025981 Bacteria 6237
363 Ga0207640_10011746 3300025981 Bacteria 4967
364 Ga0207640_10181931 3300025981 Bacteria 1577
365 Ga0207640_10414502 3300025981 Bacteria 1100
366 Ga0207640_10666003 3300025981 Bacteria 888
367 Ga0207658_10000634 3300025986 Bacteria 30862
368 Ga0207658_10004146 3300025986 Bacteria 10101
369 Ga0207658_10013250 3300025986 Bacteria 5631
370 Ga0207658_10021255 3300025986 Bacteria 4502
371 Ga0207658_10043370 3300025986 Bacteria 3269
372 Ga0207658_10120327 3300025986 Bacteria 2092
373 Ga0207658_10141709 3300025986 Bacteria 1946
374 Ga0207658_10182504 3300025986 Bacteria 1738
375 Ga0207658_10190620 3300025986 Bacteria 1704
376 Ga0207658_10749669 3300025986 Bacteria 884
377 Ga0207677_10000665 3300026023 Bacteria 20426
378 Ga0207677_10039450 3300026023 Bacteria 3105
379 Ga0207677_11539490 3300026023 Bacteria 615
380 Ga0207703_10002818 3300026035 Bacteria 14828
381 Ga0207703_10011564 3300026035 Bacteria 6863
382 Ga0207703_10138144 3300026035 Bacteria 2112
383 Ga0207703_10188919 3300026035 Bacteria 1823
384 Ga0207703_10900027 3300026035 Bacteria 847
385 Ga0207639_10011224 3300026041 Bacteria 6215
386 Ga0207639_10407396 3300026041 Bacteria 1226
387 Ga0207678_10007626 3300026067 Bacteria 9559
388 Ga0207678_10026409 3300026067 Bacteria 5065
389 Ga0207678_10068571 3300026067 Bacteria 3043
390 Ga0207678_10199758 3300026067 Bacteria 1709
391 Ga0207678_10684427 3300026067 Bacteria 902
392 Ga0207678_11191027 3300026067 Bacteria 674
393 Ga0207702_10016214 3300026078 Bacteria 6167
394 Ga0207702_10083918 3300026078 Bacteria 2773
395 Ga0207641_10000188 3300026088 Bacteria 86532
396 Ga0207641_10063317 3300026088 Bacteria 3159
397 Ga0207648_10019688 3300026089 Bacteria 6089
398 Ga0207676_10000438 3300026095 Bacteria 35161
399 Ga0207676_10012470 3300026095 Bacteria 6092
400 Ga0207676_10031484 3300026095 Bacteria 3990
401 Ga0207676_10199326 3300026095 Bacteria 1767
402 Ga0207676_10367353 3300026095 Bacteria 1335
403 Ga0207676_10423006 3300026095 Bacteria 1250
404 Ga0207676_11054992 3300026095 Bacteria 802
405 Ga0207674_10003595 3300026116 Bacteria 18906
406 Ga0207674_10028779 3300026116 Bacteria 5859
407 Ga0207675_100130020 3300026118 Bacteria 2387
408 Ga0207683_10009090 3300026121 Bacteria 8469
409 Ga0207683_10195975 3300026121 Bacteria 1835
410 Ga0207683_10394365 3300026121 Bacteria 1273
411 Ga0207698_10007920 3300026142 Bacteria 6692
412 Ga0207698_10029979 3300026142 Bacteria 3905
413 Ga0207698_10033317 3300026142 Bacteria 3743
414 Ga0207698_10095945 3300026142 Bacteria 2443
415 Ga0207698_10718713 3300026142 Bacteria 995
416 Ga0268266_10049998 3300028379 Bacteria 3586
417 Ga0268266_10205249 3300028379 Bacteria 1805
418 Ga0268266_11413458 3300028379 Bacteria 671
419 Ga0268265_10088734 3300028380 Bacteria 2464
420 Ga0268265_10108107 3300028380 Bacteria 2263
421 Ga0268265_10112327 3300028380 Bacteria 2227
422 Ga0268265_10313944 3300028380 Bacteria 1416
423 Ga0268265_10373472 3300028380 Bacteria 1309
424 Ga0268265_11462575 3300028380 Bacteria 686
425 Ga0268265_11785801 3300028380 Bacteria 621
426 Ga0268264_10001006 3300028381 Bacteria 28608
427 Ga0268264_10045042 3300028381 Bacteria 3662
428 Ga0268264_10787235 3300028381 Bacteria 949
429 Ga0268264_11034695 3300028381 Bacteria 828
430 Ga0316177_1138970 3300030731 Bacteria 661
431 Ga0314311_1097860 3300030733 Bacteria 782
432 Ga0316178_1006155 3300030735 Bacteria 699
433 Ga0316183_1064884 3300030742 Bacteria 2576
434 Ga0316182_1085336 3300030745 Bacteria 1968
435 Ga0307408_100058079 3300031548 Bacteria 2811
436 Ga0307408_100126627 3300031548 Bacteria 1987
437 Ga0307408_100243144 3300031548 Bacteria 1480
438 Ga0307408_101036375 3300031548 Bacteria 758
439 Ga0307405_10042024 3300031731 Bacteria 2780
440 Ga0307405_10046226 3300031731 Bacteria 2673
441 Ga0307405_10153746 3300031731 Bacteria 1621
442 Ga0307405_10220893 3300031731 Bacteria 1390
443 Ga0307405_10817250 3300031731 Bacteria 782
444 Ga0307405_11170535 3300031731 Bacteria 664
445 Ga0307413_10003858 3300031824 Bacteria 6402
446 Ga0307413_10017016 3300031824 Bacteria 3776
447 Ga0307413_10072983 3300031824 Bacteria 2168
448 Ga0307413_10183499 3300031824 Bacteria 1494
449 Ga0307413_10229273 3300031824 Bacteria 1363
450 Ga0307413_10317787 3300031824 Bacteria 1188
451 Ga0307413_10619106 3300031824 Bacteria 888
452 Ga0307413_10784119 3300031824 Bacteria 799
453 Ga0307413_11799995 3300031824 Bacteria 548
454 Ga0307410_10002293 3300031852 Bacteria 9183
455 Ga0307410_10002603 3300031852 Bacteria 8771
456 Ga0307410_10006803 3300031852 Bacteria 6205
457 Ga0307410_10120052 3300031852 Bacteria 1916
458 Ga0307410_10243625 3300031852 Bacteria 1394
459 Ga0307410_10363554 3300031852 Bacteria 1159
460 Ga0307410_10369189 3300031852 Bacteria 1151
461 Ga0307410_10386284 3300031852 Bacteria 1127
462 Ga0307410_10419542 3300031852 Bacteria 1085
463 Ga0307410_10820975 3300031852 Bacteria 792
464 Ga0307410_11024028 3300031852 Bacteria 713
465 Ga0307406_10056479 3300031901 Bacteria 2514
466 Ga0307406_10071050 3300031901 Bacteria 2280
467 Ga0307406_10161426 3300031901 Bacteria 1611
468 Ga0307406_11185744 3300031901 Unclassified 662
469 Ga0307407_10003942 3300031903 Bacteria 6196
470 Ga0307407_10047567 3300031903 Bacteria 2435
471 Ga0307407_10091571 3300031903 Bacteria 1865
472 Ga0307407_10157079 3300031903 Bacteria 1484
473 Ga0307407_10168670 3300031903 Bacteria 1440
474 Ga0307407_10350330 3300031903 Bacteria 1045
475 Ga0307407_10639436 3300031903 Bacteria 796
476 Ga0307412_10003002 3300031911 Bacteria 9337
477 Ga0307412_10109903 3300031911 Bacteria 1966
478 Ga0307412_10137325 3300031911 Bacteria 1785
479 Ga0307412_10205116 3300031911 Bacteria 1500
480 Ga0307412_10327603 3300031911 Bacteria 1221
481 Ga0307412_10766321 3300031911 Bacteria 834
482 Ga0307412_10784467 3300031911 Bacteria 826
483 Ga0307412_11267911 3300031911 Bacteria 662
484 Ga0307409_100011689 3300031995 Bacteria 5550
485 Ga0307409_100014063 3300031995 Bacteria 5185
486 Ga0307409_100044437 3300031995 Bacteria 3346
487 Ga0307409_100051090 3300031995 Bacteria 3161
488 Ga0307409_100118636 3300031995 Bacteria 2235
489 Ga0307409_100170889 3300031995 Bacteria 1913
490 Ga0307409_100209557 3300031995 Bacteria 1750
491 Ga0307409_100215190 3300031995 Bacteria 1730
492 Ga0307409_100273898 3300031995 Bacteria 1556
493 Ga0307409_100416053 3300031995 Bacteria 1288
494 Ga0307409_100492948 3300031995 Bacteria 1191
495 Ga0307409_100618780 3300031995 Bacteria 1072
496 Ga0307409_101039473 3300031995 Bacteria 838
497 Ga0307409_101474150 3300031995 Bacteria 707
498 Ga0307416_100001561 3300032002 Bacteria 12546
499 Ga0307416_100028750 3300032002 Bacteria 4140
500 Ga0307416_100047549 3300032002 Bacteria 3397
501 Ga0307416_100066775 3300032002 Bacteria 2963
502 Ga0307416_100097629 3300032002 Bacteria 2545
503 Ga0307416_100412015 3300032002 Bacteria 1392
504 Ga0307416_100446649 3300032002 Bacteria 1344
505 Ga0307416_100717627 3300032002 Bacteria 1090
506 Ga0307416_100949346 3300032002 Bacteria 962
507 Ga0307416_101340356 3300032002 Unclassified 821
508 Ga0307416_101811205 3300032002 Bacteria 714
509 Ga0307414_10003633 3300032004 Bacteria 8262
510 Ga0307414_10020007 3300032004 Bacteria 4162
511 Ga0307414_10032939 3300032004 Bacteria 3418
512 Ga0307414_10127738 3300032004 Bacteria 1967
513 Ga0307414_10132221 3300032004 Bacteria 1939
514 Ga0307414_10248733 3300032004 Bacteria 1476
515 Ga0307414_10512465 3300032004 Bacteria 1063
516 Ga0307411_10000438 3300032005 Bacteria 14246
517 Ga0307411_10007089 3300032005 Bacteria 5674
518 Ga0307411_10007464 3300032005 Bacteria 5572
519 Ga0307411_10084978 3300032005 Bacteria 2190
520 Ga0307411_10197689 3300032005 Bacteria 1541
521 Ga0307411_10396596 3300032005 Bacteria 1139
522 Ga0307411_10474978 3300032005 Bacteria 1051
523 Ga0307411_10576952 3300032005 Bacteria 963
524 Ga0307411_10626872 3300032005 Bacteria 928
525 Ga0307411_10668027 3300032005 Bacteria 901
526 Ga0307411_10958501 3300032005 Bacteria 763
527 Ga0307411_11107251 3300032005 Bacteria 714
528 Ga0307411_11414380 3300032005 Unclassified 637
529 Ga0307415_100002360 3300032126 Bacteria 9391
530 Ga0307415_100071842 3300032126 Bacteria 2435
531 Ga0307415_100208059 3300032126 Bacteria 1558
532 Ga0307415_100249727 3300032126 Bacteria 1441
533 Ga0307415_100351760 3300032126 Bacteria 1240
534 Ga0373937_0383897 3300036401 Bacteria 1332
535 Ga0395899_0017106 3300037312 Bacteria 5524
536 Ga0395899_0331177 3300037312 Bacteria 1023
537 Ga0395900_0017641 3300037418 Bacteria 7284
538 Ga0395900_0052306 3300037418 Bacteria 4205
539 Ga0395900_0066666 3300037418 Bacteria 3699
540 Ga0395900_0098924 3300037418 Bacteria 2997
541 Ga0395900_0156051 3300037418 Bacteria 2331
542 Ga0395900_0281003 3300037418 Bacteria 1656
543 Ga0395900_0959463 3300037418 Bacteria 776
544 Ga0395898_0025005 3300037466 Bacteria 6020
545 Ga0395898_0178403 3300037466 Bacteria 2030
546 Ga0395898_0305478 3300037466 Bacteria 1518
547 Ga0395898_0841369 3300037466 Bacteria 857
548 Ga0395898_1840270 3300037466 Bacteria 526
549 Ga0395905_0044209 3300037471 Bacteria 4180
550 Ga0395905_0047505 3300037471 Bacteria 4023
551 Ga0395905_0237537 3300037471 Bacteria 1703
552 Ga0395905_0327304 3300037471 Bacteria 1422
553 Ga0395905_0618658 3300037471 Bacteria 985
554 Ga0395901_0011159 3300038443 Bacteria 9104
555 Ga0395901_0289185 3300038443 Bacteria 1701
556 Ga0395901_0567351 3300038443 Bacteria 1148
557 Ga0451807_0199346 3300041486 Bacteria 2232
558 Ga0451835_0385350 3300041492 Bacteria 1182
559 Ga0439449_0098457 3300042007 Bacteria 1080
560 Ga0466963_0045087 3300044694 Bacteria 2903
561 Ga0466964_0057432 3300044706 Bacteria 1611
562 Ga0466967_0327207 3300045976 Bacteria 1479
563 Ga0466967_0514041 3300045976 Bacteria 1176
564 Ga0495663_0119075 3300046525 Bacteria 883
565 Ga0495668_0006757 3300046616 Bacteria 7457
566 Ga0495588_0372527 3300046674 Bacteria 750
567 Ga0495669_0035507 3300046684 Bacteria 2201
568 Ga0495669_0065399 3300046684 Bacteria 1651
569 Ga0495669_0070901 3300046684 Bacteria 1588
570 Ga0495683_0181188 3300047323 Bacteria 962
571 Ga0496101_0041000 3300048904 Bacteria 3299
572 Ga0496102_0104521 3300048905 Bacteria 2634
573 Ga0496103_0518568 3300048906 Bacteria 762
574 Ga0496107_0361330 3300048910 Bacteria 1080
575 Ga0496108_0020259 3300048911 Bacteria 5465
576 Ga0496108_0047621 3300048911 Bacteria 3584
577 Ga0496108_1142395 3300048911 Bacteria 660
578 Ga0496109_0156413 3300048912 Bacteria 2135
579 Ga0496109_1120647 3300048912 Bacteria 724
580 Ga0496110_0006432 3300048913 Bacteria 9303
581 Ga0496110_0209380 3300048913 Bacteria 1772
582 Ga0496111_0025608 3300048914 Bacteria 4163
583 Ga0496111_0274078 3300048914 Bacteria 1251
584 Ga0496111_0727214 3300048914 Bacteria 721
585 Ga0496112_0119331 3300048915 Bacteria 2607
586 Ga0496112_1570162 3300048915 Bacteria 571
587 Ga0496114_0009772 3300048917 Bacteria 7621
588 Ga0501069_0243225 3300049585 Bacteria 1049
589 Ga0501071_0700513 3300049587 Bacteria 780
590 Ga0501227_088768 3300049665 Bacteria 815
591 Ga0501239_037656 3300049672 Bacteria 658
592 Ga0501267_028848 3300049764 Bacteria 645
593 Ga0501268_122161 3300049765 Bacteria 578
594 Ga0500658_0000963 3300053134 Bacteria 11749
595 Ga0466962_0180437 3300061719 Bacteria 1029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0518568 Ga0496103_0518568_333_725 124
2 3300005530 Ga0070679_100211094 Ga0070679_1002110942 127
3 3300031731 Ga0307405_10042024 Ga0307405_100420244 130
4 3300031824 Ga0307413_10317787 Ga0307413_103177873 130
5 3300037471 Ga0395905_0618658 Ga0395905_0618658_18_410 130
6 3300005331 Ga0070670_100223884 Ga0070670_1002238842 132
7 3300005353 Ga0070669_100231701 Ga0070669_1002317013 132
8 3300005366 Ga0070659_100759079 Ga0070659_1007590792 132
9 3300005457 Ga0070662_100862266 Ga0070662_1008622662 132
10 3300025925 Ga0207650_10100644 Ga0207650_101006444 132
11 3300025932 Ga0207690_10101506 Ga0207690_101015062 132
12 3300025933 Ga0207706_10033378 Ga0207706_100333784 132
13 3300026035 Ga0207703_10188919 Ga0207703_101889193 133
14 3300005293 Ga0065715_10107215 Ga0065715_101072153 134
15 3300028380 Ga0268265_10313944 Ga0268265_103139443 134
16 3300005331 Ga0070670_100161352 Ga0070670_1001613522 135
17 3300005539 Ga0068853_100480797 Ga0068853_1004807971 135
18 3300005844 Ga0068862_100035335 Ga0068862_1000353352 135
19 3300025938 Ga0207704_10238480 Ga0207704_102384802 136
20 3300005347 Ga0070668_100010572 Ga0070668_1000105727 138
21 3300006237 Ga0097621_100571759 Ga0097621_1005717592 138
22 3300025972 Ga0207668_10122667 Ga0207668_101226672 138
23 3300031548 Ga0307408_100243144 Ga0307408_1002431443 138
24 3300031852 Ga0307410_10120052 Ga0307410_101200522 138
25 3300031901 Ga0307406_10161426 Ga0307406_101614262 138
26 3300031995 Ga0307409_100492948 Ga0307409_1004929482 138
27 3300031995 Ga0307409_101039473 Ga0307409_1010394733 138
28 3300032004 Ga0307414_10020007 Ga0307414_100200077 138
29 3300005366 Ga0070659_100098728 Ga0070659_1000987282 139
30 3300025904 Ga0207647_10174148 Ga0207647_101741482 139
31 3300025932 Ga0207690_10078948 Ga0207690_100789482 139
32 3300031995 Ga0307409_100273898 Ga0307409_1002738982 139
33 3300041486 Ga0451807_0199346 Ga0451807_0199346_812_1255 139
34 3300046525 Ga0495663_0119075 Ga0495663_0119075_20_439 139
35 3300005339 Ga0070660_100437784 Ga0070660_1004377842 140
36 3300005578 Ga0068854_100392135 Ga0068854_1003921353 140
37 3300005616 Ga0068852_101012207 Ga0068852_1010122072 140
38 3300005834 Ga0068851_10736228 Ga0068851_107362281 140
39 3300005844 Ga0068862_100110345 Ga0068862_1001103453 140
40 3300025919 Ga0207657_10387675 Ga0207657_103876752 140
41 3300025981 Ga0207640_10181931 Ga0207640_101819312 140
42 3300028380 Ga0268265_10112327 Ga0268265_101123273 140
43 3300002239 JGI24034J26672_10060621 JGI24034J26672_100606211 141
44 3300014325 Ga0163163_10522218 Ga0163163_105222182 141
45 3300031548 Ga0307408_100126627 Ga0307408_1001266272 141
46 3300031731 Ga0307405_10220893 Ga0307405_102208932 141
47 3300041492 Ga0451835_0385350 Ga0451835_0385350_366_893 141
48 3300046684 Ga0495669_0070901 Ga0495669_0070901_103_528 141
49 3300061719 Ga0466962_0180437 Ga0466962_0180437_529_969 141
50 3300036401 Ga0373937_0383897 Ga0373937_0383897_812_1267 142
51 3300025907 Ga0207645_10977966 Ga0207645_109779661 143
52 3300025923 Ga0207681_10176987 Ga0207681_101769871 143
53 3300025945 Ga0207679_10115156 Ga0207679_101151564 143
54 3300031911 Ga0307412_11267911 Ga0307412_112679112 143
55 3300048912 Ga0496109_0156413 Ga0496109_0156413_1396_1845 143
56 3300005355 Ga0070671_100038838 Ga0070671_1000388382 144
57 3300005457 Ga0070662_100109329 Ga0070662_1001093293 144
58 3300005844 Ga0068862_101178552 Ga0068862_1011785522 144
59 3300025931 Ga0207644_10017372 Ga0207644_100173724 144
60 3300025933 Ga0207706_10121902 Ga0207706_101219023 144
61 3300026067 Ga0207678_11191027 Ga0207678_111910272 144
62 iso_pu_bacteria 2885427238 2885428241 144
63 3300001989 JGI24739J22299_10000218 JGI24739J22299_1000021822 146
64 3300001990 JGI24737J22298_10001076 JGI24737J22298_100010767 146
65 3300002074 JGI24748J21848_1018694 JGI24748J21848_10186943 146
66 3300002075 JGI24738J21930_10000923 JGI24738J21930_100009234 146
67 3300002239 JGI24034J26672_10010046 JGI24034J26672_100100462 146
68 3300005290 Ga0065712_10047667 Ga0065712_100476671 146
69 3300005327 Ga0070658_10076626 Ga0070658_100766262 146
70 3300005327 Ga0070658_10092445 Ga0070658_100924451 146
71 3300005329 Ga0070683_100242098 Ga0070683_1002420984 146
72 3300005330 Ga0070690_100009606 Ga0070690_10000960610 146
73 3300005331 Ga0070670_100082684 Ga0070670_1000826843 146
74 3300005331 Ga0070670_100084867 Ga0070670_1000848672 146
75 3300005331 Ga0070670_100641795 Ga0070670_1006417953 146
76 3300005334 Ga0068869_100025580 Ga0068869_1000255804 146
77 3300005335 Ga0070666_10000731 Ga0070666_100007312 146
78 3300005335 Ga0070666_10004646 Ga0070666_1000464611 146
79 3300005335 Ga0070666_10006870 Ga0070666_1000687010 146
80 3300005335 Ga0070666_10426083 Ga0070666_104260832 146
81 3300005338 Ga0068868_100002334 Ga0068868_10000233410 146
82 3300005338 Ga0068868_100008603 Ga0068868_1000086035 146
83 3300005339 Ga0070660_100005952 Ga0070660_1000059526 146
84 3300005340 Ga0070689_100071123 Ga0070689_1000711234 146
85 3300005340 Ga0070689_100103921 Ga0070689_1001039212 146
86 3300005344 Ga0070661_100115994 Ga0070661_1001159942 146
87 3300005344 Ga0070661_100144635 Ga0070661_1001446352 146
88 3300005344 Ga0070661_100228128 Ga0070661_1002281282 146
89 3300005344 Ga0070661_100254758 Ga0070661_1002547583 146
90 3300005345 Ga0070692_10105896 Ga0070692_101058963 146
91 3300005347 Ga0070668_100617548 Ga0070668_1006175483 146
92 3300005347 Ga0070668_101697458 Ga0070668_1016974581 146
93 3300005353 Ga0070669_100258269 Ga0070669_1002582692 146
94 3300005353 Ga0070669_100483375 Ga0070669_1004833751 146
95 3300005354 Ga0070675_100029253 Ga0070675_1000292536 146
96 3300005354 Ga0070675_100201119 Ga0070675_1002011193 146
97 3300005354 Ga0070675_100277498 Ga0070675_1002774982 146
98 3300005355 Ga0070671_100022674 Ga0070671_10002267410 146
99 3300005355 Ga0070671_100177804 Ga0070671_1001778043 146
100 3300005355 Ga0070671_100525222 Ga0070671_1005252222 146
101 3300005356 Ga0070674_100027796 Ga0070674_1000277966 146
102 3300005356 Ga0070674_100038592 Ga0070674_1000385922 146
103 3300005356 Ga0070674_100169129 Ga0070674_1001691293 146
104 3300005364 Ga0070673_100003726 Ga0070673_1000037264 146
105 3300005364 Ga0070673_100007428 Ga0070673_1000074286 146
106 3300005364 Ga0070673_100007601 Ga0070673_1000076015 146
107 3300005364 Ga0070673_100040011 Ga0070673_1000400116 146
108 3300005364 Ga0070673_100405584 Ga0070673_1004055843 146
109 3300005365 Ga0070688_100207246 Ga0070688_1002072462 146
110 3300005366 Ga0070659_100011923 Ga0070659_1000119234 146
111 3300005366 Ga0070659_100069696 Ga0070659_1000696962 146
112 3300005366 Ga0070659_100366747 Ga0070659_1003667473 146
113 3300005367 Ga0070667_100001536 Ga0070667_10000153617 146
114 3300005367 Ga0070667_100003165 Ga0070667_1000031658 146
115 3300005367 Ga0070667_100007076 Ga0070667_1000070768 146
116 3300005367 Ga0070667_100008296 Ga0070667_1000082963 146
117 3300005367 Ga0070667_100012023 Ga0070667_1000120237 146
118 3300005367 Ga0070667_100018727 Ga0070667_1000187274 146
119 3300005367 Ga0070667_100060546 Ga0070667_1000605463 146
120 3300005367 Ga0070667_100306389 Ga0070667_1003063893 146
121 3300005367 Ga0070667_101198628 Ga0070667_1011986282 146
122 3300005440 Ga0070705_100389785 Ga0070705_1003897851 146
123 3300005455 Ga0070663_100770920 Ga0070663_1007709201 146
124 3300005456 Ga0070678_100040855 Ga0070678_1000408552 146
125 3300005457 Ga0070662_100001246 Ga0070662_1000012466 146
126 3300005457 Ga0070662_100001439 Ga0070662_10000143914 146
127 3300005459 Ga0068867_100154687 Ga0068867_1001546874 146
128 3300005535 Ga0070684_100989450 Ga0070684_1009894502 146
129 3300005539 Ga0068853_100004667 Ga0068853_10000466713 146
130 3300005539 Ga0068853_100067399 Ga0068853_1000673994 146
131 3300005539 Ga0068853_100431661 Ga0068853_1004316613 146
132 3300005543 Ga0070672_100001644 Ga0070672_10000164410 146
133 3300005544 Ga0070686_100008017 Ga0070686_1000080173 146
134 3300005547 Ga0070693_100273675 Ga0070693_1002736753 146
135 3300005548 Ga0070665_100002886 Ga0070665_10000288620 146
136 3300005548 Ga0070665_101005447 Ga0070665_1010054472 146
137 3300005564 Ga0070664_100004638 Ga0070664_10000463810 146
138 3300005564 Ga0070664_100024252 Ga0070664_1000242522 146
139 3300005564 Ga0070664_100055243 Ga0070664_1000552433 146
140 3300005564 Ga0070664_100126489 Ga0070664_1001264892 146
141 3300005564 Ga0070664_100277295 Ga0070664_1002772952 146
142 3300005577 Ga0068857_100010833 Ga0068857_1000108337 146
143 3300005577 Ga0068857_100047147 Ga0068857_1000471472 146
144 3300005578 Ga0068854_100056441 Ga0068854_1000564411 146
145 3300005578 Ga0068854_100406344 Ga0068854_1004063443 146
146 3300005616 Ga0068852_100001072 Ga0068852_1000010727 146
147 3300005616 Ga0068852_100266476 Ga0068852_1002664762 146
148 3300005616 Ga0068852_100391942 Ga0068852_1003919422 146
149 3300005616 Ga0068852_100530991 Ga0068852_1005309913 146
150 3300005617 Ga0068859_100000377 Ga0068859_10000037715 146
151 3300005617 Ga0068859_100016908 Ga0068859_10001690810 146
152 3300005617 Ga0068859_100099693 Ga0068859_1000996932 146
153 3300005617 Ga0068859_100157669 Ga0068859_1001576692 146
154 3300005617 Ga0068859_100960594 Ga0068859_1009605942 146
155 3300005618 Ga0068864_100000074 Ga0068864_10000007464 146
156 3300005618 Ga0068864_100006328 Ga0068864_1000063287 146
157 3300005618 Ga0068864_100008279 Ga0068864_1000082795 146
158 3300005618 Ga0068864_100071812 Ga0068864_1000718124 146
159 3300005618 Ga0068864_100112080 Ga0068864_1001120804 146
160 3300005719 Ga0068861_100409769 Ga0068861_1004097692 146
161 3300005834 Ga0068851_10090118 Ga0068851_100901182 146
162 3300005834 Ga0068851_10292740 Ga0068851_102927402 146
163 3300005841 Ga0068863_100000887 Ga0068863_10000088725 146
164 3300005841 Ga0068863_100007439 Ga0068863_1000074396 146
165 3300005841 Ga0068863_100007887 Ga0068863_1000078878 146
166 3300005841 Ga0068863_100714491 Ga0068863_1007144912 146
167 3300005842 Ga0068858_100003534 Ga0068858_1000035349 146
168 3300005842 Ga0068858_100003796 Ga0068858_10000379610 146
169 3300005842 Ga0068858_100008153 Ga0068858_1000081536 146
170 3300005842 Ga0068858_100178461 Ga0068858_1001784612 146
171 3300005842 Ga0068858_100203941 Ga0068858_1002039413 146
172 3300005843 Ga0068860_100001585 Ga0068860_10000158518 146
173 3300005843 Ga0068860_100008637 Ga0068860_10000863713 146
174 3300005843 Ga0068860_100114405 Ga0068860_1001144052 146
175 3300005843 Ga0068860_100117583 Ga0068860_1001175833 146
176 3300005844 Ga0068862_100043504 Ga0068862_1000435044 146
177 3300005844 Ga0068862_100131235 Ga0068862_1001312352 146
178 3300005844 Ga0068862_100369060 Ga0068862_1003690602 146
179 3300006237 Ga0097621_100005924 Ga0097621_1000059244 146
180 3300006237 Ga0097621_100146324 Ga0097621_1001463243 146
181 3300006358 Ga0068871_100234764 Ga0068871_1002347642 146
182 3300006358 Ga0068871_100308670 Ga0068871_1003086702 146
183 3300006881 Ga0068865_100214151 Ga0068865_1002141512 146
184 3300006881 Ga0068865_100706214 Ga0068865_1007062142 146
185 3300006931 Ga0097620_100000377 Ga0097620_10000037715 146
186 3300006931 Ga0097620_100016909 Ga0097620_10001690910 146
187 3300006931 Ga0097620_100099689 Ga0097620_1000996896 146
188 3300006931 Ga0097620_100157660 Ga0097620_1001576602 146
189 3300006931 Ga0097620_100960564 Ga0097620_1009605642 146
190 3300009011 Ga0105251_10122200 Ga0105251_101222002 146
191 3300009093 Ga0105240_10300764 Ga0105240_103007642 146
192 3300009098 Ga0105245_10002347 Ga0105245_100023476 146
193 3300009148 Ga0105243_10411516 Ga0105243_104115161 146
194 3300009148 Ga0105243_10708098 Ga0105243_107080982 146
195 3300009174 Ga0105241_10043853 Ga0105241_100438533 146
196 3300009176 Ga0105242_10493663 Ga0105242_104936632 146
197 3300009176 Ga0105242_12032593 Ga0105242_120325932 146
198 3300009177 Ga0105248_10000071 Ga0105248_100000719 146
199 3300009177 Ga0105248_10000268 Ga0105248_1000026823 146
200 3300009177 Ga0105248_10002245 Ga0105248_1000224515 146
201 3300009177 Ga0105248_10003138 Ga0105248_1000313818 146
202 3300009177 Ga0105248_10020222 Ga0105248_100202227 146
203 3300009551 Ga0105238_10623051 Ga0105238_106230513 146
204 3300009553 Ga0105249_10196393 Ga0105249_101963934 146
205 3300010375 Ga0105239_10137250 Ga0105239_101372502 146
206 3300012508 Ga0157315_1051510 Ga0157315_10515101 146
207 3300013100 Ga0157373_10079845 Ga0157373_100798452 146
208 3300013102 Ga0157371_10000867 Ga0157371_1000086720 146
209 3300013102 Ga0157371_10292786 Ga0157371_102927862 146
210 3300013104 Ga0157370_10666620 Ga0157370_106666202 146
211 3300013296 Ga0157374_10065892 Ga0157374_100658924 146
212 3300013296 Ga0157374_10072915 Ga0157374_100729154 146
213 3300013297 Ga0157378_10150614 Ga0157378_101506143 146
214 3300013297 Ga0157378_10166858 Ga0157378_101668583 146
215 3300013306 Ga0163162_10421611 Ga0163162_104216113 146
216 3300013306 Ga0163162_10524248 Ga0163162_105242483 146
217 3300013306 Ga0163162_10667118 Ga0163162_106671183 146
218 3300013306 Ga0163162_10691809 Ga0163162_106918092 146
219 3300013306 Ga0163162_10795134 Ga0163162_107951342 146
220 3300013308 Ga0157375_10104424 Ga0157375_101044242 146
221 3300013308 Ga0157375_10133983 Ga0157375_101339832 146
222 3300013308 Ga0157375_10499304 Ga0157375_104993042 146
223 3300013308 Ga0157375_10655380 Ga0157375_106553802 146
224 3300014325 Ga0163163_10000219 Ga0163163_100002194 146
225 3300014325 Ga0163163_10032124 Ga0163163_100321242 146
226 3300014326 Ga0157380_11598218 Ga0157380_115982182 146
227 3300014968 Ga0157379_10001730 Ga0157379_1000173014 146
228 3300014968 Ga0157379_11334728 Ga0157379_113347281 146
229 3300014968 Ga0157379_11565274 Ga0157379_115652742 146
230 3300017792 Ga0163161_10094721 Ga0163161_100947212 146
231 3300025315 Ga0207697_10133848 Ga0207697_101338481 146
232 3300025321 Ga0207656_10080598 Ga0207656_100805982 146
233 3300025321 Ga0207656_10259336 Ga0207656_102593362 146
234 3300025903 Ga0207680_10074654 Ga0207680_100746543 146
235 3300025903 Ga0207680_10357290 Ga0207680_103572902 146
236 3300025903 Ga0207680_10446184 Ga0207680_104461842 146
237 3300025904 Ga0207647_10002939 Ga0207647_100029397 146
238 3300025904 Ga0207647_10020274 Ga0207647_100202742 146
239 3300025907 Ga0207645_10004867 Ga0207645_100048672 146
240 3300025909 Ga0207705_10046559 Ga0207705_100465592 146
241 3300025909 Ga0207705_10062537 Ga0207705_100625372 146
242 3300025911 Ga0207654_10033771 Ga0207654_100337712 146
243 3300025919 Ga0207657_10014072 Ga0207657_100140726 146
244 3300025920 Ga0207649_10036981 Ga0207649_100369812 146
245 3300025920 Ga0207649_10042888 Ga0207649_100428883 146
246 3300025925 Ga0207650_10028803 Ga0207650_100288036 146
247 3300025925 Ga0207650_10200526 Ga0207650_102005264 146
248 3300025925 Ga0207650_10258436 Ga0207650_102584362 146
249 3300025925 Ga0207650_10465970 Ga0207650_104659701 146
250 3300025926 Ga0207659_10168394 Ga0207659_101683942 146
251 3300025926 Ga0207659_10293770 Ga0207659_102937703 146
252 3300025927 Ga0207687_10027837 Ga0207687_100278372 146
253 3300025931 Ga0207644_10001850 Ga0207644_100018502 146
254 3300025931 Ga0207644_10014933 Ga0207644_100149334 146
255 3300025931 Ga0207644_10160822 Ga0207644_101608222 146
256 3300025932 Ga0207690_10149356 Ga0207690_101493563 146
257 3300025932 Ga0207690_10293706 Ga0207690_102937061 146
258 3300025932 Ga0207690_10406543 Ga0207690_104065433 146
259 3300025933 Ga0207706_10002227 Ga0207706_100022276 146
260 3300025933 Ga0207706_10004069 Ga0207706_100040698 146
261 3300025933 Ga0207706_10039836 Ga0207706_100398366 146
262 3300025933 Ga0207706_10338918 Ga0207706_103389183 146
263 3300025933 Ga0207706_10495613 Ga0207706_104956132 146
264 3300025934 Ga0207686_10469579 Ga0207686_104695792 146
265 3300025935 Ga0207709_10336050 Ga0207709_103360503 146
266 3300025936 Ga0207670_10085406 Ga0207670_100854064 146
267 3300025936 Ga0207670_10087665 Ga0207670_100876652 146
268 3300025936 Ga0207670_10821504 Ga0207670_108215043 146
269 3300025937 Ga0207669_10024485 Ga0207669_100244852 146
270 3300025938 Ga0207704_10014745 Ga0207704_100147455 146
271 3300025938 Ga0207704_10385835 Ga0207704_103858352 146
272 3300025940 Ga0207691_10001285 Ga0207691_1000128510 146
273 3300025941 Ga0207711_10000333 Ga0207711_1000033347 146
274 3300025941 Ga0207711_10000450 Ga0207711_1000045022 146
275 3300025941 Ga0207711_10000999 Ga0207711_1000099914 146
276 3300025941 Ga0207711_10001758 Ga0207711_1000175810 146
277 3300025941 Ga0207711_10037411 Ga0207711_100374112 146
278 3300025942 Ga0207689_10363956 Ga0207689_103639563 146
279 3300025945 Ga0207679_10321886 Ga0207679_103218862 146
280 3300025945 Ga0207679_10485651 Ga0207679_104856512 146
281 3300025960 Ga0207651_10004576 Ga0207651_100045766 146
282 3300025960 Ga0207651_10013579 Ga0207651_100135792 146
283 3300025960 Ga0207651_10069150 Ga0207651_100691502 146
284 3300025960 Ga0207651_10137652 Ga0207651_101376523 146
285 3300025961 Ga0207712_10155406 Ga0207712_101554062 146
286 3300025961 Ga0207712_10622951 Ga0207712_106229512 146
287 3300025972 Ga0207668_10255571 Ga0207668_102555712 146
288 3300025972 Ga0207668_10732742 Ga0207668_107327421 146
289 3300025972 Ga0207668_11894195 Ga0207668_118941952 146
290 3300025981 Ga0207640_10011746 Ga0207640_100117462 146
291 3300025981 Ga0207640_10414502 Ga0207640_104145022 146
292 3300025986 Ga0207658_10000634 Ga0207658_1000063421 146
293 3300025986 Ga0207658_10004146 Ga0207658_1000414611 146
294 3300025986 Ga0207658_10013250 Ga0207658_100132502 146
295 3300025986 Ga0207658_10021255 Ga0207658_100212554 146
296 3300025986 Ga0207658_10043370 Ga0207658_100433702 146
297 3300025986 Ga0207658_10120327 Ga0207658_101203272 146
298 3300025986 Ga0207658_10182504 Ga0207658_101825043 146
299 3300025986 Ga0207658_10190620 Ga0207658_101906202 146
300 3300025986 Ga0207658_10749669 Ga0207658_107496692 146
301 3300026023 Ga0207677_10000665 Ga0207677_100006658 146
302 3300026023 Ga0207677_10039450 Ga0207677_100394502 146
303 3300026023 Ga0207677_11539490 Ga0207677_115394902 146
304 3300026035 Ga0207703_10002818 Ga0207703_1000281810 146
305 3300026035 Ga0207703_10011564 Ga0207703_1001156410 146
306 3300026035 Ga0207703_10138144 Ga0207703_101381442 146
307 3300026035 Ga0207703_10900027 Ga0207703_109000272 146
308 3300026041 Ga0207639_10011224 Ga0207639_100112249 146
309 3300026067 Ga0207678_10007626 Ga0207678_100076265 146
310 3300026067 Ga0207678_10684427 Ga0207678_106844272 146
311 3300026088 Ga0207641_10000188 Ga0207641_1000018852 146
312 3300026088 Ga0207641_10063317 Ga0207641_100633172 146
313 3300026089 Ga0207648_10019688 Ga0207648_100196886 146
314 3300026095 Ga0207676_10000438 Ga0207676_100004386 146
315 3300026095 Ga0207676_10031484 Ga0207676_100314842 146
316 3300026095 Ga0207676_10199326 Ga0207676_101993262 146
317 3300026095 Ga0207676_10367353 Ga0207676_103673533 146
318 3300026095 Ga0207676_11054992 Ga0207676_110549922 146
319 3300026116 Ga0207674_10003595 Ga0207674_100035956 146
320 3300026116 Ga0207674_10028779 Ga0207674_100287794 146
321 3300026121 Ga0207683_10009090 Ga0207683_100090908 146
322 3300026121 Ga0207683_10394365 Ga0207683_103943652 146
323 3300026142 Ga0207698_10007920 Ga0207698_1000792010 146
324 3300026142 Ga0207698_10033317 Ga0207698_100333172 146
325 3300026142 Ga0207698_10095945 Ga0207698_100959452 146
326 3300028379 Ga0268266_10049998 Ga0268266_100499983 146
327 3300028379 Ga0268266_11413458 Ga0268266_114134582 146
328 3300028380 Ga0268265_10088734 Ga0268265_100887342 146
329 3300028380 Ga0268265_10108107 Ga0268265_101081074 146
330 3300028380 Ga0268265_10373472 Ga0268265_103734723 146
331 3300028380 Ga0268265_11462575 Ga0268265_114625752 146
332 3300028381 Ga0268264_10001006 Ga0268264_1000100614 146
333 3300028381 Ga0268264_10045042 Ga0268264_100450422 146
334 3300028381 Ga0268264_10787235 Ga0268264_107872352 146
335 3300028381 Ga0268264_11034695 Ga0268264_110346952 146
336 3300030731 Ga0316177_1138970 Ga0316177_11389701 146
337 3300030733 Ga0314311_1097860 Ga0314311_10978601 146
338 3300030735 Ga0316178_1006155 Ga0316178_10061552 146
339 3300030742 Ga0316183_1064884 Ga0316183_10648842 146
340 3300030745 Ga0316182_1085336 Ga0316182_10853362 146
341 3300031548 Ga0307408_101036375 Ga0307408_1010363753 146
342 3300031824 Ga0307413_10229273 Ga0307413_102292733 146
343 3300031903 Ga0307407_10168670 Ga0307407_101686703 146
344 3300031903 Ga0307407_10639436 Ga0307407_106394362 146
345 3300031911 Ga0307412_10205116 Ga0307412_102051162 146
346 3300031995 Ga0307409_100044437 Ga0307409_1000444373 146
347 3300031995 Ga0307409_100618780 Ga0307409_1006187803 146
348 3300031995 Ga0307409_101474150 Ga0307409_1014741502 146
349 3300032002 Ga0307416_100446649 Ga0307416_1004466492 146
350 3300032002 Ga0307416_100949346 Ga0307416_1009493463 146
351 3300032005 Ga0307411_10197689 Ga0307411_101976893 146
352 3300032005 Ga0307411_10668027 Ga0307411_106680272 146
353 3300037312 Ga0395899_0331177 Ga0395899_0331177_339_779 146
354 3300037418 Ga0395900_0052306 Ga0395900_0052306_14_454 146
355 3300037418 Ga0395900_0066666 Ga0395900_0066666_1391_1831 146
356 3300037418 Ga0395900_0098924 Ga0395900_0098924_362_802 146
357 3300037418 Ga0395900_0281003 Ga0395900_0281003_487_927 146
358 3300037466 Ga0395898_0305478 Ga0395898_0305478_175_615 146
359 3300037466 Ga0395898_1840270 Ga0395898_1840270_69_509 146
360 3300037471 Ga0395905_0044209 Ga0395905_0044209_969_1409 146
361 3300037471 Ga0395905_0047505 Ga0395905_0047505_594_1034 146
362 3300037471 Ga0395905_0237537 Ga0395905_0237537_65_505 146
363 3300037471 Ga0395905_0327304 Ga0395905_0327304_53_493 146
364 3300038443 Ga0395901_0289185 Ga0395901_0289185_296_736 146
365 3300038443 Ga0395901_0567351 Ga0395901_0567351_41_481 146
366 3300045976 Ga0466967_0327207 Ga0466967_0327207_848_1288 146
367 3300046616 Ga0495668_0006757 Ga0495668_0006757_662_1102 146
368 3300046674 Ga0495588_0372527 Ga0495588_0372527_48_488 146
369 3300046684 Ga0495669_0065399 Ga0495669_0065399_708_1148 146
370 3300047323 Ga0495683_0181188 Ga0495683_0181188_351_791 146
371 3300048904 Ga0496101_0041000 Ga0496101_0041000_958_1398 146
372 3300048905 Ga0496102_0104521 Ga0496102_0104521_1318_1758 146
373 3300048910 Ga0496107_0361330 Ga0496107_0361330_53_493 146
374 3300048911 Ga0496108_0020259 Ga0496108_0020259_1703_2143 146
375 3300048911 Ga0496108_1142395 Ga0496108_1142395_67_507 146
376 3300048912 Ga0496109_1120647 Ga0496109_1120647_218_658 146
377 3300048913 Ga0496110_0209380 Ga0496110_0209380_1178_1618 146
378 3300048914 Ga0496111_0025608 Ga0496111_0025608_3378_3818 146
379 3300048914 Ga0496111_0727214 Ga0496111_0727214_102_542 146
380 3300048915 Ga0496112_0119331 Ga0496112_0119331_925_1365 146
381 3300048915 Ga0496112_1570162 Ga0496112_1570162_105_545 146
382 3300048917 Ga0496114_0009772 Ga0496114_0009772_594_1034 146
383 3300049585 Ga0501069_0243225 Ga0501069_0243225_403_843 146
384 3300049764 Ga0501267_028848 Ga0501267_028848_190_630 146
385 3300053134 Ga0500658_0000963 Ga0500658_0000963_3736_4176 146
386 3300005719 Ga0068861_100413864 Ga0068861_1004138642 147
387 3300013100 Ga0157373_10078699 Ga0157373_100786992 147
388 3300025907 Ga0207645_10044351 Ga0207645_100443511 147
389 3300026041 Ga0207639_10407396 Ga0207639_104073963 147
390 3300026067 Ga0207678_10026409 Ga0207678_100264094 147
391 3300026118 Ga0207675_100130020 Ga0207675_1001300202 147
392 3300032005 Ga0307411_11107251 Ga0307411_111072512 147
393 3300005293 Ga0065715_10195841 Ga0065715_101958412 148
394 3300017792 Ga0163161_10823597 Ga0163161_108235973 148
395 3300025923 Ga0207681_10235535 Ga0207681_102355353 148
396 3300028380 Ga0268265_11785801 Ga0268265_117858012 148
397 3300031548 Ga0307408_100058079 Ga0307408_1000580793 148
398 3300031824 Ga0307413_10017016 Ga0307413_100170164 148
399 3300031824 Ga0307413_10619106 Ga0307413_106191063 148
400 3300031852 Ga0307410_10363554 Ga0307410_103635542 148
401 3300031852 Ga0307410_10369189 Ga0307410_103691893 148
402 3300031852 Ga0307410_10386284 Ga0307410_103862842 148
403 3300031852 Ga0307410_10820975 Ga0307410_108209751 148
404 3300031901 Ga0307406_10071050 Ga0307406_100710502 148
405 3300031901 Ga0307406_11185744 Ga0307406_111857442 148
406 3300031903 Ga0307407_10157079 Ga0307407_101570793 148
407 3300031903 Ga0307407_10350330 Ga0307407_103503302 148
408 3300031911 Ga0307412_10003002 Ga0307412_100030028 148
409 3300031911 Ga0307412_10137325 Ga0307412_101373252 148
410 3300031995 Ga0307409_100215190 Ga0307409_1002151903 148
411 3300031995 Ga0307409_100416053 Ga0307409_1004160533 148
412 3300032002 Ga0307416_100412015 Ga0307416_1004120152 148
413 3300032002 Ga0307416_101340356 Ga0307416_1013403562 148
414 3300032004 Ga0307414_10127738 Ga0307414_101277384 148
415 3300032004 Ga0307414_10248733 Ga0307414_102487333 148
416 3300032005 Ga0307411_10000438 Ga0307411_1000043812 148
417 3300032005 Ga0307411_10626872 Ga0307411_106268723 148
418 3300032005 Ga0307411_10958501 Ga0307411_109585012 148
419 3300032126 Ga0307415_100071842 Ga0307415_1000718424 148
420 3300032126 Ga0307415_100351760 Ga0307415_1003517602 148
421 3300049665 Ga0501227_088768 Ga0501227_088768_149_595 148
422 3300049672 Ga0501239_037656 Ga0501239_037656_103_549 148
423 2162886012 MBSR1b_contig_9705856 MBSR1b_0417.00006860 149
424 3300005327 Ga0070658_10087145 Ga0070658_100871451 149
425 3300005327 Ga0070658_11057996 Ga0070658_110579961 149
426 3300005331 Ga0070670_100000600 Ga0070670_10000060025 149
427 3300005331 Ga0070670_100261891 Ga0070670_1002618912 149
428 3300005333 Ga0070677_10000735 Ga0070677_100007352 149
429 3300005335 Ga0070666_10049326 Ga0070666_100493262 149
430 3300005339 Ga0070660_100150517 Ga0070660_1001505173 149
431 3300005344 Ga0070661_100024235 Ga0070661_1000242356 149
432 3300005345 Ga0070692_10210669 Ga0070692_102106692 149
433 3300005347 Ga0070668_100252244 Ga0070668_1002522443 149
434 3300005347 Ga0070668_100365151 Ga0070668_1003651511 149
435 3300005353 Ga0070669_100046775 Ga0070669_1000467756 149
436 3300005354 Ga0070675_100007982 Ga0070675_10000798212 149
437 3300005354 Ga0070675_100009299 Ga0070675_1000092999 149
438 3300005355 Ga0070671_100000190 Ga0070671_10000019024 149
439 3300005356 Ga0070674_100082966 Ga0070674_1000829662 149
440 3300005356 Ga0070674_101168194 Ga0070674_1011681942 149
441 3300005364 Ga0070673_100005750 Ga0070673_1000057503 149
442 3300005366 Ga0070659_100016545 Ga0070659_1000165457 149
443 3300005366 Ga0070659_100062773 Ga0070659_1000627732 149
444 3300005367 Ga0070667_100116502 Ga0070667_1001165022 149
445 3300005455 Ga0070663_100063708 Ga0070663_1000637082 149
446 3300005456 Ga0070678_100165462 Ga0070678_1001654623 149
447 3300005457 Ga0070662_100003210 Ga0070662_1000032102 149
448 3300005457 Ga0070662_100007707 Ga0070662_1000077079 149
449 3300005457 Ga0070662_100018517 Ga0070662_1000185173 149
450 3300005466 Ga0070685_10759879 Ga0070685_107598791 149
451 3300005543 Ga0070672_100012803 Ga0070672_1000128032 149
452 3300005543 Ga0070672_100097586 Ga0070672_1000975864 149
453 3300005563 Ga0068855_100451650 Ga0068855_1004516503 149
454 3300005563 Ga0068855_100572682 Ga0068855_1005726823 149
455 3300005563 Ga0068855_100642406 Ga0068855_1006424063 149
456 3300005563 Ga0068855_100903964 Ga0068855_1009039642 149
457 3300005577 Ga0068857_100208455 Ga0068857_1002084552 149
458 3300005578 Ga0068854_100000334 Ga0068854_10000033412 149
459 3300005578 Ga0068854_100020970 Ga0068854_1000209704 149
460 3300005616 Ga0068852_100028203 Ga0068852_1000282037 149
461 3300009093 Ga0105240_10008099 Ga0105240_100080999 149
462 3300009093 Ga0105240_10098562 Ga0105240_100985622 149
463 3300009093 Ga0105240_10267544 Ga0105240_102675442 149
464 3300009174 Ga0105241_10631779 Ga0105241_106317792 149
465 3300009177 Ga0105248_10003624 Ga0105248_100036248 149
466 3300009177 Ga0105248_11071219 Ga0105248_110712192 149
467 3300009551 Ga0105238_10112662 Ga0105238_101126622 149
468 3300013100 Ga0157373_10102090 Ga0157373_101020902 149
469 3300013100 Ga0157373_10187149 Ga0157373_101871493 149
470 3300013102 Ga0157371_10033139 Ga0157371_100331392 149
471 3300013102 Ga0157371_10131647 Ga0157371_101316471 149
472 3300013104 Ga0157370_10034625 Ga0157370_100346253 149
473 3300013105 Ga0157369_10000298 Ga0157369_1000029859 149
474 3300013105 Ga0157369_10014983 Ga0157369_100149837 149
475 3300013105 Ga0157369_10117618 Ga0157369_101176182 149
476 3300013296 Ga0157374_10343064 Ga0157374_103430642 149
477 3300013297 Ga0157378_10642401 Ga0157378_106424012 149
478 3300013307 Ga0157372_10146967 Ga0157372_101469672 149
479 3300013307 Ga0157372_10189843 Ga0157372_101898432 149
480 3300025893 Ga0207682_10002976 Ga0207682_100029762 149
481 3300025901 Ga0207688_10119830 Ga0207688_101198302 149
482 3300025904 Ga0207647_10026341 Ga0207647_100263418 149
483 3300025904 Ga0207647_10046968 Ga0207647_100469682 149
484 3300025904 Ga0207647_10150032 Ga0207647_101500321 149
485 3300025909 Ga0207705_10000070 Ga0207705_1000007086 149
486 3300025909 Ga0207705_10148670 Ga0207705_101486703 149
487 3300025913 Ga0207695_10011780 Ga0207695_100117807 149
488 3300025913 Ga0207695_10015034 Ga0207695_100150343 149
489 3300025913 Ga0207695_10082120 Ga0207695_100821202 149
490 3300025919 Ga0207657_10030981 Ga0207657_100309813 149
491 3300025920 Ga0207649_10000816 Ga0207649_100008169 149
492 3300025920 Ga0207649_10042328 Ga0207649_100423282 149
493 3300025923 Ga0207681_10038332 Ga0207681_100383322 149
494 3300025923 Ga0207681_10046614 Ga0207681_100466142 149
495 3300025924 Ga0207694_10036679 Ga0207694_100366794 149
496 3300025925 Ga0207650_10027429 Ga0207650_100274294 149
497 3300025925 Ga0207650_10268366 Ga0207650_102683662 149
498 3300025926 Ga0207659_10006496 Ga0207659_100064964 149
499 3300025926 Ga0207659_10622559 Ga0207659_106225593 149
500 3300025931 Ga0207644_10012706 Ga0207644_100127068 149
501 3300025932 Ga0207690_10016994 Ga0207690_100169946 149
502 3300025933 Ga0207706_10027529 Ga0207706_100275296 149
503 3300025933 Ga0207706_10027660 Ga0207706_100276604 149
504 3300025933 Ga0207706_10034743 Ga0207706_100347432 149
505 3300025937 Ga0207669_10638982 Ga0207669_106389821 149
506 3300025940 Ga0207691_10048439 Ga0207691_100484392 149
507 3300025941 Ga0207711_10019305 Ga0207711_100193052 149
508 3300025945 Ga0207679_10184968 Ga0207679_101849684 149
509 3300025949 Ga0207667_10162795 Ga0207667_101627952 149
510 3300025949 Ga0207667_10277377 Ga0207667_102773772 149
511 3300025949 Ga0207667_10281897 Ga0207667_102818972 149
512 3300025949 Ga0207667_10475364 Ga0207667_104753643 149
513 3300025960 Ga0207651_10085712 Ga0207651_100857122 149
514 3300025972 Ga0207668_10409508 Ga0207668_104095082 149
515 3300025981 Ga0207640_10000344 Ga0207640_1000034422 149
516 3300025981 Ga0207640_10006924 Ga0207640_100069242 149
517 3300025981 Ga0207640_10666003 Ga0207640_106660033 149
518 3300025986 Ga0207658_10141709 Ga0207658_101417093 149
519 3300026067 Ga0207678_10068571 Ga0207678_100685716 149
520 3300026067 Ga0207678_10199758 Ga0207678_101997584 149
521 3300026078 Ga0207702_10016214 Ga0207702_100162146 149
522 3300026078 Ga0207702_10083918 Ga0207702_100839184 149
523 3300026095 Ga0207676_10012470 Ga0207676_100124702 149
524 3300026095 Ga0207676_10423006 Ga0207676_104230062 149
525 3300026121 Ga0207683_10195975 Ga0207683_101959753 149
526 3300026142 Ga0207698_10029979 Ga0207698_100299792 149
527 3300026142 Ga0207698_10718713 Ga0207698_107187133 149
528 3300028379 Ga0268266_10205249 Ga0268266_102052493 149
529 3300031731 Ga0307405_10046226 Ga0307405_100462262 149
530 3300031731 Ga0307405_10153746 Ga0307405_101537464 149
531 3300031731 Ga0307405_10817250 Ga0307405_108172501 149
532 3300031731 Ga0307405_11170535 Ga0307405_111705351 149
533 3300031824 Ga0307413_10003858 Ga0307413_100038587 149
534 3300031824 Ga0307413_10072983 Ga0307413_100729832 149
535 3300031824 Ga0307413_10183499 Ga0307413_101834992 149
536 3300031824 Ga0307413_10784119 Ga0307413_107841193 149
537 3300031824 Ga0307413_11799995 Ga0307413_117999951 149
538 3300031852 Ga0307410_10002293 Ga0307410_100022939 149
539 3300031852 Ga0307410_10002603 Ga0307410_1000260311 149
540 3300031852 Ga0307410_10006803 Ga0307410_100068036 149
541 3300031852 Ga0307410_10243625 Ga0307410_102436253 149
542 3300031852 Ga0307410_10419542 Ga0307410_104195423 149
543 3300031852 Ga0307410_11024028 Ga0307410_110240281 149
544 3300031901 Ga0307406_10056479 Ga0307406_100564793 149
545 3300031903 Ga0307407_10003942 Ga0307407_100039425 149
546 3300031903 Ga0307407_10047567 Ga0307407_100475673 149
547 3300031903 Ga0307407_10091571 Ga0307407_100915714 149
548 3300031911 Ga0307412_10109903 Ga0307412_101099032 149
549 3300031911 Ga0307412_10327603 Ga0307412_103276032 149
550 3300031911 Ga0307412_10766321 Ga0307412_107663212 149
551 3300031911 Ga0307412_10784467 Ga0307412_107844672 149
552 3300031995 Ga0307409_100011689 Ga0307409_1000116893 149
553 3300031995 Ga0307409_100014063 Ga0307409_1000140635 149
554 3300031995 Ga0307409_100051090 Ga0307409_1000510903 149
555 3300031995 Ga0307409_100118636 Ga0307409_1001186363 149
556 3300031995 Ga0307409_100170889 Ga0307409_1001708892 149
557 3300031995 Ga0307409_100209557 Ga0307409_1002095573 149
558 3300032002 Ga0307416_100001561 Ga0307416_1000015619 149
559 3300032002 Ga0307416_100028750 Ga0307416_1000287506 149
560 3300032002 Ga0307416_100047549 Ga0307416_1000475496 149
561 3300032002 Ga0307416_100066775 Ga0307416_1000667754 149
562 3300032002 Ga0307416_100097629 Ga0307416_1000976292 149
563 3300032002 Ga0307416_100717627 Ga0307416_1007176272 149
564 3300032002 Ga0307416_101811205 Ga0307416_1018112051 149
565 3300032004 Ga0307414_10003633 Ga0307414_100036338 149
566 3300032004 Ga0307414_10032939 Ga0307414_100329396 149
567 3300032004 Ga0307414_10132221 Ga0307414_101322212 149
568 3300032004 Ga0307414_10512465 Ga0307414_105124652 149
569 3300032005 Ga0307411_10007089 Ga0307411_100070893 149
570 3300032005 Ga0307411_10007464 Ga0307411_100074642 149
571 3300032005 Ga0307411_10084978 Ga0307411_100849782 149
572 3300032005 Ga0307411_10396596 Ga0307411_103965963 149
573 3300032005 Ga0307411_10474978 Ga0307411_104749782 149
574 3300032005 Ga0307411_10576952 Ga0307411_105769522 149
575 3300032005 Ga0307411_11414380 Ga0307411_114143802 149
576 3300032126 Ga0307415_100002360 Ga0307415_1000023605 149
577 3300032126 Ga0307415_100208059 Ga0307415_1002080593 149
578 3300032126 Ga0307415_100249727 Ga0307415_1002497273 149
579 3300037312 Ga0395899_0017106 Ga0395899_0017106_2067_2516 149
580 3300037418 Ga0395900_0017641 Ga0395900_0017641_4258_4707 149
581 3300037418 Ga0395900_0156051 Ga0395900_0156051_1015_1464 149
582 3300037418 Ga0395900_0959463 Ga0395900_0959463_32_481 149
583 3300037466 Ga0395898_0025005 Ga0395898_0025005_1903_2352 149
584 3300037466 Ga0395898_0178403 Ga0395898_0178403_390_839 149
585 3300037466 Ga0395898_0841369 Ga0395898_0841369_48_497 149
586 3300038443 Ga0395901_0011159 Ga0395901_0011159_6738_7187 149
587 3300042007 Ga0439449_0098457 Ga0439449_0098457_102_551 149
588 3300044694 Ga0466963_0045087 Ga0466963_0045087_1156_1605 149
589 3300044706 Ga0466964_0057432 Ga0466964_0057432_894_1343 149
590 3300045976 Ga0466967_0514041 Ga0466967_0514041_622_1071 149
591 3300046684 Ga0495669_0035507 Ga0495669_0035507_1699_2148 149
592 3300048911 Ga0496108_0047621 Ga0496108_0047621_620_1069 149
593 3300048913 Ga0496110_0006432 Ga0496110_0006432_2042_2491 149
594 3300048914 Ga0496111_0274078 Ga0496111_0274078_349_798 149
595 3300049587 Ga0501071_0700513 Ga0501071_0700513_213_662 149
596 3300049765 Ga0501268_122161 Ga0501268_122161_77_526 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

3

142

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8933 37 125
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.841 49 124
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.8226 34 136
6t8h-assembly1.cif.gz_A cryo-em structure of the dna-bound pold-pcna processive complex from p. abyssi 0.8097 36 121
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.7949 54 126
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8933 37 125 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.841 49 124 2.40.50.140
1sr3A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8226 34 136 2.40.50.140
af_Q2FY46_5_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8217 54 122 2.40.50.140
af_K7VHZ3_96_226_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8095 32 133 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5W4VQ91-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9462 32 123 GO:0005886
GO:0017004
GO:0020037
AF-A0A1F4BIV1-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9168 4 127 GO:0005886
GO:0017004
GO:0020037
AF-A0A1F4BIV1-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9031 4 127 GO:0005886
GO:0017004
GO:0020037
AF-A0A520RT28-F1-model_v4 Cytochrome c maturation protein CcmE 0.8984 55 132 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A2E5PIS8-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.891 18 127 GO:0005886
GO:0017004
GO:0020037

Feature Viewer

pLDDT pTM Quality
80.48 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map