F467571

General Info

Members Datasets Scaffolds Average Seq Length
596 263 596 215

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100008102|Ga0307408_1000081028
Length 250
Sequence VTPHDHAGLAPDESLDAVAPTAPALRDGDVDGGGAMPRDRASAGIVPALDPATRRLIRLSAVICAASEAAIREAMADATDGIDPVWVEELILQSYLFAGFPRALNAMREWRRISGRRAPPADEDARAESQAALWRERGERTCAVVYGPFYDALRHNIRDLHPALDAWMIVDGYGKVLARAGLDLRRRELCVVGACAAARQDRQLHSHLHGALHAGATPAEVADALHVVEDLAGPDDARRYRQLLARVVGK

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
242 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
243 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.52
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10029355 3300001990 Bacteria 1725
2 JGI24750J21931_1003346 3300002070 Bacteria 1919
3 Ga0065707_10210518 3300005295 Bacteria 1268
4 Ga0070658_10023333 3300005327 Bacteria 4967
5 Ga0070658_10056809 3300005327 Bacteria 3182
6 Ga0070658_10380678 3300005327 Bacteria 1210
7 Ga0070658_10653978 3300005327 Bacteria 912
8 Ga0070676_10008120 3300005328 Bacteria 5647
9 Ga0070676_10081692 3300005328 Bacteria 1962
10 Ga0070676_10093313 3300005328 Bacteria 1848
11 Ga0070683_100000681 3300005329 Bacteria 24634
12 Ga0070683_100010079 3300005329 Bacteria 8106
13 Ga0070683_100022880 3300005329 Bacteria 5589
14 Ga0070683_100041535 3300005329 Bacteria 4231
15 Ga0070683_100179991 3300005329 Bacteria 2006
16 Ga0070683_100336243 3300005329 Bacteria 1438
17 Ga0070670_100171030 3300005331 Bacteria 1884
18 Ga0070670_100188933 3300005331 Bacteria 1789
19 Ga0070670_100290336 3300005331 Bacteria 1429
20 Ga0070670_100479235 3300005331 Bacteria 1105
21 Ga0068869_100000336 3300005334 Bacteria 25057
22 Ga0068869_100003185 3300005334 Bacteria 10023
23 Ga0068869_100997942 3300005334 Unclassified 729
24 Ga0070666_10113294 3300005335 Bacteria 1876
25 Ga0070666_10357363 3300005335 Bacteria 1046
26 Ga0070680_100000247 3300005336 Bacteria 35633
27 Ga0070680_100016663 3300005336 Bacteria 5787
28 Ga0070680_100050750 3300005336 Bacteria 3384
29 Ga0070680_100073293 3300005336 Bacteria 2815
30 Ga0070682_100006710 3300005337 Bacteria 6454
31 Ga0070682_100295135 3300005337 Bacteria 1187
32 Ga0068868_100037170 3300005338 Bacteria 3774
33 Ga0068868_100054291 3300005338 Bacteria 3157
34 Ga0070660_100025284 3300005339 Bacteria 4412
35 Ga0070660_100126897 3300005339 Bacteria 2039
36 Ga0070689_100003792 3300005340 Bacteria 10123
37 Ga0070689_100009066 3300005340 Bacteria 7042
38 Ga0070689_100542484 3300005340 Bacteria 1001
39 Ga0070687_100009043 3300005343 Bacteria 4249
40 Ga0070661_100005547 3300005344 Bacteria 8699
41 Ga0070661_100007742 3300005344 Bacteria 7417
42 Ga0070661_100065231 3300005344 Bacteria 2675
43 Ga0070661_100066085 3300005344 Bacteria 2657
44 Ga0070661_100117045 3300005344 Bacteria 1994
45 Ga0070692_10006391 3300005345 Bacteria 5116
46 Ga0070668_100004050 3300005347 Bacteria 10850
47 Ga0070669_100002374 3300005353 Bacteria 13618
48 Ga0070669_100017185 3300005353 Bacteria 5161
49 Ga0070669_100024551 3300005353 Bacteria 4322
50 Ga0070669_100189645 3300005353 Bacteria 1612
51 Ga0070675_100000547 3300005354 Bacteria 25799
52 Ga0070675_100010741 3300005354 Bacteria 7162
53 Ga0070675_100011278 3300005354 Bacteria 6996
54 Ga0070675_100032429 3300005354 Bacteria 4228
55 Ga0070671_100007736 3300005355 Bacteria 8584
56 Ga0070674_100072016 3300005356 Bacteria 2446
57 Ga0070674_100535292 3300005356 Unclassified 981
58 Ga0070673_100016912 3300005364 Bacteria 5172
59 Ga0070673_100029330 3300005364 Bacteria 4102
60 Ga0070673_100064374 3300005364 Bacteria 2921
61 Ga0070673_100322686 3300005364 Bacteria 1364
62 Ga0070688_100010739 3300005365 Bacteria 5059
63 Ga0070688_100026534 3300005365 Bacteria 3443
64 Ga0070659_100006929 3300005366 Bacteria 8206
65 Ga0070659_100225117 3300005366 Bacteria 1549
66 Ga0070667_100004361 3300005367 Bacteria 11938
67 Ga0070667_100024900 3300005367 Bacteria 4971
68 Ga0070667_100273902 3300005367 Bacteria 1514
69 Ga0070667_100414056 3300005367 Bacteria 1228
70 Ga0070709_10203843 3300005434 Unclassified 1402
71 Ga0070714_100073555 3300005435 Bacteria 2961
72 Ga0070701_10223408 3300005438 Bacteria 1124
73 Ga0070711_100817716 3300005439 Bacteria 791
74 Ga0070700_100101883 3300005441 Bacteria 1893
75 Ga0070694_100092001 3300005444 Bacteria 2130
76 Ga0070694_100127279 3300005444 Bacteria 1835
77 Ga0070678_100368950 3300005456 Bacteria 1239
78 Ga0070662_100010640 3300005457 Bacteria 6049
79 Ga0070662_100079870 3300005457 Bacteria 2434
80 Ga0070662_100135797 3300005457 Bacteria 1902
81 Ga0070681_10009028 3300005458 Bacteria 9800
82 Ga0070681_10150059 3300005458 Bacteria 2258
83 Ga0070681_10324247 3300005458 Bacteria 1450
84 Ga0068867_100019037 3300005459 Bacteria 4888
85 Ga0068867_100042966 3300005459 Bacteria 3308
86 Ga0068867_100143437 3300005459 Bacteria 1869
87 Ga0068867_100265492 3300005459 Bacteria 1401
88 Ga0070698_100099851 3300005471 Bacteria 2875
89 Ga0070699_100115930 3300005518 Bacteria 2354
90 Ga0070699_100200961 3300005518 Unclassified 1772
91 Ga0070679_100045506 3300005530 Bacteria 4373
92 Ga0070679_100092366 3300005530 Bacteria 3014
93 Ga0070679_100163588 3300005530 Bacteria 2199
94 Ga0070679_100189309 3300005530 Bacteria 2027
95 Ga0070679_100285648 3300005530 Bacteria 1602
96 Ga0070679_100469149 3300005530 Bacteria 1203
97 Ga0070684_100004716 3300005535 Bacteria 10413
98 Ga0070684_100006298 3300005535 Bacteria 9169
99 Ga0070684_100010020 3300005535 Bacteria 7492
100 Ga0070684_100012054 3300005535 Bacteria 6911
101 Ga0070684_100146696 3300005535 Bacteria 2136
102 Ga0070684_100319602 3300005535 Bacteria 1426
103 Ga0070684_100336089 3300005535 Unclassified 1388
104 Ga0070697_100448262 3300005536 Bacteria 1124
105 Ga0068853_100008061 3300005539 Bacteria 8448
106 Ga0068853_100024434 3300005539 Bacteria 5066
107 Ga0068853_100590022 3300005539 Bacteria 1055
108 Ga0070672_100029789 3300005543 Bacteria 4096
109 Ga0070672_100071261 3300005543 Bacteria 2764
110 Ga0070672_100098231 3300005543 Bacteria 2371
111 Ga0070672_100103354 3300005543 Bacteria 2314
112 Ga0070672_100228072 3300005543 Bacteria 1564
113 Ga0070672_100558084 3300005543 Bacteria 995
114 Ga0070686_100642005 3300005544 Bacteria 841
115 Ga0070686_100763456 3300005544 Unclassified 776
116 Ga0070695_100035292 3300005545 Bacteria 3141
117 Ga0070693_100030580 3300005547 Bacteria 2944
118 Ga0070665_100181608 3300005548 Bacteria 2105
119 Ga0068855_100059280 3300005563 Bacteria 4479
120 Ga0068855_100087932 3300005563 Bacteria 3590
121 Ga0068855_100294924 3300005563 Unclassified 1797
122 Ga0068855_100333925 3300005563 Bacteria 1673
123 Ga0070664_100005450 3300005564 Bacteria 10216
124 Ga0070664_100010643 3300005564 Bacteria 7453
125 Ga0070664_100013631 3300005564 Bacteria 6625
126 Ga0070664_100033122 3300005564 Bacteria 4325
127 Ga0070664_100100588 3300005564 Unclassified 2513
128 Ga0070664_100127605 3300005564 Bacteria 2232
129 Ga0070664_100271366 3300005564 Bacteria 1528
130 Ga0070664_100543652 3300005564 Unclassified 1074
131 Ga0068857_100003188 3300005577 Bacteria 13600
132 Ga0068857_100012828 3300005577 Bacteria 7302
133 Ga0068857_100027471 3300005577 Bacteria 5020
134 Ga0068857_100030916 3300005577 Bacteria 4731
135 Ga0068857_100078648 3300005577 Bacteria 2944
136 Ga0068854_100075120 3300005578 Bacteria 2481
137 Ga0068854_100584085 3300005578 Bacteria 952
138 Ga0068854_101185395 3300005578 Bacteria 684
139 Ga0068856_100004404 3300005614 Bacteria 14032
140 Ga0068856_100097012 3300005614 Bacteria 2937
141 Ga0068856_100143304 3300005614 Bacteria 2397
142 Ga0068856_100856444 3300005614 Unclassified 928
143 Ga0070702_100003041 3300005615 Bacteria 7420
144 Ga0070702_100157770 3300005615 Bacteria 1463
145 Ga0068852_100006303 3300005616 Bacteria 8560
146 Ga0068852_100026250 3300005616 Bacteria 4732
147 Ga0068852_100050273 3300005616 Bacteria 3571
148 Ga0068852_100055451 3300005616 Bacteria 3421
149 Ga0068852_100192660 3300005616 Bacteria 1924
150 Ga0068852_100720371 3300005616 Bacteria 1009
151 Ga0068859_100040566 3300005617 Bacteria 4672
152 Ga0068859_100132524 3300005617 Bacteria 2564
153 Ga0068859_100182395 3300005617 Bacteria 2182
154 Ga0068864_100029675 3300005618 Bacteria 4634
155 Ga0068861_100014363 3300005719 Bacteria 5557
156 Ga0068861_100031208 3300005719 Bacteria 3912
157 Ga0068861_100523339 3300005719 Bacteria 1076
158 Ga0068861_100740408 3300005719 Bacteria 917
159 Ga0068851_10003188 3300005834 Bacteria 7275
160 Ga0068870_10012379 3300005840 Bacteria 3986
161 Ga0068870_10094352 3300005840 Bacteria 1679
162 Ga0068863_100013838 3300005841 Bacteria 7776
163 Ga0068863_100178298 3300005841 Bacteria 2039
164 Ga0068863_100875417 3300005841 Bacteria 898
165 Ga0068858_100012176 3300005842 Bacteria 8110
166 Ga0068858_100082269 3300005842 Bacteria 2992
167 Ga0068858_100086564 3300005842 Bacteria 2914
168 Ga0068858_100117492 3300005842 Bacteria 2486
169 Ga0068860_100006907 3300005843 Bacteria 11382
170 Ga0068860_100014614 3300005843 Bacteria 7682
171 Ga0068860_100166983 3300005843 Bacteria 2125
172 Ga0068862_100008006 3300005844 Bacteria 8745
173 Ga0081455_10028128 3300005937 Bacteria 5139
174 Ga0081539_10012248 3300005985 Bacteria 6648
175 Ga0097621_100012625 3300006237 Bacteria 6269
176 Ga0068871_100020170 3300006358 Bacteria 5102
177 Ga0068871_100753928 3300006358 Unclassified 895
178 Ga0075428_100160807 3300006844 Bacteria 2438
179 Ga0075428_100209060 3300006844 Bacteria 2109
180 Ga0075428_100418508 3300006844 Bacteria 1436
181 Ga0075430_100016806 3300006846 Bacteria 6231
182 Ga0075430_100024856 3300006846 Bacteria 5095
183 Ga0075430_100039628 3300006846 Bacteria 3988
184 Ga0075430_100058837 3300006846 Bacteria 3231
185 Ga0075431_100031621 3300006847 Bacteria 5450
186 Ga0075431_100061920 3300006847 Bacteria 3861
187 Ga0075431_100115542 3300006847 Unclassified 2770
188 Ga0075431_100131271 3300006847 Bacteria 2583
189 Ga0075431_100264535 3300006847 Bacteria 1745
190 Ga0075431_100276052 3300006847 Bacteria 1702
191 Ga0075433_10013303 3300006852 Bacteria 6686
192 Ga0075434_100008741 3300006871 Bacteria 9423
193 Ga0075434_100365309 3300006871 Bacteria 1464
194 Ga0075429_100031032 3300006880 Unclassified 4644
195 Ga0075429_100064042 3300006880 Bacteria 3202
196 Ga0075429_100124743 3300006880 Bacteria 2252
197 Ga0068865_100009369 3300006881 Bacteria 6068
198 Ga0068865_100123076 3300006881 Bacteria 1932
199 Ga0068865_100283830 3300006881 Bacteria 1319
200 Ga0097620_100040566 3300006931 Bacteria 4672
201 Ga0097620_100132517 3300006931 Bacteria 2564
202 Ga0097620_100182391 3300006931 Bacteria 2182
203 Ga0075435_100337712 3300007076 Bacteria 1291
204 Ga0105240_10008178 3300009093 Bacteria 15002
205 Ga0105240_10289202 3300009093 Bacteria 1880
206 Ga0111539_10034268 3300009094 Bacteria 6159
207 Ga0111539_10112864 3300009094 Bacteria 3188
208 Ga0111539_10216851 3300009094 Bacteria 2229
209 Ga0111539_10264150 3300009094 Bacteria 2003
210 Ga0105245_10004762 3300009098 Bacteria 11978
211 Ga0105245_10028583 3300009098 Bacteria 4920
212 Ga0105245_10114634 3300009098 Bacteria 2510
213 Ga0114129_10039108 3300009147 Bacteria 6688
214 Ga0114129_10544237 3300009147 Unclassified 1511
215 Ga0105243_10048333 3300009148 Bacteria 3353
216 Ga0105241_10003558 3300009174 Bacteria 11587
217 Ga0105242_10016201 3300009176 Bacteria 5792
218 Ga0105242_10277538 3300009176 Bacteria 1521
219 Ga0105248_10015710 3300009177 Bacteria 8344
220 Ga0105248_10016255 3300009177 Bacteria 8190
221 Ga0105248_10047581 3300009177 Bacteria 4810
222 Ga0105248_10082569 3300009177 Bacteria 3614
223 Ga0105248_10142839 3300009177 Bacteria 2700
224 Ga0105248_10315860 3300009177 Bacteria 1760
225 Ga0105237_10638173 3300009545 Bacteria 1072
226 Ga0105238_10111041 3300009551 Bacteria 2722
227 Ga0105238_10353815 3300009551 Bacteria 1458
228 Ga0105238_10542294 3300009551 Bacteria 1167
229 Ga0105249_10000401 3300009553 Bacteria 41704
230 Ga0105249_10025142 3300009553 Bacteria 5359
231 Ga0105249_10501733 3300009553 Bacteria 1259
232 Ga0105239_10012515 3300010375 Bacteria 9450
233 Ga0105239_10025212 3300010375 Bacteria 6548
234 Ga0105246_10000533 3300011119 Bacteria 20789
235 Ga0105246_10625396 3300011119 Bacteria 934
236 Ga0157373_10044476 3300013100 Bacteria 3170
237 Ga0157373_10309231 3300013100 Bacteria 1123
238 Ga0157373_10398658 3300013100 Bacteria 986
239 Ga0157371_10020222 3300013102 Bacteria 4900
240 Ga0157370_10011107 3300013104 Bacteria 9441
241 Ga0157370_10036679 3300013104 Bacteria 4756
242 Ga0157370_10075470 3300013104 Bacteria 3178
243 Ga0157370_10315934 3300013104 Bacteria 1441
244 Ga0157369_10017079 3300013105 Bacteria 8154
245 Ga0157369_10100386 3300013105 Bacteria 3085
246 Ga0157369_10202695 3300013105 Bacteria 2082
247 Ga0157369_10231304 3300013105 Bacteria 1933
248 Ga0157374_10046567 3300013296 Bacteria 4017
249 Ga0157374_10376654 3300013296 Bacteria 1413
250 Ga0163162_10006251 3300013306 Bacteria 11547
251 Ga0163162_10093767 3300013306 Bacteria 3088
252 Ga0163162_10376346 3300013306 Bacteria 1553
253 Ga0157372_10012289 3300013307 Bacteria 9122
254 Ga0157372_10018962 3300013307 Bacteria 7404
255 Ga0157372_10021746 3300013307 Bacteria 6933
256 Ga0157372_10036682 3300013307 Bacteria 5404
257 Ga0157372_10290894 3300013307 Bacteria 1900
258 Ga0157372_10458506 3300013307 Bacteria 1486
259 Ga0157372_10765478 3300013307 Bacteria 1122
260 Ga0157375_10007703 3300013308 Bacteria 9424
261 Ga0157375_10155663 3300013308 Bacteria 2424
262 Ga0157375_10162094 3300013308 Bacteria 2378
263 Ga0157375_10537380 3300013308 Bacteria 1331
264 Ga0157375_10891209 3300013308 Unclassified 1034
265 Ga0163163_10050780 3300014325 Bacteria 4086
266 Ga0163163_10199473 3300014325 Bacteria 2049
267 Ga0163163_10399946 3300014325 Bacteria 1432
268 Ga0157380_10002943 3300014326 Bacteria 11579
269 Ga0157380_10159520 3300014326 Bacteria 1959
270 Ga0157380_10383867 3300014326 Bacteria 1327
271 Ga0157377_10001214 3300014745 Bacteria 10986
272 Ga0157379_10002779 3300014968 Bacteria 14754
273 Ga0157379_10460801 3300014968 Bacteria 1175
274 Ga0157376_10021797 3300014969 Bacteria 4980
275 Ga0157376_11253349 3300014969 Bacteria 771
276 Ga0163161_10061252 3300017792 Bacteria 2739
277 Ga0163161_10587099 3300017792 Bacteria 917
278 Ga0206356_11452365 3300020070 Unclassified 1204
279 Ga0206353_10829339 3300020082 Bacteria 3091
280 Ga0207697_10004114 3300025315 Bacteria 7023
281 Ga0207656_10008725 3300025321 Bacteria 3744
282 Ga0207682_10022945 3300025893 Bacteria 2462
283 Ga0207688_10008758 3300025901 Bacteria 5505
284 Ga0207680_10145851 3300025903 Bacteria 1573
285 Ga0207680_10324758 3300025903 Bacteria 1077
286 Ga0207647_10091023 3300025904 Bacteria 1819
287 Ga0207645_10000246 3300025907 Bacteria 44995
288 Ga0207645_10046076 3300025907 Bacteria 2786
289 Ga0207645_10399763 3300025907 Bacteria 924
290 Ga0207643_10005735 3300025908 Bacteria 6635
291 Ga0207705_10008483 3300025909 Bacteria 7499
292 Ga0207705_10027463 3300025909 Bacteria 4058
293 Ga0207705_10337446 3300025909 Bacteria 1160
294 Ga0207705_10510233 3300025909 Bacteria 934
295 Ga0207654_10006351 3300025911 Bacteria 5943
296 Ga0207707_10008044 3300025912 Bacteria 9158
297 Ga0207707_10034532 3300025912 Bacteria 4425
298 Ga0207707_10264225 3300025912 Bacteria 1492
299 Ga0207707_10609740 3300025912 Bacteria 923
300 Ga0207695_10015068 3300025913 Bacteria 9120
301 Ga0207695_10049287 3300025913 Bacteria 4442
302 Ga0207695_10055931 3300025913 Bacteria 4109
303 Ga0207695_10202071 3300025913 Bacteria 1901
304 Ga0207695_10494519 3300025913 Bacteria 1105
305 Ga0207671_10725906 3300025914 Unclassified 790
306 Ga0207660_10000019 3300025917 Bacteria 74841
307 Ga0207660_10193439 3300025917 Bacteria 1585
308 Ga0207662_10001341 3300025918 Bacteria 11871
309 Ga0207657_10035139 3300025919 Bacteria 4498
310 Ga0207657_10047429 3300025919 Bacteria 3756
311 Ga0207649_10001792 3300025920 Bacteria 12287
312 Ga0207649_10141668 3300025920 Bacteria 1646
313 Ga0207649_10404344 3300025920 Bacteria 1022
314 Ga0207652_10040959 3300025921 Bacteria 3936
315 Ga0207652_10052768 3300025921 Bacteria 3491
316 Ga0207652_10069352 3300025921 Bacteria 3061
317 Ga0207652_10393495 3300025921 Unclassified 1251
318 Ga0207652_10502895 3300025921 Bacteria 1091
319 Ga0207681_10004605 3300025923 Bacteria 8482
320 Ga0207681_10010274 3300025923 Bacteria 5729
321 Ga0207694_10048137 3300025924 Bacteria 3298
322 Ga0207650_10028491 3300025925 Bacteria 4005
323 Ga0207659_10008740 3300025926 Bacteria 6306
324 Ga0207659_10030744 3300025926 Bacteria 3672
325 Ga0207659_10093133 3300025926 Bacteria 2254
326 Ga0207687_10004209 3300025927 Bacteria 9624
327 Ga0207664_10019391 3300025929 Bacteria 5026
328 Ga0207690_10224469 3300025932 Bacteria 1439
329 Ga0207690_10566392 3300025932 Bacteria 925
330 Ga0207706_10000357 3300025933 Bacteria 49369
331 Ga0207706_10004509 3300025933 Bacteria 13079
332 Ga0207686_10041324 3300025934 Bacteria 2810
333 Ga0207669_10166423 3300025937 Bacteria 1564
334 Ga0207669_10212592 3300025937 Unclassified 1413
335 Ga0207669_10533466 3300025937 Bacteria 944
336 Ga0207704_10011553 3300025938 Bacteria 4351
337 Ga0207704_10093293 3300025938 Bacteria 1984
338 Ga0207704_10454829 3300025938 Bacteria 1023
339 Ga0207691_10001314 3300025940 Bacteria 24795
340 Ga0207691_10001355 3300025940 Bacteria 24425
341 Ga0207691_10002440 3300025940 Bacteria 18181
342 Ga0207691_10017747 3300025940 Bacteria 6747
343 Ga0207691_10023156 3300025940 Bacteria 5848
344 Ga0207691_10114299 3300025940 Bacteria 2398
345 Ga0207711_10012482 3300025941 Bacteria 7060
346 Ga0207711_10188200 3300025941 Bacteria 1880
347 Ga0207711_10377280 3300025941 Unclassified 1315
348 Ga0207711_10402317 3300025941 Bacteria 1272
349 Ga0207689_10000838 3300025942 Bacteria 29648
350 Ga0207689_10001360 3300025942 Bacteria 23476
351 Ga0207661_10002707 3300025944 Bacteria 12194
352 Ga0207661_10012163 3300025944 Bacteria 6249
353 Ga0207661_10016359 3300025944 Bacteria 5471
354 Ga0207661_10221446 3300025944 Bacteria 1673
355 Ga0207661_10450574 3300025944 Bacteria 1172
356 Ga0207661_10559334 3300025944 Unclassified 1048
357 Ga0207679_10001293 3300025945 Bacteria 15800
358 Ga0207679_10073037 3300025945 Bacteria 2594
359 Ga0207679_10089529 3300025945 Unclassified 2376
360 Ga0207679_10098064 3300025945 Bacteria 2284
361 Ga0207679_10214924 3300025945 Bacteria 1615
362 Ga0207679_10910136 3300025945 Unclassified 805
363 Ga0207667_10067852 3300025949 Bacteria 3715
364 Ga0207667_10247351 3300025949 Bacteria 1824
365 Ga0207667_10647948 3300025949 Bacteria 1062
366 Ga0207651_10013040 3300025960 Bacteria 4736
367 Ga0207651_10221656 3300025960 Bacteria 1529
368 Ga0207651_10255050 3300025960 Bacteria 1437
369 Ga0207712_10004798 3300025961 Bacteria 8542
370 Ga0207712_10294845 3300025961 Bacteria 1329
371 Ga0207668_10030244 3300025972 Bacteria 3557
372 Ga0207668_10100358 3300025972 Bacteria 2149
373 Ga0207668_10163630 3300025972 Unclassified 1737
374 Ga0207668_10237780 3300025972 Bacteria 1472
375 Ga0207668_10784366 3300025972 Bacteria 842
376 Ga0207640_10018594 3300025981 Bacteria 4087
377 Ga0207640_10350857 3300025981 Bacteria 1185
378 Ga0207658_10019166 3300025986 Bacteria 4731
379 Ga0207658_10294159 3300025986 Bacteria 1397
380 Ga0207658_10635455 3300025986 Unclassified 961
381 Ga0207677_10034060 3300026023 Bacteria 3294
382 Ga0207703_10005549 3300026035 Bacteria 10126
383 Ga0207703_10086685 3300026035 Bacteria 2623
384 Ga0207703_10130373 3300026035 Bacteria 2170
385 Ga0207639_10103518 3300026041 Bacteria 2306
386 Ga0207639_10286049 3300026041 Bacteria 1452
387 Ga0207639_10553318 3300026041 Bacteria 1057
388 Ga0207678_10052781 3300026067 Bacteria 3505
389 Ga0207708_10052601 3300026075 Bacteria 3102
390 Ga0207708_10129045 3300026075 Bacteria 1975
391 Ga0207702_10008970 3300026078 Bacteria 8426
392 Ga0207702_10111929 3300026078 Bacteria 2429
393 Ga0207702_10149450 3300026078 Bacteria 2123
394 Ga0207641_10015530 3300026088 Bacteria 6240
395 Ga0207641_10023335 3300026088 Bacteria 5098
396 Ga0207641_10120792 3300026088 Bacteria 2338
397 Ga0207648_10043640 3300026089 Bacteria 3935
398 Ga0207648_10048053 3300026089 Bacteria 3738
399 Ga0207648_10127878 3300026089 Bacteria 2235
400 Ga0207676_10006741 3300026095 Bacteria 8128
401 Ga0207676_10013795 3300026095 Bacteria 5802
402 Ga0207676_11255112 3300026095 Bacteria 735
403 Ga0207674_10001189 3300026116 Bacteria 33857
404 Ga0207674_10005220 3300026116 Bacteria 15462
405 Ga0207674_10012363 3300026116 Bacteria 9541
406 Ga0207674_10020068 3300026116 Bacteria 7229
407 Ga0207674_10084809 3300026116 Bacteria 3165
408 Ga0207675_100000320 3300026118 Bacteria 45668
409 Ga0207675_100024660 3300026118 Bacteria 5592
410 Ga0207698_10038232 3300026142 Bacteria 3544
411 Ga0207698_10052960 3300026142 Bacteria 3112
412 Ga0207698_10268896 3300026142 Bacteria 1570
413 Ga0207698_10298593 3300026142 Bacteria 1498
414 Ga0207428_10092971 3300027907 Bacteria 2340
415 Ga0207428_10197484 3300027907 Bacteria 1514
416 Ga0268266_10065062 3300028379 Bacteria 3152
417 Ga0268266_10303356 3300028379 Bacteria 1490
418 Ga0268266_10990145 3300028379 Bacteria 814
419 Ga0268265_10002328 3300028380 Bacteria 14426
420 Ga0268265_10002878 3300028380 Bacteria 12639
421 Ga0268264_10007527 3300028381 Bacteria 9085
422 Ga0268264_10037773 3300028381 Bacteria 3983
423 Ga0307408_100008102 3300031548 Bacteria 6946
424 Ga0307408_100187332 3300031548 Bacteria 1664
425 Ga0307405_10002563 3300031731 Bacteria 8065
426 Ga0307405_10006095 3300031731 Bacteria 5898
427 Ga0307405_10011026 3300031731 Bacteria 4715
428 Ga0307405_10020285 3300031731 Bacteria 3711
429 Ga0307405_10198154 3300031731 Bacteria 1456
430 Ga0307413_10002839 3300031824 Bacteria 7147
431 Ga0307413_10029397 3300031824 Bacteria 3073
432 Ga0307413_10066930 3300031824 Bacteria 2244
433 Ga0307410_10005473 3300031852 Bacteria 6727
434 Ga0307410_10025754 3300031852 Bacteria 3694
435 Ga0307410_10480401 3300031852 Bacteria 1019
436 Ga0307410_10560084 3300031852 Bacteria 948
437 Ga0307406_10000997 3300031901 Bacteria 15702
438 Ga0307406_10003135 3300031901 Bacteria 8987
439 Ga0307406_10007929 3300031901 Bacteria 5912
440 Ga0307406_10190655 3300031901 Bacteria 1500
441 Ga0307406_10244351 3300031901 Bacteria 1348
442 Ga0307406_10297630 3300031901 Bacteria 1238
443 Ga0307407_10006846 3300031903 Bacteria 5110
444 Ga0307407_10037378 3300031903 Bacteria 2682
445 Ga0307412_10302608 3300031911 Bacteria 1265
446 Ga0307412_10482307 3300031911 Bacteria 1028
447 Ga0307412_10552150 3300031911 Bacteria 968
448 Ga0307409_100023265 3300031995 Bacteria 4289
449 Ga0307409_100038991 3300031995 Bacteria 3520
450 Ga0307409_100039847 3300031995 Bacteria 3490
451 Ga0307409_100115909 3300031995 Bacteria 2257
452 Ga0307409_100212235 3300031995 Bacteria 1740
453 Ga0307409_100422047 3300031995 Bacteria 1280
454 Ga0307416_100017933 3300032002 Bacteria 4971
455 Ga0307416_100018106 3300032002 Bacteria 4952
456 Ga0307416_100020574 3300032002 Bacteria 4712
457 Ga0307416_100079715 3300032002 Bacteria 2761
458 Ga0307416_100124611 3300032002 Bacteria 2305
459 Ga0307416_100334795 3300032002 Bacteria 1523
460 Ga0307416_100442581 3300032002 Unclassified 1350
461 Ga0307416_101117569 3300032002 Bacteria 893
462 Ga0307414_10004771 3300032004 Bacteria 7397
463 Ga0307414_10023255 3300032004 Bacteria 3927
464 Ga0307414_10041511 3300032004 Bacteria 3117
465 Ga0307411_10016870 3300032005 Bacteria 4142
466 Ga0307411_10017025 3300032005 Bacteria 4128
467 Ga0307411_10097853 3300032005 Bacteria 2066
468 Ga0307415_100004642 3300032126 Bacteria 7176
469 Ga0307415_100004895 3300032126 Bacteria 7035
470 Ga0307415_100010501 3300032126 Bacteria 5249
471 Ga0307415_100117207 3300032126 Bacteria 1988
472 Ga0307415_100238943 3300032126 Bacteria 1468
473 Ga0307415_100363626 3300032126 Bacteria 1223
474 Ga0373934_0009118 3300035086 Bacteria 3712
475 Ga0373923_0048579 3300035111 Bacteria 1772
476 Ga0373956_0010506 3300035119 Bacteria 3796
477 Ga0373957_0105396 3300035120 Unclassified 1132
478 Ga0373960_0059628 3300035121 Bacteria 1155
479 Ga0373924_0110981 3300035410 Unclassified 1185
480 Ga0373931_0004289 3300035691 Bacteria 6494
481 Ga0373931_0274986 3300035691 Bacteria 1032
482 Ga0373935_0259841 3300035692 Unclassified 1218
483 Ga0373933_0005918 3300035724 Bacteria 6654
484 Ga0373937_0009784 3300036401 Bacteria 8358
485 Ga0373937_0654475 3300036401 Bacteria 996
486 Ga0395899_0110016 3300037312 Bacteria 1982
487 Ga0395900_0066207 3300037418 Bacteria 3713
488 Ga0395898_0116174 3300037466 Bacteria 2564
489 Ga0395905_0006883 3300037471 Bacteria 11367
490 Ga0395905_0141882 3300037471 Bacteria 2260
491 Ga0395901_0103552 3300038443 Bacteria 2986
492 Ga0436365_0262337 3300039437 Bacteria 7273
493 Ga0436365_0614410 3300039437 Bacteria 1502
494 Ga0451807_0077717 3300041486 Bacteria 1283
495 Ga0439462_0060789 3300042015 Bacteria 1022
496 Ga0451577_0000016 3300042876 Bacteria 531002
497 Ga0451577_0029136 3300042876 Bacteria 4991
498 Ga0451577_0045506 3300042876 Bacteria 3928
499 Ga0451577_0121515 3300042876 Bacteria 2339
500 Ga0451577_0623837 3300042876 Unclassified 978
501 Ga0453684_0036233 3300044712 Bacteria 6801
502 Ga0453684_0918023 3300044712 Unclassified 936
503 Ga0451576_0106572 3300045051 Bacteria 2916
504 Ga0451576_0793667 3300045051 Unclassified 994
505 Ga0466967_0147298 3300045976 Bacteria 2197
506 Ga0466967_0244092 3300045976 Bacteria 1714
507 Ga0466967_0918418 3300045976 Bacteria 871
508 Ga0495592_0069656 3300046454 Bacteria 2564
509 Ga0495651_0001301 3300046462 Bacteria 19332
510 Ga0495653_0017208 3300046463 Bacteria 5878
511 Ga0495664_0067927 3300046477 Bacteria 2127
512 Ga0495608_0009500 3300046511 Bacteria 6795
513 Ga0495608_0225593 3300046511 Bacteria 1174
514 Ga0495618_0453374 3300046514 Unclassified 778
515 Ga0495628_0000494 3300046516 Bacteria 36135
516 Ga0495630_0265247 3300046517 Unclassified 1312
517 Ga0495652_0004653 3300046529 Bacteria 13086
518 Ga0495665_0429092 3300046531 Unclassified 669
519 Ga0495586_0610060 3300046535 Unclassified 630
520 Ga0495587_0000269 3300046536 Bacteria 37262
521 Ga0495645_0076410 3300046543 Bacteria 2409
522 Ga0495645_0467804 3300046543 Unclassified 793
523 Ga0495667_0090743 3300046559 Bacteria 1979
524 Ga0495635_0000200 3300046663 Bacteria 37911
525 Ga0495657_0001237 3300046675 Bacteria 22362
526 Ga0495599_0004010 3300046678 Bacteria 8674
527 Ga0495599_0229830 3300046678 Unclassified 1133
528 Ga0495623_0000156 3300046679 Bacteria 42279
529 Ga0495646_0139099 3300046680 Bacteria 1359
530 Ga0495613_0345732 3300046689 Unclassified 1022
531 Ga0495670_0038861 3300046691 Bacteria 2373
532 Ga0495600_0005770 3300046809 Bacteria 7477
533 Ga0495604_0345792 3300047317 Unclassified 989
534 Ga0495674_0004839 3300047319 Bacteria 12950
535 Ga0495680_0432590 3300047322 Unclassified 903
536 Ga0495675_0058505 3300047444 Bacteria 2444
537 Ga0495684_0028480 3300047471 Bacteria 4288
538 Ga0495602_0022321 3300048088 Bacteria 6198
539 Ga0496104_0827413 3300048907 Unclassified 832
540 Ga0496106_0208930 3300048909 Bacteria 1554
541 Ga0496107_0220874 3300048910 Bacteria 1410
542 Ga0496108_0020209 3300048911 Bacteria 5473
543 Ga0496108_0139525 3300048911 Bacteria 2088
544 Ga0496109_0031858 3300048912 Bacteria 4736
545 Ga0496112_0000196 3300048915 Bacteria 39516
546 Ga0496112_0088854 3300048915 Bacteria 3058
547 Ga0496113_0014762 3300048916 Bacteria 5343
548 Ga0496113_0203528 3300048916 Bacteria 1574
549 Ga0496114_0133646 3300048917 Bacteria 2144
550 Ga0496114_0308843 3300048917 Unclassified 1397
551 Ga0496115_0023520 3300048918 Bacteria 4781
552 Ga0496115_0128735 3300048918 Bacteria 2086
553 Ga0501032_0261876 3300049569 Bacteria 1121
554 Ga0501033_0026915 3300049570 Bacteria 4326
555 Ga0501034_0023281 3300049571 Bacteria 6311
556 Ga0501040_0085139 3300049576 Bacteria 2194
557 Ga0501042_0629947 3300049578 Unclassified 780
558 Ga0501046_0391768 3300049580 Bacteria 1004
559 Ga0501047_0030185 3300049581 Bacteria 5227
560 Ga0501076_0071229 3300049592 Bacteria 2781
561 Ga0501206_020164 3300049653 Unclassified 946
562 Ga0501233_065594 3300049668 Unclassified 910
563 Ga0501259_011575 3300049688 Bacteria 1461
564 Ga0501259_064161 3300049688 Unclassified 774
565 Ga0501079_0330498 3300049741 Unclassified 1194
566 Ga0501080_0102262 3300049742 Bacteria 2658
567 Ga0501080_0442693 3300049742 Unclassified 1166
568 Ga0501080_1112539 3300049742 Unclassified 682
569 Ga0501081_0412949 3300049743 Unclassified 1000
570 Ga0501035_0028174 3300049822 Bacteria 5127
571 Ga0501035_0879961 3300049822 Bacteria 711
572 Ga0501044_0042149 3300049823 Bacteria 4750
573 Ga0501045_0351037 3300049824 Bacteria 1098
574 nmdc:mga05p37_1508813_c1 3300050507 Unclassified 669
575 nmdc:mga05p37_272908_c1 3300050507 Bacteria 2020
576 nmdc:mga09592_137749_c1 3300050508 Bacteria 2103
577 nmdc:mga09592_33595_c1 3300050508 Unclassified 4283
578 nmdc:mga0qj67_39857_c1 3300050509 Bacteria 3690
579 nmdc:mga0qj67_422506_c1 3300050509 Bacteria 1075
580 nmdc:mga0qj67_71620_c1 3300050509 Bacteria 2767
581 nmdc:mga06r32_189904_c1 3300050510 Bacteria 2042
582 nmdc:mga06r32_321556_c1 3300050510 Bacteria 1533
583 nmdc:mga06r32_414762_c1 3300050510 Bacteria 1328
584 nmdc:mga06r32_92915_c1 3300050510 Bacteria 2950
585 nmdc:mga08y16_335477_c1 3300050511 Bacteria 1555
586 nmdc:mga08y16_66250_c1 3300050511 Bacteria 3769
587 nmdc:mga0n895_18729_c1 3300050512 Bacteria 6415
588 nmdc:mga0n895_342946_c1 3300050512 Bacteria 1513
589 nmdc:mga0rr50_553955_c1 3300050513 Unclassified 979
590 nmdc:mga08x19_44349_c1 3300050514 Bacteria 2839
591 nmdc:mga0a205_24539_c1 3300050515 Bacteria 5736
592 Ga0495601_0088017 3300053077 Bacteria 1997
593 Ga0495612_0074613 3300053078 Unclassified 1418
594 Ga0495595_0311602 3300053084 Unclassified 792
595 Ga0495619_0076356 3300053085 Bacteria 2249
596 Ga0590071_055781 3300059421 Unclassified 961

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046531 Ga0495665_0429092 Ga0495665_0429092_129_656 173
2 3300046535 Ga0495586_0610060 Ga0495586_0610060_82_609 173
3 3300046543 Ga0495645_0467804 Ga0495645_0467804_14_553 176
4 3300006847 Ga0075431_100276052 Ga0075431_1002760522 182
5 3300046678 Ga0495599_0229830 Ga0495599_0229830_196_846 185
6 3300031548 Ga0307408_100187332 Ga0307408_1001873321 187
7 3300031731 Ga0307405_10006095 Ga0307405_100060957 187
8 3300031824 Ga0307413_10029397 Ga0307413_100293972 187
9 3300031852 Ga0307410_10005473 Ga0307410_100054734 187
10 3300031901 Ga0307406_10003135 Ga0307406_100031358 187
11 3300031903 Ga0307407_10006846 Ga0307407_100068464 187
12 3300031911 Ga0307412_10482307 Ga0307412_104823072 187
13 3300031995 Ga0307409_100039847 Ga0307409_1000398473 187
14 3300032002 Ga0307416_100020574 Ga0307416_1000205743 187
15 3300032004 Ga0307414_10023255 Ga0307414_100232554 187
16 3300032005 Ga0307411_10097853 Ga0307411_100978532 187
17 3300032126 Ga0307415_100010501 Ga0307415_1000105014 187
18 3300005564 Ga0070664_100271366 Ga0070664_1002713662 190
19 3300049822 Ga0501035_0879961 Ga0501035_0879961_14_586 190
20 3300042876 Ga0451577_0029136 Ga0451577_0029136_3581_4243 193
21 3300042876 Ga0451577_0121515 Ga0451577_0121515_310_1065 193
22 3300044712 Ga0453684_0036233 Ga0453684_0036233_3797_4459 193
23 3300005518 Ga0070699_100115930 Ga0070699_1001159302 196
24 3300050510 nmdc:mga06r32_189904_c1 nmdc:mga06r32_189904_c1_14_637 197
25 3300042015 Ga0439462_0060789 Ga0439462_0060789_295_939 198
26 3300006846 Ga0075430_100024856 Ga0075430_1000248563 199
27 3300035691 Ga0373931_0004289 Ga0373931_0004289_5406_6005 199
28 3300045051 Ga0451576_0793667 Ga0451576_0793667_117_716 199
29 3300048911 Ga0496108_0139525 Ga0496108_0139525_1281_1880 199
30 3300048912 Ga0496109_0031858 Ga0496109_0031858_2891_3490 199
31 3300048915 Ga0496112_0000196 Ga0496112_0000196_12700_13299 199
32 3300050509 nmdc:mga0qj67_39857_c1 nmdc:mga0qj67_39857_c1_1874_2530 199
33 3300005937 Ga0081455_10028128 Ga0081455_100281285 200
34 3300006846 Ga0075430_100058837 Ga0075430_1000588373 200
35 3300006847 Ga0075431_100264535 Ga0075431_1002645352 200
36 3300050510 nmdc:mga06r32_92915_c1 nmdc:mga06r32_92915_c1_1090_1779 200
37 3300005530 Ga0070679_100285648 Ga0070679_1002856482 201
38 3300006846 Ga0075430_100016806 Ga0075430_1000168067 201
39 3300006847 Ga0075431_100031621 Ga0075431_1000316215 201
40 3300025921 Ga0207652_10393495 Ga0207652_103934952 201
41 3300005329 Ga0070683_100010079 Ga0070683_1000100793 202
42 3300005334 Ga0068869_100000336 Ga0068869_10000033625 202
43 3300005335 Ga0070666_10357363 Ga0070666_103573631 202
44 3300005336 Ga0070680_100016663 Ga0070680_1000166631 202
45 3300005337 Ga0070682_100006710 Ga0070682_1000067103 202
46 3300005338 Ga0068868_100054291 Ga0068868_1000542912 202
47 3300005339 Ga0070660_100126897 Ga0070660_1001268972 202
48 3300005344 Ga0070661_100007742 Ga0070661_1000077426 202
49 3300005345 Ga0070692_10006391 Ga0070692_100063913 202
50 3300005354 Ga0070675_100000547 Ga0070675_10000054711 202
51 3300005364 Ga0070673_100029330 Ga0070673_1000293302 202
52 3300005366 Ga0070659_100006929 Ga0070659_1000069294 202
53 3300005367 Ga0070667_100414056 Ga0070667_1004140562 202
54 3300005457 Ga0070662_100135797 Ga0070662_1001357972 202
55 3300005458 Ga0070681_10009028 Ga0070681_100090286 202
56 3300005530 Ga0070679_100045506 Ga0070679_1000455063 202
57 3300005535 Ga0070684_100010020 Ga0070684_1000100204 202
58 3300005544 Ga0070686_100642005 Ga0070686_1006420051 202
59 3300005545 Ga0070695_100035292 Ga0070695_1000352922 202
60 3300005547 Ga0070693_100030580 Ga0070693_1000305804 202
61 3300005564 Ga0070664_100005450 Ga0070664_1000054506 202
62 3300005577 Ga0068857_100003188 Ga0068857_1000031886 202
63 3300005614 Ga0068856_100004404 Ga0068856_10000440414 202
64 3300005615 Ga0070702_100003041 Ga0070702_1000030416 202
65 3300005616 Ga0068852_100026250 Ga0068852_1000262502 202
66 3300005616 Ga0068852_100050273 Ga0068852_1000502734 202
67 3300005617 Ga0068859_100040566 Ga0068859_1000405664 202
68 3300005618 Ga0068864_100029675 Ga0068864_1000296754 202
69 3300005841 Ga0068863_100013838 Ga0068863_1000138386 202
70 3300005842 Ga0068858_100117492 Ga0068858_1001174921 202
71 3300005843 Ga0068860_100006907 Ga0068860_1000069075 202
72 3300006237 Ga0097621_100012625 Ga0097621_1000126256 202
73 3300006358 Ga0068871_100020170 Ga0068871_1000201704 202
74 3300006931 Ga0097620_100040566 Ga0097620_1000405664 202
75 3300009098 Ga0105245_10004762 Ga0105245_100047629 202
76 3300009098 Ga0105245_10028583 Ga0105245_100285834 202
77 3300009174 Ga0105241_10003558 Ga0105241_100035585 202
78 3300009176 Ga0105242_10277538 Ga0105242_102775382 202
79 3300009177 Ga0105248_10015710 Ga0105248_100157103 202
80 3300009177 Ga0105248_10047581 Ga0105248_100475813 202
81 3300010375 Ga0105239_10012515 Ga0105239_100125156 202
82 3300011119 Ga0105246_10000533 Ga0105246_100005336 202
83 3300013100 Ga0157373_10044476 Ga0157373_100444763 202
84 3300013307 Ga0157372_10021746 Ga0157372_100217466 202
85 3300013308 Ga0157375_10007703 Ga0157375_100077039 202
86 3300014325 Ga0163163_10050780 Ga0163163_100507804 202
87 3300014745 Ga0157377_10001214 Ga0157377_100012144 202
88 3300014968 Ga0157379_10460801 Ga0157379_104608012 202
89 3300014969 Ga0157376_10021797 Ga0157376_100217972 202
90 3300025911 Ga0207654_10006351 Ga0207654_100063514 202
91 3300025912 Ga0207707_10008044 Ga0207707_100080445 202
92 3300025913 Ga0207695_10494519 Ga0207695_104945192 202
93 3300025920 Ga0207649_10001792 Ga0207649_1000179212 202
94 3300025921 Ga0207652_10052768 Ga0207652_100527682 202
95 3300025926 Ga0207659_10030744 Ga0207659_100307443 202
96 3300025927 Ga0207687_10004209 Ga0207687_100042096 202
97 3300025933 Ga0207706_10004509 Ga0207706_1000450910 202
98 3300025941 Ga0207711_10012482 Ga0207711_100124826 202
99 3300025942 Ga0207689_10000838 Ga0207689_1000083822 202
100 3300025944 Ga0207661_10002707 Ga0207661_1000270712 202
101 3300025945 Ga0207679_10098064 Ga0207679_100980643 202
102 3300025960 Ga0207651_10013040 Ga0207651_100130403 202
103 3300026023 Ga0207677_10034060 Ga0207677_100340604 202
104 3300026035 Ga0207703_10086685 Ga0207703_100866853 202
105 3300026078 Ga0207702_10008970 Ga0207702_100089709 202
106 3300026088 Ga0207641_10015530 Ga0207641_100155303 202
107 3300026095 Ga0207676_10006741 Ga0207676_100067418 202
108 3300026116 Ga0207674_10001189 Ga0207674_1000118933 202
109 3300026142 Ga0207698_10038232 Ga0207698_100382324 202
110 3300028381 Ga0268264_10007527 Ga0268264_100075275 202
111 3300005535 Ga0070684_100336089 Ga0070684_1003360892 203
112 3300005614 Ga0068856_100097012 Ga0068856_1000970121 203
113 3300005614 Ga0068856_100143304 Ga0068856_1001433043 203
114 3300005614 Ga0068856_100856444 Ga0068856_1008564441 203
115 3300013307 Ga0157372_10036682 Ga0157372_100366824 203
116 3300017792 Ga0163161_10587099 Ga0163161_105870992 203
117 3300025941 Ga0207711_10377280 Ga0207711_103772802 203
118 3300025986 Ga0207658_10294159 Ga0207658_102941592 203
119 3300026078 Ga0207702_10111929 Ga0207702_101119293 203
120 3300026078 Ga0207702_10149450 Ga0207702_101494502 203
121 3300026095 Ga0207676_10013795 Ga0207676_100137954 203
122 3300035691 Ga0373931_0274986 Ga0373931_0274986_165_815 203
123 3300036401 Ga0373937_0654475 Ga0373937_0654475_95_745 203
124 3300042876 Ga0451577_0000016 Ga0451577_0000016_359416_360066 203
125 3300042876 Ga0451577_0045506 Ga0451577_0045506_2846_3496 203
126 3300042876 Ga0451577_0623837 Ga0451577_0623837_143_793 203
127 3300044712 Ga0453684_0918023 Ga0453684_0918023_99_749 203
128 3300005329 Ga0070683_100336243 Ga0070683_1003362432 204
129 3300005336 Ga0070680_100000247 Ga0070680_1000002473 204
130 3300005337 Ga0070682_100295135 Ga0070682_1002951352 204
131 3300005434 Ga0070709_10203843 Ga0070709_102038431 204
132 3300005458 Ga0070681_10150059 Ga0070681_101500592 204
133 3300005458 Ga0070681_10324247 Ga0070681_103242472 204
134 3300005535 Ga0070684_100319602 Ga0070684_1003196022 204
135 3300005536 Ga0070697_100448262 Ga0070697_1004482622 204
136 3300009147 Ga0114129_10544237 Ga0114129_105442371 204
137 3300013100 Ga0157373_10309231 Ga0157373_103092311 204
138 3300013105 Ga0157369_10231304 Ga0157369_102313043 204
139 3300014325 Ga0163163_10399946 Ga0163163_103999462 204
140 3300025912 Ga0207707_10264225 Ga0207707_102642252 204
141 3300025913 Ga0207695_10055931 Ga0207695_100559312 204
142 3300025917 Ga0207660_10000019 Ga0207660_100000195 204
143 3300025944 Ga0207661_10221446 Ga0207661_102214462 204
144 3300039437 Ga0436365_0262337 Ga0436365_0262337_2185_2868 204
145 3300039437 Ga0436365_0614410 Ga0436365_0614410_70_702 204
146 3300046517 Ga0495630_0265247 Ga0495630_0265247_655_1287 204
147 3300048915 Ga0496112_0088854 Ga0496112_0088854_149_763 204
148 3300048916 Ga0496113_0014762 Ga0496113_0014762_3136_3750 204
149 3300049570 Ga0501033_0026915 Ga0501033_0026915_2211_2843 204
150 3300049571 Ga0501034_0023281 Ga0501034_0023281_171_803 204
151 3300049580 Ga0501046_0391768 Ga0501046_0391768_133_765 204
152 3300049581 Ga0501047_0030185 Ga0501047_0030185_2254_2886 204
153 3300049653 Ga0501206_020164 Ga0501206_020164_30_653 204
154 3300049668 Ga0501233_065594 Ga0501233_065594_272_895 204
155 3300049688 Ga0501259_064161 Ga0501259_064161_16_639 204
156 3300049742 Ga0501080_0102262 Ga0501080_0102262_1046_1678 204
157 3300049742 Ga0501080_1112539 Ga0501080_1112539_37_654 204
158 3300049822 Ga0501035_0028174 Ga0501035_0028174_2013_2645 204
159 3300049823 Ga0501044_0042149 Ga0501044_0042149_2649_3281 204
160 3300050507 nmdc:mga05p37_1508813_c1 nmdc:mga05p37_1508813_c1_20_643 204
161 3300050511 nmdc:mga08y16_335477_c1 nmdc:mga08y16_335477_c1_16_639 204
162 3300050512 nmdc:mga0n895_342946_c1 nmdc:mga0n895_342946_c1_770_1393 204
163 3300005530 Ga0070679_100092366 Ga0070679_1000923662 205
164 3300025921 Ga0207652_10069352 Ga0207652_100693523 205
165 3300045976 Ga0466967_0147298 Ga0466967_0147298_1148_1783 205
166 3300049569 Ga0501032_0261876 Ga0501032_0261876_311_961 205
167 3300005530 Ga0070679_100469149 Ga0070679_1004691492 206
168 3300009551 Ga0105238_10542294 Ga0105238_105422942 206
169 3300025909 Ga0207705_10510233 Ga0207705_105102332 206
170 3300035086 Ga0373934_0009118 Ga0373934_0009118_342_986 206
171 3300035111 Ga0373923_0048579 Ga0373923_0048579_1001_1645 206
172 3300035119 Ga0373956_0010506 Ga0373956_0010506_1638_2282 206
173 3300035120 Ga0373957_0105396 Ga0373957_0105396_418_1062 206
174 3300035410 Ga0373924_0110981 Ga0373924_0110981_110_754 206
175 3300035692 Ga0373935_0259841 Ga0373935_0259841_283_927 206
176 3300035724 Ga0373933_0005918 Ga0373933_0005918_5353_5997 206
177 3300036401 Ga0373937_0009784 Ga0373937_0009784_1590_2234 206
178 3300046454 Ga0495592_0069656 Ga0495592_0069656_1724_2368 206
179 3300046462 Ga0495651_0001301 Ga0495651_0001301_14663_15307 206
180 3300046463 Ga0495653_0017208 Ga0495653_0017208_2196_2840 206
181 3300046477 Ga0495664_0067927 Ga0495664_0067927_1408_2052 206
182 3300046511 Ga0495608_0009500 Ga0495608_0009500_828_1472 206
183 3300046514 Ga0495618_0453374 Ga0495618_0453374_43_687 206
184 3300046516 Ga0495628_0000494 Ga0495628_0000494_183_827 206
185 3300046529 Ga0495652_0004653 Ga0495652_0004653_7083_7727 206
186 3300046536 Ga0495587_0000269 Ga0495587_0000269_2128_2772 206
187 3300046543 Ga0495645_0076410 Ga0495645_0076410_1571_2215 206
188 3300046559 Ga0495667_0090743 Ga0495667_0090743_118_762 206
189 3300046663 Ga0495635_0000200 Ga0495635_0000200_2785_3429 206
190 3300046675 Ga0495657_0001237 Ga0495657_0001237_4945_5589 206
191 3300046678 Ga0495599_0004010 Ga0495599_0004010_2043_2687 206
192 3300046679 Ga0495623_0000156 Ga0495623_0000156_39781_40425 206
193 3300046680 Ga0495646_0139099 Ga0495646_0139099_345_989 206
194 3300046689 Ga0495613_0345732 Ga0495613_0345732_162_806 206
195 3300046809 Ga0495600_0005770 Ga0495600_0005770_5644_6288 206
196 3300047319 Ga0495674_0004839 Ga0495674_0004839_7690_8334 206
197 3300047322 Ga0495680_0432590 Ga0495680_0432590_88_732 206
198 3300047444 Ga0495675_0058505 Ga0495675_0058505_1668_2312 206
199 3300047471 Ga0495684_0028480 Ga0495684_0028480_1581_2225 206
200 3300048088 Ga0495602_0022321 Ga0495602_0022321_5477_6121 206
201 3300048918 Ga0496115_0128735 Ga0496115_0128735_655_1275 206
202 3300053077 Ga0495601_0088017 Ga0495601_0088017_858_1502 206
203 3300053078 Ga0495612_0074613 Ga0495612_0074613_445_1089 206
204 3300053084 Ga0495595_0311602 Ga0495595_0311602_60_704 206
205 3300053085 Ga0495619_0076356 Ga0495619_0076356_1546_2190 206
206 3300006847 Ga0075431_100115542 Ga0075431_1001155423 207
207 3300031824 Ga0307413_10066930 Ga0307413_100669302 207
208 3300031901 Ga0307406_10244351 Ga0307406_102443512 207
209 3300031911 Ga0307412_10302608 Ga0307412_103026082 207
210 3300031911 Ga0307412_10552150 Ga0307412_105521501 207
211 3300031995 Ga0307409_100115909 Ga0307409_1001159092 207
212 3300032126 Ga0307415_100238943 Ga0307415_1002389432 207
213 3300049576 Ga0501040_0085139 Ga0501040_0085139_394_1038 207
214 3300049578 Ga0501042_0629947 Ga0501042_0629947_74_718 207
215 3300049592 Ga0501076_0071229 Ga0501076_0071229_1658_2302 207
216 3300049688 Ga0501259_011575 Ga0501259_011575_126_749 207
217 3300049741 Ga0501079_0330498 Ga0501079_0330498_312_956 207
218 3300049742 Ga0501080_0442693 Ga0501080_0442693_458_1102 207
219 3300049743 Ga0501081_0412949 Ga0501081_0412949_70_714 207
220 3300049824 Ga0501045_0351037 Ga0501045_0351037_28_672 207
221 3300050509 nmdc:mga0qj67_422506_c1 nmdc:mga0qj67_422506_c1_260_904 207
222 3300001990 JGI24737J22298_10029355 JGI24737J22298_100293552 208
223 3300002070 JGI24750J21931_1003346 JGI24750J21931_10033462 208
224 3300005295 Ga0065707_10210518 Ga0065707_102105182 208
225 3300005327 Ga0070658_10023333 Ga0070658_100233332 208
226 3300005327 Ga0070658_10056809 Ga0070658_100568091 208
227 3300005327 Ga0070658_10380678 Ga0070658_103806781 208
228 3300005327 Ga0070658_10653978 Ga0070658_106539781 208
229 3300005328 Ga0070676_10008120 Ga0070676_100081204 208
230 3300005328 Ga0070676_10081692 Ga0070676_100816922 208
231 3300005328 Ga0070676_10093313 Ga0070676_100933132 208
232 3300005329 Ga0070683_100000681 Ga0070683_10000068123 208
233 3300005329 Ga0070683_100022880 Ga0070683_1000228802 208
234 3300005329 Ga0070683_100041535 Ga0070683_1000415354 208
235 3300005329 Ga0070683_100179991 Ga0070683_1001799913 208
236 3300005331 Ga0070670_100171030 Ga0070670_1001710302 208
237 3300005331 Ga0070670_100188933 Ga0070670_1001889332 208
238 3300005331 Ga0070670_100290336 Ga0070670_1002903361 208
239 3300005331 Ga0070670_100479235 Ga0070670_1004792352 208
240 3300005334 Ga0068869_100003185 Ga0068869_1000031854 208
241 3300005334 Ga0068869_100997942 Ga0068869_1009979421 208
242 3300005335 Ga0070666_10113294 Ga0070666_101132942 208
243 3300005336 Ga0070680_100050750 Ga0070680_1000507503 208
244 3300005336 Ga0070680_100073293 Ga0070680_1000732932 208
245 3300005338 Ga0068868_100037170 Ga0068868_1000371702 208
246 3300005339 Ga0070660_100025284 Ga0070660_1000252844 208
247 3300005340 Ga0070689_100003792 Ga0070689_1000037927 208
248 3300005340 Ga0070689_100009066 Ga0070689_1000090664 208
249 3300005340 Ga0070689_100542484 Ga0070689_1005424842 208
250 3300005343 Ga0070687_100009043 Ga0070687_1000090434 208
251 3300005344 Ga0070661_100005547 Ga0070661_1000055476 208
252 3300005344 Ga0070661_100065231 Ga0070661_1000652312 208
253 3300005344 Ga0070661_100066085 Ga0070661_1000660852 208
254 3300005344 Ga0070661_100117045 Ga0070661_1001170452 208
255 3300005347 Ga0070668_100004050 Ga0070668_1000040504 208
256 3300005353 Ga0070669_100002374 Ga0070669_10000237412 208
257 3300005353 Ga0070669_100017185 Ga0070669_1000171854 208
258 3300005353 Ga0070669_100024551 Ga0070669_1000245513 208
259 3300005353 Ga0070669_100189645 Ga0070669_1001896452 208
260 3300005354 Ga0070675_100010741 Ga0070675_1000107413 208
261 3300005354 Ga0070675_100011278 Ga0070675_1000112784 208
262 3300005354 Ga0070675_100032429 Ga0070675_1000324292 208
263 3300005355 Ga0070671_100007736 Ga0070671_1000077366 208
264 3300005356 Ga0070674_100072016 Ga0070674_1000720162 208
265 3300005356 Ga0070674_100535292 Ga0070674_1005352921 208
266 3300005364 Ga0070673_100016912 Ga0070673_1000169123 208
267 3300005364 Ga0070673_100064374 Ga0070673_1000643742 208
268 3300005364 Ga0070673_100322686 Ga0070673_1003226861 208
269 3300005365 Ga0070688_100010739 Ga0070688_1000107394 208
270 3300005365 Ga0070688_100026534 Ga0070688_1000265344 208
271 3300005366 Ga0070659_100225117 Ga0070659_1002251172 208
272 3300005367 Ga0070667_100004361 Ga0070667_10000436110 208
273 3300005367 Ga0070667_100024900 Ga0070667_1000249003 208
274 3300005367 Ga0070667_100273902 Ga0070667_1002739022 208
275 3300005435 Ga0070714_100073555 Ga0070714_1000735553 208
276 3300005438 Ga0070701_10223408 Ga0070701_102234081 208
277 3300005439 Ga0070711_100817716 Ga0070711_1008177161 208
278 3300005441 Ga0070700_100101883 Ga0070700_1001018832 208
279 3300005444 Ga0070694_100092001 Ga0070694_1000920012 208
280 3300005444 Ga0070694_100127279 Ga0070694_1001272792 208
281 3300005456 Ga0070678_100368950 Ga0070678_1003689502 208
282 3300005457 Ga0070662_100010640 Ga0070662_1000106402 208
283 3300005457 Ga0070662_100079870 Ga0070662_1000798703 208
284 3300005459 Ga0068867_100019037 Ga0068867_1000190372 208
285 3300005459 Ga0068867_100042966 Ga0068867_1000429663 208
286 3300005459 Ga0068867_100143437 Ga0068867_1001434372 208
287 3300005459 Ga0068867_100265492 Ga0068867_1002654921 208
288 3300005471 Ga0070698_100099851 Ga0070698_1000998513 208
289 3300005518 Ga0070699_100200961 Ga0070699_1002009612 208
290 3300005530 Ga0070679_100163588 Ga0070679_1001635882 208
291 3300005530 Ga0070679_100189309 Ga0070679_1001893092 208
292 3300005535 Ga0070684_100004716 Ga0070684_1000047168 208
293 3300005535 Ga0070684_100006298 Ga0070684_1000062986 208
294 3300005535 Ga0070684_100012054 Ga0070684_1000120546 208
295 3300005535 Ga0070684_100146696 Ga0070684_1001466963 208
296 3300005539 Ga0068853_100008061 Ga0068853_1000080615 208
297 3300005539 Ga0068853_100024434 Ga0068853_1000244345 208
298 3300005539 Ga0068853_100590022 Ga0068853_1005900222 208
299 3300005543 Ga0070672_100029789 Ga0070672_1000297892 208
300 3300005543 Ga0070672_100071261 Ga0070672_1000712613 208
301 3300005543 Ga0070672_100098231 Ga0070672_1000982311 208
302 3300005543 Ga0070672_100103354 Ga0070672_1001033542 208
303 3300005543 Ga0070672_100228072 Ga0070672_1002280722 208
304 3300005543 Ga0070672_100558084 Ga0070672_1005580841 208
305 3300005544 Ga0070686_100763456 Ga0070686_1007634561 208
306 3300005548 Ga0070665_100181608 Ga0070665_1001816082 208
307 3300005563 Ga0068855_100059280 Ga0068855_1000592805 208
308 3300005563 Ga0068855_100087932 Ga0068855_1000879324 208
309 3300005563 Ga0068855_100294924 Ga0068855_1002949242 208
310 3300005563 Ga0068855_100333925 Ga0068855_1003339252 208
311 3300005564 Ga0070664_100010643 Ga0070664_1000106437 208
312 3300005564 Ga0070664_100013631 Ga0070664_1000136312 208
313 3300005564 Ga0070664_100033122 Ga0070664_1000331222 208
314 3300005564 Ga0070664_100100588 Ga0070664_1001005883 208
315 3300005564 Ga0070664_100127605 Ga0070664_1001276052 208
316 3300005564 Ga0070664_100543652 Ga0070664_1005436522 208
317 3300005577 Ga0068857_100012828 Ga0068857_1000128286 208
318 3300005577 Ga0068857_100027471 Ga0068857_1000274714 208
319 3300005577 Ga0068857_100030916 Ga0068857_1000309164 208
320 3300005577 Ga0068857_100078648 Ga0068857_1000786482 208
321 3300005578 Ga0068854_100075120 Ga0068854_1000751203 208
322 3300005578 Ga0068854_100584085 Ga0068854_1005840852 208
323 3300005578 Ga0068854_101185395 Ga0068854_1011853951 208
324 3300005615 Ga0070702_100157770 Ga0070702_1001577702 208
325 3300005616 Ga0068852_100006303 Ga0068852_1000063038 208
326 3300005616 Ga0068852_100055451 Ga0068852_1000554513 208
327 3300005616 Ga0068852_100192660 Ga0068852_1001926602 208
328 3300005616 Ga0068852_100720371 Ga0068852_1007203712 208
329 3300005617 Ga0068859_100132524 Ga0068859_1001325242 208
330 3300005617 Ga0068859_100182395 Ga0068859_1001823953 208
331 3300005719 Ga0068861_100014363 Ga0068861_1000143634 208
332 3300005719 Ga0068861_100031208 Ga0068861_1000312083 208
333 3300005719 Ga0068861_100523339 Ga0068861_1005233392 208
334 3300005719 Ga0068861_100740408 Ga0068861_1007404081 208
335 3300005834 Ga0068851_10003188 Ga0068851_100031886 208
336 3300005840 Ga0068870_10012379 Ga0068870_100123793 208
337 3300005840 Ga0068870_10094352 Ga0068870_100943522 208
338 3300005841 Ga0068863_100178298 Ga0068863_1001782983 208
339 3300005841 Ga0068863_100875417 Ga0068863_1008754172 208
340 3300005842 Ga0068858_100012176 Ga0068858_1000121764 208
341 3300005842 Ga0068858_100082269 Ga0068858_1000822693 208
342 3300005842 Ga0068858_100086564 Ga0068858_1000865642 208
343 3300005843 Ga0068860_100014614 Ga0068860_1000146146 208
344 3300005843 Ga0068860_100166983 Ga0068860_1001669832 208
345 3300005844 Ga0068862_100008006 Ga0068862_1000080062 208
346 3300005985 Ga0081539_10012248 Ga0081539_100122483 208
347 3300006358 Ga0068871_100753928 Ga0068871_1007539281 208
348 3300006844 Ga0075428_100160807 Ga0075428_1001608072 208
349 3300006844 Ga0075428_100209060 Ga0075428_1002090602 208
350 3300006844 Ga0075428_100418508 Ga0075428_1004185082 208
351 3300006846 Ga0075430_100039628 Ga0075430_1000396283 208
352 3300006847 Ga0075431_100061920 Ga0075431_1000619204 208
353 3300006847 Ga0075431_100131271 Ga0075431_1001312712 208
354 3300006852 Ga0075433_10013303 Ga0075433_100133034 208
355 3300006871 Ga0075434_100008741 Ga0075434_1000087412 208
356 3300006871 Ga0075434_100365309 Ga0075434_1003653091 208
357 3300006880 Ga0075429_100031032 Ga0075429_1000310325 208
358 3300006880 Ga0075429_100064042 Ga0075429_1000640423 208
359 3300006880 Ga0075429_100124743 Ga0075429_1001247433 208
360 3300006881 Ga0068865_100009369 Ga0068865_1000093694 208
361 3300006881 Ga0068865_100123076 Ga0068865_1001230763 208
362 3300006881 Ga0068865_100283830 Ga0068865_1002838302 208
363 3300006931 Ga0097620_100132517 Ga0097620_1001325173 208
364 3300006931 Ga0097620_100182391 Ga0097620_1001823913 208
365 3300007076 Ga0075435_100337712 Ga0075435_1003377122 208
366 3300009093 Ga0105240_10008178 Ga0105240_1000817814 208
367 3300009093 Ga0105240_10289202 Ga0105240_102892022 208
368 3300009094 Ga0111539_10034268 Ga0111539_100342683 208
369 3300009094 Ga0111539_10112864 Ga0111539_101128643 208
370 3300009094 Ga0111539_10216851 Ga0111539_102168512 208
371 3300009094 Ga0111539_10264150 Ga0111539_102641502 208
372 3300009098 Ga0105245_10114634 Ga0105245_101146343 208
373 3300009147 Ga0114129_10039108 Ga0114129_100391082 208
374 3300009148 Ga0105243_10048333 Ga0105243_100483333 208
375 3300009176 Ga0105242_10016201 Ga0105242_100162012 208
376 3300009177 Ga0105248_10016255 Ga0105248_100162553 208
377 3300009177 Ga0105248_10082569 Ga0105248_100825692 208
378 3300009177 Ga0105248_10142839 Ga0105248_101428392 208
379 3300009177 Ga0105248_10315860 Ga0105248_103158602 208
380 3300009545 Ga0105237_10638173 Ga0105237_106381732 208
381 3300009551 Ga0105238_10111041 Ga0105238_101110413 208
382 3300009551 Ga0105238_10353815 Ga0105238_103538151 208
383 3300009553 Ga0105249_10000401 Ga0105249_100004018 208
384 3300009553 Ga0105249_10025142 Ga0105249_100251424 208
385 3300009553 Ga0105249_10501733 Ga0105249_105017332 208
386 3300010375 Ga0105239_10025212 Ga0105239_100252127 208
387 3300011119 Ga0105246_10625396 Ga0105246_106253962 208
388 3300013100 Ga0157373_10398658 Ga0157373_103986582 208
389 3300013102 Ga0157371_10020222 Ga0157371_100202224 208
390 3300013104 Ga0157370_10011107 Ga0157370_1001110710 208
391 3300013104 Ga0157370_10036679 Ga0157370_100366795 208
392 3300013104 Ga0157370_10075470 Ga0157370_100754702 208
393 3300013104 Ga0157370_10315934 Ga0157370_103159341 208
394 3300013105 Ga0157369_10017079 Ga0157369_100170794 208
395 3300013105 Ga0157369_10100386 Ga0157369_101003861 208
396 3300013105 Ga0157369_10202695 Ga0157369_102026951 208
397 3300013296 Ga0157374_10046567 Ga0157374_100465674 208
398 3300013296 Ga0157374_10376654 Ga0157374_103766542 208
399 3300013306 Ga0163162_10006251 Ga0163162_100062514 208
400 3300013306 Ga0163162_10093767 Ga0163162_100937673 208
401 3300013306 Ga0163162_10376346 Ga0163162_103763462 208
402 3300013307 Ga0157372_10012289 Ga0157372_100122894 208
403 3300013307 Ga0157372_10018962 Ga0157372_100189626 208
404 3300013307 Ga0157372_10290894 Ga0157372_102908941 208
405 3300013307 Ga0157372_10458506 Ga0157372_104585062 208
406 3300013307 Ga0157372_10765478 Ga0157372_107654781 208
407 3300013308 Ga0157375_10155663 Ga0157375_101556632 208
408 3300013308 Ga0157375_10162094 Ga0157375_101620942 208
409 3300013308 Ga0157375_10537380 Ga0157375_105373802 208
410 3300013308 Ga0157375_10891209 Ga0157375_108912092 208
411 3300014325 Ga0163163_10199473 Ga0163163_101994732 208
412 3300014326 Ga0157380_10002943 Ga0157380_1000294310 208
413 3300014326 Ga0157380_10159520 Ga0157380_101595202 208
414 3300014326 Ga0157380_10383867 Ga0157380_103838672 208
415 3300014968 Ga0157379_10002779 Ga0157379_100027795 208
416 3300014969 Ga0157376_11253349 Ga0157376_112533491 208
417 3300017792 Ga0163161_10061252 Ga0163161_100612522 208
418 3300020070 Ga0206356_11452365 Ga0206356_114523652 208
419 3300020082 Ga0206353_10829339 Ga0206353_108293392 208
420 3300025315 Ga0207697_10004114 Ga0207697_100041146 208
421 3300025321 Ga0207656_10008725 Ga0207656_100087253 208
422 3300025893 Ga0207682_10022945 Ga0207682_100229452 208
423 3300025901 Ga0207688_10008758 Ga0207688_100087582 208
424 3300025903 Ga0207680_10145851 Ga0207680_101458512 208
425 3300025903 Ga0207680_10324758 Ga0207680_103247582 208
426 3300025904 Ga0207647_10091023 Ga0207647_100910232 208
427 3300025907 Ga0207645_10000246 Ga0207645_100002464 208
428 3300025907 Ga0207645_10046076 Ga0207645_100460762 208
429 3300025907 Ga0207645_10399763 Ga0207645_103997632 208
430 3300025908 Ga0207643_10005735 Ga0207643_100057354 208
431 3300025909 Ga0207705_10008483 Ga0207705_100084832 208
432 3300025909 Ga0207705_10027463 Ga0207705_100274633 208
433 3300025909 Ga0207705_10337446 Ga0207705_103374462 208
434 3300025912 Ga0207707_10034532 Ga0207707_100345321 208
435 3300025912 Ga0207707_10609740 Ga0207707_106097402 208
436 3300025913 Ga0207695_10015068 Ga0207695_100150682 208
437 3300025913 Ga0207695_10049287 Ga0207695_100492872 208
438 3300025913 Ga0207695_10202071 Ga0207695_102020712 208
439 3300025914 Ga0207671_10725906 Ga0207671_107259061 208
440 3300025917 Ga0207660_10193439 Ga0207660_101934392 208
441 3300025918 Ga0207662_10001341 Ga0207662_100013418 208
442 3300025919 Ga0207657_10035139 Ga0207657_100351392 208
443 3300025919 Ga0207657_10047429 Ga0207657_100474292 208
444 3300025920 Ga0207649_10141668 Ga0207649_101416682 208
445 3300025920 Ga0207649_10404344 Ga0207649_104043442 208
446 3300025921 Ga0207652_10040959 Ga0207652_100409594 208
447 3300025921 Ga0207652_10502895 Ga0207652_105028951 208
448 3300025923 Ga0207681_10004605 Ga0207681_100046054 208
449 3300025923 Ga0207681_10010274 Ga0207681_100102743 208
450 3300025924 Ga0207694_10048137 Ga0207694_100481373 208
451 3300025925 Ga0207650_10028491 Ga0207650_100284914 208
452 3300025926 Ga0207659_10008740 Ga0207659_100087404 208
453 3300025926 Ga0207659_10093133 Ga0207659_100931332 208
454 3300025929 Ga0207664_10019391 Ga0207664_100193915 208
455 3300025932 Ga0207690_10224469 Ga0207690_102244692 208
456 3300025932 Ga0207690_10566392 Ga0207690_105663921 208
457 3300025933 Ga0207706_10000357 Ga0207706_100003574 208
458 3300025934 Ga0207686_10041324 Ga0207686_100413242 208
459 3300025937 Ga0207669_10166423 Ga0207669_101664232 208
460 3300025937 Ga0207669_10212592 Ga0207669_102125921 208
461 3300025937 Ga0207669_10533466 Ga0207669_105334662 208
462 3300025938 Ga0207704_10011553 Ga0207704_100115534 208
463 3300025938 Ga0207704_10093293 Ga0207704_100932932 208
464 3300025938 Ga0207704_10454829 Ga0207704_104548292 208
465 3300025940 Ga0207691_10001314 Ga0207691_1000131411 208
466 3300025940 Ga0207691_10001355 Ga0207691_1000135521 208
467 3300025940 Ga0207691_10002440 Ga0207691_100024408 208
468 3300025940 Ga0207691_10017747 Ga0207691_100177472 208
469 3300025940 Ga0207691_10023156 Ga0207691_100231562 208
470 3300025940 Ga0207691_10114299 Ga0207691_101142992 208
471 3300025941 Ga0207711_10188200 Ga0207711_101882002 208
472 3300025941 Ga0207711_10402317 Ga0207711_104023172 208
473 3300025942 Ga0207689_10001360 Ga0207689_100013606 208
474 3300025944 Ga0207661_10012163 Ga0207661_100121633 208
475 3300025944 Ga0207661_10016359 Ga0207661_100163592 208
476 3300025944 Ga0207661_10450574 Ga0207661_104505742 208
477 3300025944 Ga0207661_10559334 Ga0207661_105593342 208
478 3300025945 Ga0207679_10001293 Ga0207679_100012936 208
479 3300025945 Ga0207679_10073037 Ga0207679_100730372 208
480 3300025945 Ga0207679_10089529 Ga0207679_100895291 208
481 3300025945 Ga0207679_10214924 Ga0207679_102149242 208
482 3300025945 Ga0207679_10910136 Ga0207679_109101361 208
483 3300025949 Ga0207667_10067852 Ga0207667_100678522 208
484 3300025949 Ga0207667_10247351 Ga0207667_102473513 208
485 3300025949 Ga0207667_10647948 Ga0207667_106479482 208
486 3300025960 Ga0207651_10221656 Ga0207651_102216562 208
487 3300025960 Ga0207651_10255050 Ga0207651_102550502 208
488 3300025961 Ga0207712_10004798 Ga0207712_100047983 208
489 3300025961 Ga0207712_10294845 Ga0207712_102948452 208
490 3300025972 Ga0207668_10030244 Ga0207668_100302444 208
491 3300025972 Ga0207668_10100358 Ga0207668_101003582 208
492 3300025972 Ga0207668_10163630 Ga0207668_101636302 208
493 3300025972 Ga0207668_10237780 Ga0207668_102377802 208
494 3300025972 Ga0207668_10784366 Ga0207668_107843661 208
495 3300025981 Ga0207640_10018594 Ga0207640_100185942 208
496 3300025981 Ga0207640_10350857 Ga0207640_103508572 208
497 3300025986 Ga0207658_10019166 Ga0207658_100191662 208
498 3300025986 Ga0207658_10635455 Ga0207658_106354552 208
499 3300026035 Ga0207703_10005549 Ga0207703_100055496 208
500 3300026035 Ga0207703_10130373 Ga0207703_101303732 208
501 3300026041 Ga0207639_10103518 Ga0207639_101035182 208
502 3300026041 Ga0207639_10286049 Ga0207639_102860491 208
503 3300026041 Ga0207639_10553318 Ga0207639_105533182 208
504 3300026067 Ga0207678_10052781 Ga0207678_100527812 208
505 3300026075 Ga0207708_10052601 Ga0207708_100526013 208
506 3300026075 Ga0207708_10129045 Ga0207708_101290452 208
507 3300026088 Ga0207641_10023335 Ga0207641_100233353 208
508 3300026088 Ga0207641_10120792 Ga0207641_101207922 208
509 3300026089 Ga0207648_10043640 Ga0207648_100436404 208
510 3300026089 Ga0207648_10048053 Ga0207648_100480532 208
511 3300026089 Ga0207648_10127878 Ga0207648_101278781 208
512 3300026095 Ga0207676_11255112 Ga0207676_112551121 208
513 3300026116 Ga0207674_10005220 Ga0207674_1000522012 208
514 3300026116 Ga0207674_10012363 Ga0207674_100123633 208
515 3300026116 Ga0207674_10020068 Ga0207674_100200686 208
516 3300026116 Ga0207674_10084809 Ga0207674_100848092 208
517 3300026118 Ga0207675_100000320 Ga0207675_10000032042 208
518 3300026118 Ga0207675_100024660 Ga0207675_1000246602 208
519 3300026142 Ga0207698_10052960 Ga0207698_100529602 208
520 3300026142 Ga0207698_10268896 Ga0207698_102688961 208
521 3300026142 Ga0207698_10298593 Ga0207698_102985932 208
522 3300027907 Ga0207428_10092971 Ga0207428_100929712 208
523 3300027907 Ga0207428_10197484 Ga0207428_101974842 208
524 3300028379 Ga0268266_10065062 Ga0268266_100650622 208
525 3300028379 Ga0268266_10303356 Ga0268266_103033562 208
526 3300028379 Ga0268266_10990145 Ga0268266_109901451 208
527 3300028380 Ga0268265_10002328 Ga0268265_100023289 208
528 3300028380 Ga0268265_10002878 Ga0268265_100028785 208
529 3300028381 Ga0268264_10037773 Ga0268264_100377732 208
530 3300031548 Ga0307408_100008102 Ga0307408_1000081028 208
531 3300031731 Ga0307405_10002563 Ga0307405_100025636 208
532 3300031731 Ga0307405_10011026 Ga0307405_100110263 208
533 3300031731 Ga0307405_10020285 Ga0307405_100202852 208
534 3300031731 Ga0307405_10198154 Ga0307405_101981542 208
535 3300031824 Ga0307413_10002839 Ga0307413_100028392 208
536 3300031852 Ga0307410_10025754 Ga0307410_100257542 208
537 3300031852 Ga0307410_10480401 Ga0307410_104804012 208
538 3300031852 Ga0307410_10560084 Ga0307410_105600842 208
539 3300031901 Ga0307406_10000997 Ga0307406_100009978 208
540 3300031901 Ga0307406_10007929 Ga0307406_100079295 208
541 3300031901 Ga0307406_10190655 Ga0307406_101906552 208
542 3300031901 Ga0307406_10297630 Ga0307406_102976302 208
543 3300031903 Ga0307407_10037378 Ga0307407_100373783 208
544 3300031995 Ga0307409_100023265 Ga0307409_1000232653 208
545 3300031995 Ga0307409_100038991 Ga0307409_1000389913 208
546 3300031995 Ga0307409_100212235 Ga0307409_1002122352 208
547 3300031995 Ga0307409_100422047 Ga0307409_1004220472 208
548 3300032002 Ga0307416_100017933 Ga0307416_1000179331 208
549 3300032002 Ga0307416_100018106 Ga0307416_1000181062 208
550 3300032002 Ga0307416_100079715 Ga0307416_1000797152 208
551 3300032002 Ga0307416_100124611 Ga0307416_1001246112 208
552 3300032002 Ga0307416_100334795 Ga0307416_1003347952 208
553 3300032002 Ga0307416_100442581 Ga0307416_1004425812 208
554 3300032002 Ga0307416_101117569 Ga0307416_1011175692 208
555 3300032004 Ga0307414_10004771 Ga0307414_100047716 208
556 3300032004 Ga0307414_10041511 Ga0307414_100415112 208
557 3300032005 Ga0307411_10016870 Ga0307411_100168704 208
558 3300032005 Ga0307411_10017025 Ga0307411_100170253 208
559 3300032126 Ga0307415_100004642 Ga0307415_1000046423 208
560 3300032126 Ga0307415_100004895 Ga0307415_1000048955 208
561 3300032126 Ga0307415_100117207 Ga0307415_1001172071 208
562 3300032126 Ga0307415_100363626 Ga0307415_1003636262 208
563 3300035121 Ga0373960_0059628 Ga0373960_0059628_306_974 208
564 3300037312 Ga0395899_0110016 Ga0395899_0110016_1095_1823 208
565 3300037418 Ga0395900_0066207 Ga0395900_0066207_1113_1841 208
566 3300037466 Ga0395898_0116174 Ga0395898_0116174_1450_2178 208
567 3300037471 Ga0395905_0006883 Ga0395905_0006883_8785_9513 208
568 3300037471 Ga0395905_0141882 Ga0395905_0141882_854_1585 208
569 3300038443 Ga0395901_0103552 Ga0395901_0103552_882_1610 208
570 3300041486 Ga0451807_0077717 Ga0451807_0077717_553_1221 208
571 3300045051 Ga0451576_0106572 Ga0451576_0106572_1133_1801 208
572 3300045976 Ga0466967_0244092 Ga0466967_0244092_74_796 208
573 3300045976 Ga0466967_0918418 Ga0466967_0918418_91_819 208
574 3300046511 Ga0495608_0225593 Ga0495608_0225593_316_942 208
575 3300046691 Ga0495670_0038861 Ga0495670_0038861_300_968 208
576 3300047317 Ga0495604_0345792 Ga0495604_0345792_39_665 208
577 3300048907 Ga0496104_0827413 Ga0496104_0827413_164_790 208
578 3300048909 Ga0496106_0208930 Ga0496106_0208930_257_907 208
579 3300048910 Ga0496107_0220874 Ga0496107_0220874_425_1051 208
580 3300048911 Ga0496108_0020209 Ga0496108_0020209_1315_1941 208
581 3300048916 Ga0496113_0203528 Ga0496113_0203528_157_825 208
582 3300048917 Ga0496114_0133646 Ga0496114_0133646_308_958 208
583 3300048917 Ga0496114_0308843 Ga0496114_0308843_109_735 208
584 3300048918 Ga0496115_0023520 Ga0496115_0023520_2607_3257 208
585 3300050507 nmdc:mga05p37_272908_c1 nmdc:mga05p37_272908_c1_255_923 208
586 3300050508 nmdc:mga09592_137749_c1 nmdc:mga09592_137749_c1_821_1474 208
587 3300050508 nmdc:mga09592_33595_c1 nmdc:mga09592_33595_c1_577_1245 208
588 3300050509 nmdc:mga0qj67_71620_c1 nmdc:mga0qj67_71620_c1_1286_1939 208
589 3300050510 nmdc:mga06r32_321556_c1 nmdc:mga06r32_321556_c1_279_932 208
590 3300050510 nmdc:mga06r32_414762_c1 nmdc:mga06r32_414762_c1_626_1279 208
591 3300050511 nmdc:mga08y16_66250_c1 nmdc:mga08y16_66250_c1_1848_2516 208
592 3300050512 nmdc:mga0n895_18729_c1 nmdc:mga0n895_18729_c1_1104_1772 208
593 3300050513 nmdc:mga0rr50_553955_c1 nmdc:mga0rr50_553955_c1_63_731 208
594 3300050514 nmdc:mga08x19_44349_c1 nmdc:mga08x19_44349_c1_1079_1732 208
595 3300050515 nmdc:mga0a205_24539_c1 nmdc:mga0a205_24539_c1_2090_2758 208
596 3300059421 Ga0590071_055781 Ga0590071_055781_277_927 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

163

245

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.905 91 206
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8899 91 208
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8763 91 208
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8635 91 206
4g9q-assembly1.cif.gz_A crystal structure of a 4-carboxymuconolactone decarboxylase 0.759 6 207
ID Description Score Start End Superfamily
2af7G00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8751 93 208 1.20.1290.10
2af7D00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8748 92 206 1.20.1290.10
2af7G00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8541 93 208 1.20.1290.10
af_Q58906_2_101_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8421 110 202 1.20.1290.10
2af7F00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8307 91 206 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7D5XEZ3-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9841 89 207 GO:0051920
AF-A0A841HV07-F1-model_v4 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) 0.9754 99 207 GO:0016829
GO:0051920
AF-A0A2V7SID8-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9753 1 208 GO:0051920
AF-A0A7V9U3B1-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9752 8 205 GO:0051920
AF-A0A430RUR7-F1-model_v4 4-carboxymuconolactone decarboxylase 0.9734 99 207 GO:0051920

Feature Viewer

pLDDT pTM Quality
95.52 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map