F467571
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 596 | 263 | 596 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100008102|Ga0307408_1000081028 |
| Length | 250 |
| Sequence | VTPHDHAGLAPDESLDAVAPTAPALRDGDVDGGGAMPRDRASAGIVPALDPATRRLIRLSAVICAASEAAIREAMADATDGIDPVWVEELILQSYLFAGFPRALNAMREWRRISGRRAPPADEDARAESQAALWRERGERTCAVVYGPFYDALRHNIRDLHPALDAWMIVDGYGKVLARAGLDLRRRELCVVGACAAARQDRQLHSHLHGALHAGATPAEVADALHVVEDLAGPDDARRYRQLLARVVGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 178 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 191 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 192 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 242 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.52 |
| Rhizosphere | 97.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10029355 | 3300001990 | Bacteria | 1725 |
| 2 | JGI24750J21931_1003346 | 3300002070 | Bacteria | 1919 |
| 3 | Ga0065707_10210518 | 3300005295 | Bacteria | 1268 |
| 4 | Ga0070658_10023333 | 3300005327 | Bacteria | 4967 |
| 5 | Ga0070658_10056809 | 3300005327 | Bacteria | 3182 |
| 6 | Ga0070658_10380678 | 3300005327 | Bacteria | 1210 |
| 7 | Ga0070658_10653978 | 3300005327 | Bacteria | 912 |
| 8 | Ga0070676_10008120 | 3300005328 | Bacteria | 5647 |
| 9 | Ga0070676_10081692 | 3300005328 | Bacteria | 1962 |
| 10 | Ga0070676_10093313 | 3300005328 | Bacteria | 1848 |
| 11 | Ga0070683_100000681 | 3300005329 | Bacteria | 24634 |
| 12 | Ga0070683_100010079 | 3300005329 | Bacteria | 8106 |
| 13 | Ga0070683_100022880 | 3300005329 | Bacteria | 5589 |
| 14 | Ga0070683_100041535 | 3300005329 | Bacteria | 4231 |
| 15 | Ga0070683_100179991 | 3300005329 | Bacteria | 2006 |
| 16 | Ga0070683_100336243 | 3300005329 | Bacteria | 1438 |
| 17 | Ga0070670_100171030 | 3300005331 | Bacteria | 1884 |
| 18 | Ga0070670_100188933 | 3300005331 | Bacteria | 1789 |
| 19 | Ga0070670_100290336 | 3300005331 | Bacteria | 1429 |
| 20 | Ga0070670_100479235 | 3300005331 | Bacteria | 1105 |
| 21 | Ga0068869_100000336 | 3300005334 | Bacteria | 25057 |
| 22 | Ga0068869_100003185 | 3300005334 | Bacteria | 10023 |
| 23 | Ga0068869_100997942 | 3300005334 | Unclassified | 729 |
| 24 | Ga0070666_10113294 | 3300005335 | Bacteria | 1876 |
| 25 | Ga0070666_10357363 | 3300005335 | Bacteria | 1046 |
| 26 | Ga0070680_100000247 | 3300005336 | Bacteria | 35633 |
| 27 | Ga0070680_100016663 | 3300005336 | Bacteria | 5787 |
| 28 | Ga0070680_100050750 | 3300005336 | Bacteria | 3384 |
| 29 | Ga0070680_100073293 | 3300005336 | Bacteria | 2815 |
| 30 | Ga0070682_100006710 | 3300005337 | Bacteria | 6454 |
| 31 | Ga0070682_100295135 | 3300005337 | Bacteria | 1187 |
| 32 | Ga0068868_100037170 | 3300005338 | Bacteria | 3774 |
| 33 | Ga0068868_100054291 | 3300005338 | Bacteria | 3157 |
| 34 | Ga0070660_100025284 | 3300005339 | Bacteria | 4412 |
| 35 | Ga0070660_100126897 | 3300005339 | Bacteria | 2039 |
| 36 | Ga0070689_100003792 | 3300005340 | Bacteria | 10123 |
| 37 | Ga0070689_100009066 | 3300005340 | Bacteria | 7042 |
| 38 | Ga0070689_100542484 | 3300005340 | Bacteria | 1001 |
| 39 | Ga0070687_100009043 | 3300005343 | Bacteria | 4249 |
| 40 | Ga0070661_100005547 | 3300005344 | Bacteria | 8699 |
| 41 | Ga0070661_100007742 | 3300005344 | Bacteria | 7417 |
| 42 | Ga0070661_100065231 | 3300005344 | Bacteria | 2675 |
| 43 | Ga0070661_100066085 | 3300005344 | Bacteria | 2657 |
| 44 | Ga0070661_100117045 | 3300005344 | Bacteria | 1994 |
| 45 | Ga0070692_10006391 | 3300005345 | Bacteria | 5116 |
| 46 | Ga0070668_100004050 | 3300005347 | Bacteria | 10850 |
| 47 | Ga0070669_100002374 | 3300005353 | Bacteria | 13618 |
| 48 | Ga0070669_100017185 | 3300005353 | Bacteria | 5161 |
| 49 | Ga0070669_100024551 | 3300005353 | Bacteria | 4322 |
| 50 | Ga0070669_100189645 | 3300005353 | Bacteria | 1612 |
| 51 | Ga0070675_100000547 | 3300005354 | Bacteria | 25799 |
| 52 | Ga0070675_100010741 | 3300005354 | Bacteria | 7162 |
| 53 | Ga0070675_100011278 | 3300005354 | Bacteria | 6996 |
| 54 | Ga0070675_100032429 | 3300005354 | Bacteria | 4228 |
| 55 | Ga0070671_100007736 | 3300005355 | Bacteria | 8584 |
| 56 | Ga0070674_100072016 | 3300005356 | Bacteria | 2446 |
| 57 | Ga0070674_100535292 | 3300005356 | Unclassified | 981 |
| 58 | Ga0070673_100016912 | 3300005364 | Bacteria | 5172 |
| 59 | Ga0070673_100029330 | 3300005364 | Bacteria | 4102 |
| 60 | Ga0070673_100064374 | 3300005364 | Bacteria | 2921 |
| 61 | Ga0070673_100322686 | 3300005364 | Bacteria | 1364 |
| 62 | Ga0070688_100010739 | 3300005365 | Bacteria | 5059 |
| 63 | Ga0070688_100026534 | 3300005365 | Bacteria | 3443 |
| 64 | Ga0070659_100006929 | 3300005366 | Bacteria | 8206 |
| 65 | Ga0070659_100225117 | 3300005366 | Bacteria | 1549 |
| 66 | Ga0070667_100004361 | 3300005367 | Bacteria | 11938 |
| 67 | Ga0070667_100024900 | 3300005367 | Bacteria | 4971 |
| 68 | Ga0070667_100273902 | 3300005367 | Bacteria | 1514 |
| 69 | Ga0070667_100414056 | 3300005367 | Bacteria | 1228 |
| 70 | Ga0070709_10203843 | 3300005434 | Unclassified | 1402 |
| 71 | Ga0070714_100073555 | 3300005435 | Bacteria | 2961 |
| 72 | Ga0070701_10223408 | 3300005438 | Bacteria | 1124 |
| 73 | Ga0070711_100817716 | 3300005439 | Bacteria | 791 |
| 74 | Ga0070700_100101883 | 3300005441 | Bacteria | 1893 |
| 75 | Ga0070694_100092001 | 3300005444 | Bacteria | 2130 |
| 76 | Ga0070694_100127279 | 3300005444 | Bacteria | 1835 |
| 77 | Ga0070678_100368950 | 3300005456 | Bacteria | 1239 |
| 78 | Ga0070662_100010640 | 3300005457 | Bacteria | 6049 |
| 79 | Ga0070662_100079870 | 3300005457 | Bacteria | 2434 |
| 80 | Ga0070662_100135797 | 3300005457 | Bacteria | 1902 |
| 81 | Ga0070681_10009028 | 3300005458 | Bacteria | 9800 |
| 82 | Ga0070681_10150059 | 3300005458 | Bacteria | 2258 |
| 83 | Ga0070681_10324247 | 3300005458 | Bacteria | 1450 |
| 84 | Ga0068867_100019037 | 3300005459 | Bacteria | 4888 |
| 85 | Ga0068867_100042966 | 3300005459 | Bacteria | 3308 |
| 86 | Ga0068867_100143437 | 3300005459 | Bacteria | 1869 |
| 87 | Ga0068867_100265492 | 3300005459 | Bacteria | 1401 |
| 88 | Ga0070698_100099851 | 3300005471 | Bacteria | 2875 |
| 89 | Ga0070699_100115930 | 3300005518 | Bacteria | 2354 |
| 90 | Ga0070699_100200961 | 3300005518 | Unclassified | 1772 |
| 91 | Ga0070679_100045506 | 3300005530 | Bacteria | 4373 |
| 92 | Ga0070679_100092366 | 3300005530 | Bacteria | 3014 |
| 93 | Ga0070679_100163588 | 3300005530 | Bacteria | 2199 |
| 94 | Ga0070679_100189309 | 3300005530 | Bacteria | 2027 |
| 95 | Ga0070679_100285648 | 3300005530 | Bacteria | 1602 |
| 96 | Ga0070679_100469149 | 3300005530 | Bacteria | 1203 |
| 97 | Ga0070684_100004716 | 3300005535 | Bacteria | 10413 |
| 98 | Ga0070684_100006298 | 3300005535 | Bacteria | 9169 |
| 99 | Ga0070684_100010020 | 3300005535 | Bacteria | 7492 |
| 100 | Ga0070684_100012054 | 3300005535 | Bacteria | 6911 |
| 101 | Ga0070684_100146696 | 3300005535 | Bacteria | 2136 |
| 102 | Ga0070684_100319602 | 3300005535 | Bacteria | 1426 |
| 103 | Ga0070684_100336089 | 3300005535 | Unclassified | 1388 |
| 104 | Ga0070697_100448262 | 3300005536 | Bacteria | 1124 |
| 105 | Ga0068853_100008061 | 3300005539 | Bacteria | 8448 |
| 106 | Ga0068853_100024434 | 3300005539 | Bacteria | 5066 |
| 107 | Ga0068853_100590022 | 3300005539 | Bacteria | 1055 |
| 108 | Ga0070672_100029789 | 3300005543 | Bacteria | 4096 |
| 109 | Ga0070672_100071261 | 3300005543 | Bacteria | 2764 |
| 110 | Ga0070672_100098231 | 3300005543 | Bacteria | 2371 |
| 111 | Ga0070672_100103354 | 3300005543 | Bacteria | 2314 |
| 112 | Ga0070672_100228072 | 3300005543 | Bacteria | 1564 |
| 113 | Ga0070672_100558084 | 3300005543 | Bacteria | 995 |
| 114 | Ga0070686_100642005 | 3300005544 | Bacteria | 841 |
| 115 | Ga0070686_100763456 | 3300005544 | Unclassified | 776 |
| 116 | Ga0070695_100035292 | 3300005545 | Bacteria | 3141 |
| 117 | Ga0070693_100030580 | 3300005547 | Bacteria | 2944 |
| 118 | Ga0070665_100181608 | 3300005548 | Bacteria | 2105 |
| 119 | Ga0068855_100059280 | 3300005563 | Bacteria | 4479 |
| 120 | Ga0068855_100087932 | 3300005563 | Bacteria | 3590 |
| 121 | Ga0068855_100294924 | 3300005563 | Unclassified | 1797 |
| 122 | Ga0068855_100333925 | 3300005563 | Bacteria | 1673 |
| 123 | Ga0070664_100005450 | 3300005564 | Bacteria | 10216 |
| 124 | Ga0070664_100010643 | 3300005564 | Bacteria | 7453 |
| 125 | Ga0070664_100013631 | 3300005564 | Bacteria | 6625 |
| 126 | Ga0070664_100033122 | 3300005564 | Bacteria | 4325 |
| 127 | Ga0070664_100100588 | 3300005564 | Unclassified | 2513 |
| 128 | Ga0070664_100127605 | 3300005564 | Bacteria | 2232 |
| 129 | Ga0070664_100271366 | 3300005564 | Bacteria | 1528 |
| 130 | Ga0070664_100543652 | 3300005564 | Unclassified | 1074 |
| 131 | Ga0068857_100003188 | 3300005577 | Bacteria | 13600 |
| 132 | Ga0068857_100012828 | 3300005577 | Bacteria | 7302 |
| 133 | Ga0068857_100027471 | 3300005577 | Bacteria | 5020 |
| 134 | Ga0068857_100030916 | 3300005577 | Bacteria | 4731 |
| 135 | Ga0068857_100078648 | 3300005577 | Bacteria | 2944 |
| 136 | Ga0068854_100075120 | 3300005578 | Bacteria | 2481 |
| 137 | Ga0068854_100584085 | 3300005578 | Bacteria | 952 |
| 138 | Ga0068854_101185395 | 3300005578 | Bacteria | 684 |
| 139 | Ga0068856_100004404 | 3300005614 | Bacteria | 14032 |
| 140 | Ga0068856_100097012 | 3300005614 | Bacteria | 2937 |
| 141 | Ga0068856_100143304 | 3300005614 | Bacteria | 2397 |
| 142 | Ga0068856_100856444 | 3300005614 | Unclassified | 928 |
| 143 | Ga0070702_100003041 | 3300005615 | Bacteria | 7420 |
| 144 | Ga0070702_100157770 | 3300005615 | Bacteria | 1463 |
| 145 | Ga0068852_100006303 | 3300005616 | Bacteria | 8560 |
| 146 | Ga0068852_100026250 | 3300005616 | Bacteria | 4732 |
| 147 | Ga0068852_100050273 | 3300005616 | Bacteria | 3571 |
| 148 | Ga0068852_100055451 | 3300005616 | Bacteria | 3421 |
| 149 | Ga0068852_100192660 | 3300005616 | Bacteria | 1924 |
| 150 | Ga0068852_100720371 | 3300005616 | Bacteria | 1009 |
| 151 | Ga0068859_100040566 | 3300005617 | Bacteria | 4672 |
| 152 | Ga0068859_100132524 | 3300005617 | Bacteria | 2564 |
| 153 | Ga0068859_100182395 | 3300005617 | Bacteria | 2182 |
| 154 | Ga0068864_100029675 | 3300005618 | Bacteria | 4634 |
| 155 | Ga0068861_100014363 | 3300005719 | Bacteria | 5557 |
| 156 | Ga0068861_100031208 | 3300005719 | Bacteria | 3912 |
| 157 | Ga0068861_100523339 | 3300005719 | Bacteria | 1076 |
| 158 | Ga0068861_100740408 | 3300005719 | Bacteria | 917 |
| 159 | Ga0068851_10003188 | 3300005834 | Bacteria | 7275 |
| 160 | Ga0068870_10012379 | 3300005840 | Bacteria | 3986 |
| 161 | Ga0068870_10094352 | 3300005840 | Bacteria | 1679 |
| 162 | Ga0068863_100013838 | 3300005841 | Bacteria | 7776 |
| 163 | Ga0068863_100178298 | 3300005841 | Bacteria | 2039 |
| 164 | Ga0068863_100875417 | 3300005841 | Bacteria | 898 |
| 165 | Ga0068858_100012176 | 3300005842 | Bacteria | 8110 |
| 166 | Ga0068858_100082269 | 3300005842 | Bacteria | 2992 |
| 167 | Ga0068858_100086564 | 3300005842 | Bacteria | 2914 |
| 168 | Ga0068858_100117492 | 3300005842 | Bacteria | 2486 |
| 169 | Ga0068860_100006907 | 3300005843 | Bacteria | 11382 |
| 170 | Ga0068860_100014614 | 3300005843 | Bacteria | 7682 |
| 171 | Ga0068860_100166983 | 3300005843 | Bacteria | 2125 |
| 172 | Ga0068862_100008006 | 3300005844 | Bacteria | 8745 |
| 173 | Ga0081455_10028128 | 3300005937 | Bacteria | 5139 |
| 174 | Ga0081539_10012248 | 3300005985 | Bacteria | 6648 |
| 175 | Ga0097621_100012625 | 3300006237 | Bacteria | 6269 |
| 176 | Ga0068871_100020170 | 3300006358 | Bacteria | 5102 |
| 177 | Ga0068871_100753928 | 3300006358 | Unclassified | 895 |
| 178 | Ga0075428_100160807 | 3300006844 | Bacteria | 2438 |
| 179 | Ga0075428_100209060 | 3300006844 | Bacteria | 2109 |
| 180 | Ga0075428_100418508 | 3300006844 | Bacteria | 1436 |
| 181 | Ga0075430_100016806 | 3300006846 | Bacteria | 6231 |
| 182 | Ga0075430_100024856 | 3300006846 | Bacteria | 5095 |
| 183 | Ga0075430_100039628 | 3300006846 | Bacteria | 3988 |
| 184 | Ga0075430_100058837 | 3300006846 | Bacteria | 3231 |
| 185 | Ga0075431_100031621 | 3300006847 | Bacteria | 5450 |
| 186 | Ga0075431_100061920 | 3300006847 | Bacteria | 3861 |
| 187 | Ga0075431_100115542 | 3300006847 | Unclassified | 2770 |
| 188 | Ga0075431_100131271 | 3300006847 | Bacteria | 2583 |
| 189 | Ga0075431_100264535 | 3300006847 | Bacteria | 1745 |
| 190 | Ga0075431_100276052 | 3300006847 | Bacteria | 1702 |
| 191 | Ga0075433_10013303 | 3300006852 | Bacteria | 6686 |
| 192 | Ga0075434_100008741 | 3300006871 | Bacteria | 9423 |
| 193 | Ga0075434_100365309 | 3300006871 | Bacteria | 1464 |
| 194 | Ga0075429_100031032 | 3300006880 | Unclassified | 4644 |
| 195 | Ga0075429_100064042 | 3300006880 | Bacteria | 3202 |
| 196 | Ga0075429_100124743 | 3300006880 | Bacteria | 2252 |
| 197 | Ga0068865_100009369 | 3300006881 | Bacteria | 6068 |
| 198 | Ga0068865_100123076 | 3300006881 | Bacteria | 1932 |
| 199 | Ga0068865_100283830 | 3300006881 | Bacteria | 1319 |
| 200 | Ga0097620_100040566 | 3300006931 | Bacteria | 4672 |
| 201 | Ga0097620_100132517 | 3300006931 | Bacteria | 2564 |
| 202 | Ga0097620_100182391 | 3300006931 | Bacteria | 2182 |
| 203 | Ga0075435_100337712 | 3300007076 | Bacteria | 1291 |
| 204 | Ga0105240_10008178 | 3300009093 | Bacteria | 15002 |
| 205 | Ga0105240_10289202 | 3300009093 | Bacteria | 1880 |
| 206 | Ga0111539_10034268 | 3300009094 | Bacteria | 6159 |
| 207 | Ga0111539_10112864 | 3300009094 | Bacteria | 3188 |
| 208 | Ga0111539_10216851 | 3300009094 | Bacteria | 2229 |
| 209 | Ga0111539_10264150 | 3300009094 | Bacteria | 2003 |
| 210 | Ga0105245_10004762 | 3300009098 | Bacteria | 11978 |
| 211 | Ga0105245_10028583 | 3300009098 | Bacteria | 4920 |
| 212 | Ga0105245_10114634 | 3300009098 | Bacteria | 2510 |
| 213 | Ga0114129_10039108 | 3300009147 | Bacteria | 6688 |
| 214 | Ga0114129_10544237 | 3300009147 | Unclassified | 1511 |
| 215 | Ga0105243_10048333 | 3300009148 | Bacteria | 3353 |
| 216 | Ga0105241_10003558 | 3300009174 | Bacteria | 11587 |
| 217 | Ga0105242_10016201 | 3300009176 | Bacteria | 5792 |
| 218 | Ga0105242_10277538 | 3300009176 | Bacteria | 1521 |
| 219 | Ga0105248_10015710 | 3300009177 | Bacteria | 8344 |
| 220 | Ga0105248_10016255 | 3300009177 | Bacteria | 8190 |
| 221 | Ga0105248_10047581 | 3300009177 | Bacteria | 4810 |
| 222 | Ga0105248_10082569 | 3300009177 | Bacteria | 3614 |
| 223 | Ga0105248_10142839 | 3300009177 | Bacteria | 2700 |
| 224 | Ga0105248_10315860 | 3300009177 | Bacteria | 1760 |
| 225 | Ga0105237_10638173 | 3300009545 | Bacteria | 1072 |
| 226 | Ga0105238_10111041 | 3300009551 | Bacteria | 2722 |
| 227 | Ga0105238_10353815 | 3300009551 | Bacteria | 1458 |
| 228 | Ga0105238_10542294 | 3300009551 | Bacteria | 1167 |
| 229 | Ga0105249_10000401 | 3300009553 | Bacteria | 41704 |
| 230 | Ga0105249_10025142 | 3300009553 | Bacteria | 5359 |
| 231 | Ga0105249_10501733 | 3300009553 | Bacteria | 1259 |
| 232 | Ga0105239_10012515 | 3300010375 | Bacteria | 9450 |
| 233 | Ga0105239_10025212 | 3300010375 | Bacteria | 6548 |
| 234 | Ga0105246_10000533 | 3300011119 | Bacteria | 20789 |
| 235 | Ga0105246_10625396 | 3300011119 | Bacteria | 934 |
| 236 | Ga0157373_10044476 | 3300013100 | Bacteria | 3170 |
| 237 | Ga0157373_10309231 | 3300013100 | Bacteria | 1123 |
| 238 | Ga0157373_10398658 | 3300013100 | Bacteria | 986 |
| 239 | Ga0157371_10020222 | 3300013102 | Bacteria | 4900 |
| 240 | Ga0157370_10011107 | 3300013104 | Bacteria | 9441 |
| 241 | Ga0157370_10036679 | 3300013104 | Bacteria | 4756 |
| 242 | Ga0157370_10075470 | 3300013104 | Bacteria | 3178 |
| 243 | Ga0157370_10315934 | 3300013104 | Bacteria | 1441 |
| 244 | Ga0157369_10017079 | 3300013105 | Bacteria | 8154 |
| 245 | Ga0157369_10100386 | 3300013105 | Bacteria | 3085 |
| 246 | Ga0157369_10202695 | 3300013105 | Bacteria | 2082 |
| 247 | Ga0157369_10231304 | 3300013105 | Bacteria | 1933 |
| 248 | Ga0157374_10046567 | 3300013296 | Bacteria | 4017 |
| 249 | Ga0157374_10376654 | 3300013296 | Bacteria | 1413 |
| 250 | Ga0163162_10006251 | 3300013306 | Bacteria | 11547 |
| 251 | Ga0163162_10093767 | 3300013306 | Bacteria | 3088 |
| 252 | Ga0163162_10376346 | 3300013306 | Bacteria | 1553 |
| 253 | Ga0157372_10012289 | 3300013307 | Bacteria | 9122 |
| 254 | Ga0157372_10018962 | 3300013307 | Bacteria | 7404 |
| 255 | Ga0157372_10021746 | 3300013307 | Bacteria | 6933 |
| 256 | Ga0157372_10036682 | 3300013307 | Bacteria | 5404 |
| 257 | Ga0157372_10290894 | 3300013307 | Bacteria | 1900 |
| 258 | Ga0157372_10458506 | 3300013307 | Bacteria | 1486 |
| 259 | Ga0157372_10765478 | 3300013307 | Bacteria | 1122 |
| 260 | Ga0157375_10007703 | 3300013308 | Bacteria | 9424 |
| 261 | Ga0157375_10155663 | 3300013308 | Bacteria | 2424 |
| 262 | Ga0157375_10162094 | 3300013308 | Bacteria | 2378 |
| 263 | Ga0157375_10537380 | 3300013308 | Bacteria | 1331 |
| 264 | Ga0157375_10891209 | 3300013308 | Unclassified | 1034 |
| 265 | Ga0163163_10050780 | 3300014325 | Bacteria | 4086 |
| 266 | Ga0163163_10199473 | 3300014325 | Bacteria | 2049 |
| 267 | Ga0163163_10399946 | 3300014325 | Bacteria | 1432 |
| 268 | Ga0157380_10002943 | 3300014326 | Bacteria | 11579 |
| 269 | Ga0157380_10159520 | 3300014326 | Bacteria | 1959 |
| 270 | Ga0157380_10383867 | 3300014326 | Bacteria | 1327 |
| 271 | Ga0157377_10001214 | 3300014745 | Bacteria | 10986 |
| 272 | Ga0157379_10002779 | 3300014968 | Bacteria | 14754 |
| 273 | Ga0157379_10460801 | 3300014968 | Bacteria | 1175 |
| 274 | Ga0157376_10021797 | 3300014969 | Bacteria | 4980 |
| 275 | Ga0157376_11253349 | 3300014969 | Bacteria | 771 |
| 276 | Ga0163161_10061252 | 3300017792 | Bacteria | 2739 |
| 277 | Ga0163161_10587099 | 3300017792 | Bacteria | 917 |
| 278 | Ga0206356_11452365 | 3300020070 | Unclassified | 1204 |
| 279 | Ga0206353_10829339 | 3300020082 | Bacteria | 3091 |
| 280 | Ga0207697_10004114 | 3300025315 | Bacteria | 7023 |
| 281 | Ga0207656_10008725 | 3300025321 | Bacteria | 3744 |
| 282 | Ga0207682_10022945 | 3300025893 | Bacteria | 2462 |
| 283 | Ga0207688_10008758 | 3300025901 | Bacteria | 5505 |
| 284 | Ga0207680_10145851 | 3300025903 | Bacteria | 1573 |
| 285 | Ga0207680_10324758 | 3300025903 | Bacteria | 1077 |
| 286 | Ga0207647_10091023 | 3300025904 | Bacteria | 1819 |
| 287 | Ga0207645_10000246 | 3300025907 | Bacteria | 44995 |
| 288 | Ga0207645_10046076 | 3300025907 | Bacteria | 2786 |
| 289 | Ga0207645_10399763 | 3300025907 | Bacteria | 924 |
| 290 | Ga0207643_10005735 | 3300025908 | Bacteria | 6635 |
| 291 | Ga0207705_10008483 | 3300025909 | Bacteria | 7499 |
| 292 | Ga0207705_10027463 | 3300025909 | Bacteria | 4058 |
| 293 | Ga0207705_10337446 | 3300025909 | Bacteria | 1160 |
| 294 | Ga0207705_10510233 | 3300025909 | Bacteria | 934 |
| 295 | Ga0207654_10006351 | 3300025911 | Bacteria | 5943 |
| 296 | Ga0207707_10008044 | 3300025912 | Bacteria | 9158 |
| 297 | Ga0207707_10034532 | 3300025912 | Bacteria | 4425 |
| 298 | Ga0207707_10264225 | 3300025912 | Bacteria | 1492 |
| 299 | Ga0207707_10609740 | 3300025912 | Bacteria | 923 |
| 300 | Ga0207695_10015068 | 3300025913 | Bacteria | 9120 |
| 301 | Ga0207695_10049287 | 3300025913 | Bacteria | 4442 |
| 302 | Ga0207695_10055931 | 3300025913 | Bacteria | 4109 |
| 303 | Ga0207695_10202071 | 3300025913 | Bacteria | 1901 |
| 304 | Ga0207695_10494519 | 3300025913 | Bacteria | 1105 |
| 305 | Ga0207671_10725906 | 3300025914 | Unclassified | 790 |
| 306 | Ga0207660_10000019 | 3300025917 | Bacteria | 74841 |
| 307 | Ga0207660_10193439 | 3300025917 | Bacteria | 1585 |
| 308 | Ga0207662_10001341 | 3300025918 | Bacteria | 11871 |
| 309 | Ga0207657_10035139 | 3300025919 | Bacteria | 4498 |
| 310 | Ga0207657_10047429 | 3300025919 | Bacteria | 3756 |
| 311 | Ga0207649_10001792 | 3300025920 | Bacteria | 12287 |
| 312 | Ga0207649_10141668 | 3300025920 | Bacteria | 1646 |
| 313 | Ga0207649_10404344 | 3300025920 | Bacteria | 1022 |
| 314 | Ga0207652_10040959 | 3300025921 | Bacteria | 3936 |
| 315 | Ga0207652_10052768 | 3300025921 | Bacteria | 3491 |
| 316 | Ga0207652_10069352 | 3300025921 | Bacteria | 3061 |
| 317 | Ga0207652_10393495 | 3300025921 | Unclassified | 1251 |
| 318 | Ga0207652_10502895 | 3300025921 | Bacteria | 1091 |
| 319 | Ga0207681_10004605 | 3300025923 | Bacteria | 8482 |
| 320 | Ga0207681_10010274 | 3300025923 | Bacteria | 5729 |
| 321 | Ga0207694_10048137 | 3300025924 | Bacteria | 3298 |
| 322 | Ga0207650_10028491 | 3300025925 | Bacteria | 4005 |
| 323 | Ga0207659_10008740 | 3300025926 | Bacteria | 6306 |
| 324 | Ga0207659_10030744 | 3300025926 | Bacteria | 3672 |
| 325 | Ga0207659_10093133 | 3300025926 | Bacteria | 2254 |
| 326 | Ga0207687_10004209 | 3300025927 | Bacteria | 9624 |
| 327 | Ga0207664_10019391 | 3300025929 | Bacteria | 5026 |
| 328 | Ga0207690_10224469 | 3300025932 | Bacteria | 1439 |
| 329 | Ga0207690_10566392 | 3300025932 | Bacteria | 925 |
| 330 | Ga0207706_10000357 | 3300025933 | Bacteria | 49369 |
| 331 | Ga0207706_10004509 | 3300025933 | Bacteria | 13079 |
| 332 | Ga0207686_10041324 | 3300025934 | Bacteria | 2810 |
| 333 | Ga0207669_10166423 | 3300025937 | Bacteria | 1564 |
| 334 | Ga0207669_10212592 | 3300025937 | Unclassified | 1413 |
| 335 | Ga0207669_10533466 | 3300025937 | Bacteria | 944 |
| 336 | Ga0207704_10011553 | 3300025938 | Bacteria | 4351 |
| 337 | Ga0207704_10093293 | 3300025938 | Bacteria | 1984 |
| 338 | Ga0207704_10454829 | 3300025938 | Bacteria | 1023 |
| 339 | Ga0207691_10001314 | 3300025940 | Bacteria | 24795 |
| 340 | Ga0207691_10001355 | 3300025940 | Bacteria | 24425 |
| 341 | Ga0207691_10002440 | 3300025940 | Bacteria | 18181 |
| 342 | Ga0207691_10017747 | 3300025940 | Bacteria | 6747 |
| 343 | Ga0207691_10023156 | 3300025940 | Bacteria | 5848 |
| 344 | Ga0207691_10114299 | 3300025940 | Bacteria | 2398 |
| 345 | Ga0207711_10012482 | 3300025941 | Bacteria | 7060 |
| 346 | Ga0207711_10188200 | 3300025941 | Bacteria | 1880 |
| 347 | Ga0207711_10377280 | 3300025941 | Unclassified | 1315 |
| 348 | Ga0207711_10402317 | 3300025941 | Bacteria | 1272 |
| 349 | Ga0207689_10000838 | 3300025942 | Bacteria | 29648 |
| 350 | Ga0207689_10001360 | 3300025942 | Bacteria | 23476 |
| 351 | Ga0207661_10002707 | 3300025944 | Bacteria | 12194 |
| 352 | Ga0207661_10012163 | 3300025944 | Bacteria | 6249 |
| 353 | Ga0207661_10016359 | 3300025944 | Bacteria | 5471 |
| 354 | Ga0207661_10221446 | 3300025944 | Bacteria | 1673 |
| 355 | Ga0207661_10450574 | 3300025944 | Bacteria | 1172 |
| 356 | Ga0207661_10559334 | 3300025944 | Unclassified | 1048 |
| 357 | Ga0207679_10001293 | 3300025945 | Bacteria | 15800 |
| 358 | Ga0207679_10073037 | 3300025945 | Bacteria | 2594 |
| 359 | Ga0207679_10089529 | 3300025945 | Unclassified | 2376 |
| 360 | Ga0207679_10098064 | 3300025945 | Bacteria | 2284 |
| 361 | Ga0207679_10214924 | 3300025945 | Bacteria | 1615 |
| 362 | Ga0207679_10910136 | 3300025945 | Unclassified | 805 |
| 363 | Ga0207667_10067852 | 3300025949 | Bacteria | 3715 |
| 364 | Ga0207667_10247351 | 3300025949 | Bacteria | 1824 |
| 365 | Ga0207667_10647948 | 3300025949 | Bacteria | 1062 |
| 366 | Ga0207651_10013040 | 3300025960 | Bacteria | 4736 |
| 367 | Ga0207651_10221656 | 3300025960 | Bacteria | 1529 |
| 368 | Ga0207651_10255050 | 3300025960 | Bacteria | 1437 |
| 369 | Ga0207712_10004798 | 3300025961 | Bacteria | 8542 |
| 370 | Ga0207712_10294845 | 3300025961 | Bacteria | 1329 |
| 371 | Ga0207668_10030244 | 3300025972 | Bacteria | 3557 |
| 372 | Ga0207668_10100358 | 3300025972 | Bacteria | 2149 |
| 373 | Ga0207668_10163630 | 3300025972 | Unclassified | 1737 |
| 374 | Ga0207668_10237780 | 3300025972 | Bacteria | 1472 |
| 375 | Ga0207668_10784366 | 3300025972 | Bacteria | 842 |
| 376 | Ga0207640_10018594 | 3300025981 | Bacteria | 4087 |
| 377 | Ga0207640_10350857 | 3300025981 | Bacteria | 1185 |
| 378 | Ga0207658_10019166 | 3300025986 | Bacteria | 4731 |
| 379 | Ga0207658_10294159 | 3300025986 | Bacteria | 1397 |
| 380 | Ga0207658_10635455 | 3300025986 | Unclassified | 961 |
| 381 | Ga0207677_10034060 | 3300026023 | Bacteria | 3294 |
| 382 | Ga0207703_10005549 | 3300026035 | Bacteria | 10126 |
| 383 | Ga0207703_10086685 | 3300026035 | Bacteria | 2623 |
| 384 | Ga0207703_10130373 | 3300026035 | Bacteria | 2170 |
| 385 | Ga0207639_10103518 | 3300026041 | Bacteria | 2306 |
| 386 | Ga0207639_10286049 | 3300026041 | Bacteria | 1452 |
| 387 | Ga0207639_10553318 | 3300026041 | Bacteria | 1057 |
| 388 | Ga0207678_10052781 | 3300026067 | Bacteria | 3505 |
| 389 | Ga0207708_10052601 | 3300026075 | Bacteria | 3102 |
| 390 | Ga0207708_10129045 | 3300026075 | Bacteria | 1975 |
| 391 | Ga0207702_10008970 | 3300026078 | Bacteria | 8426 |
| 392 | Ga0207702_10111929 | 3300026078 | Bacteria | 2429 |
| 393 | Ga0207702_10149450 | 3300026078 | Bacteria | 2123 |
| 394 | Ga0207641_10015530 | 3300026088 | Bacteria | 6240 |
| 395 | Ga0207641_10023335 | 3300026088 | Bacteria | 5098 |
| 396 | Ga0207641_10120792 | 3300026088 | Bacteria | 2338 |
| 397 | Ga0207648_10043640 | 3300026089 | Bacteria | 3935 |
| 398 | Ga0207648_10048053 | 3300026089 | Bacteria | 3738 |
| 399 | Ga0207648_10127878 | 3300026089 | Bacteria | 2235 |
| 400 | Ga0207676_10006741 | 3300026095 | Bacteria | 8128 |
| 401 | Ga0207676_10013795 | 3300026095 | Bacteria | 5802 |
| 402 | Ga0207676_11255112 | 3300026095 | Bacteria | 735 |
| 403 | Ga0207674_10001189 | 3300026116 | Bacteria | 33857 |
| 404 | Ga0207674_10005220 | 3300026116 | Bacteria | 15462 |
| 405 | Ga0207674_10012363 | 3300026116 | Bacteria | 9541 |
| 406 | Ga0207674_10020068 | 3300026116 | Bacteria | 7229 |
| 407 | Ga0207674_10084809 | 3300026116 | Bacteria | 3165 |
| 408 | Ga0207675_100000320 | 3300026118 | Bacteria | 45668 |
| 409 | Ga0207675_100024660 | 3300026118 | Bacteria | 5592 |
| 410 | Ga0207698_10038232 | 3300026142 | Bacteria | 3544 |
| 411 | Ga0207698_10052960 | 3300026142 | Bacteria | 3112 |
| 412 | Ga0207698_10268896 | 3300026142 | Bacteria | 1570 |
| 413 | Ga0207698_10298593 | 3300026142 | Bacteria | 1498 |
| 414 | Ga0207428_10092971 | 3300027907 | Bacteria | 2340 |
| 415 | Ga0207428_10197484 | 3300027907 | Bacteria | 1514 |
| 416 | Ga0268266_10065062 | 3300028379 | Bacteria | 3152 |
| 417 | Ga0268266_10303356 | 3300028379 | Bacteria | 1490 |
| 418 | Ga0268266_10990145 | 3300028379 | Bacteria | 814 |
| 419 | Ga0268265_10002328 | 3300028380 | Bacteria | 14426 |
| 420 | Ga0268265_10002878 | 3300028380 | Bacteria | 12639 |
| 421 | Ga0268264_10007527 | 3300028381 | Bacteria | 9085 |
| 422 | Ga0268264_10037773 | 3300028381 | Bacteria | 3983 |
| 423 | Ga0307408_100008102 | 3300031548 | Bacteria | 6946 |
| 424 | Ga0307408_100187332 | 3300031548 | Bacteria | 1664 |
| 425 | Ga0307405_10002563 | 3300031731 | Bacteria | 8065 |
| 426 | Ga0307405_10006095 | 3300031731 | Bacteria | 5898 |
| 427 | Ga0307405_10011026 | 3300031731 | Bacteria | 4715 |
| 428 | Ga0307405_10020285 | 3300031731 | Bacteria | 3711 |
| 429 | Ga0307405_10198154 | 3300031731 | Bacteria | 1456 |
| 430 | Ga0307413_10002839 | 3300031824 | Bacteria | 7147 |
| 431 | Ga0307413_10029397 | 3300031824 | Bacteria | 3073 |
| 432 | Ga0307413_10066930 | 3300031824 | Bacteria | 2244 |
| 433 | Ga0307410_10005473 | 3300031852 | Bacteria | 6727 |
| 434 | Ga0307410_10025754 | 3300031852 | Bacteria | 3694 |
| 435 | Ga0307410_10480401 | 3300031852 | Bacteria | 1019 |
| 436 | Ga0307410_10560084 | 3300031852 | Bacteria | 948 |
| 437 | Ga0307406_10000997 | 3300031901 | Bacteria | 15702 |
| 438 | Ga0307406_10003135 | 3300031901 | Bacteria | 8987 |
| 439 | Ga0307406_10007929 | 3300031901 | Bacteria | 5912 |
| 440 | Ga0307406_10190655 | 3300031901 | Bacteria | 1500 |
| 441 | Ga0307406_10244351 | 3300031901 | Bacteria | 1348 |
| 442 | Ga0307406_10297630 | 3300031901 | Bacteria | 1238 |
| 443 | Ga0307407_10006846 | 3300031903 | Bacteria | 5110 |
| 444 | Ga0307407_10037378 | 3300031903 | Bacteria | 2682 |
| 445 | Ga0307412_10302608 | 3300031911 | Bacteria | 1265 |
| 446 | Ga0307412_10482307 | 3300031911 | Bacteria | 1028 |
| 447 | Ga0307412_10552150 | 3300031911 | Bacteria | 968 |
| 448 | Ga0307409_100023265 | 3300031995 | Bacteria | 4289 |
| 449 | Ga0307409_100038991 | 3300031995 | Bacteria | 3520 |
| 450 | Ga0307409_100039847 | 3300031995 | Bacteria | 3490 |
| 451 | Ga0307409_100115909 | 3300031995 | Bacteria | 2257 |
| 452 | Ga0307409_100212235 | 3300031995 | Bacteria | 1740 |
| 453 | Ga0307409_100422047 | 3300031995 | Bacteria | 1280 |
| 454 | Ga0307416_100017933 | 3300032002 | Bacteria | 4971 |
| 455 | Ga0307416_100018106 | 3300032002 | Bacteria | 4952 |
| 456 | Ga0307416_100020574 | 3300032002 | Bacteria | 4712 |
| 457 | Ga0307416_100079715 | 3300032002 | Bacteria | 2761 |
| 458 | Ga0307416_100124611 | 3300032002 | Bacteria | 2305 |
| 459 | Ga0307416_100334795 | 3300032002 | Bacteria | 1523 |
| 460 | Ga0307416_100442581 | 3300032002 | Unclassified | 1350 |
| 461 | Ga0307416_101117569 | 3300032002 | Bacteria | 893 |
| 462 | Ga0307414_10004771 | 3300032004 | Bacteria | 7397 |
| 463 | Ga0307414_10023255 | 3300032004 | Bacteria | 3927 |
| 464 | Ga0307414_10041511 | 3300032004 | Bacteria | 3117 |
| 465 | Ga0307411_10016870 | 3300032005 | Bacteria | 4142 |
| 466 | Ga0307411_10017025 | 3300032005 | Bacteria | 4128 |
| 467 | Ga0307411_10097853 | 3300032005 | Bacteria | 2066 |
| 468 | Ga0307415_100004642 | 3300032126 | Bacteria | 7176 |
| 469 | Ga0307415_100004895 | 3300032126 | Bacteria | 7035 |
| 470 | Ga0307415_100010501 | 3300032126 | Bacteria | 5249 |
| 471 | Ga0307415_100117207 | 3300032126 | Bacteria | 1988 |
| 472 | Ga0307415_100238943 | 3300032126 | Bacteria | 1468 |
| 473 | Ga0307415_100363626 | 3300032126 | Bacteria | 1223 |
| 474 | Ga0373934_0009118 | 3300035086 | Bacteria | 3712 |
| 475 | Ga0373923_0048579 | 3300035111 | Bacteria | 1772 |
| 476 | Ga0373956_0010506 | 3300035119 | Bacteria | 3796 |
| 477 | Ga0373957_0105396 | 3300035120 | Unclassified | 1132 |
| 478 | Ga0373960_0059628 | 3300035121 | Bacteria | 1155 |
| 479 | Ga0373924_0110981 | 3300035410 | Unclassified | 1185 |
| 480 | Ga0373931_0004289 | 3300035691 | Bacteria | 6494 |
| 481 | Ga0373931_0274986 | 3300035691 | Bacteria | 1032 |
| 482 | Ga0373935_0259841 | 3300035692 | Unclassified | 1218 |
| 483 | Ga0373933_0005918 | 3300035724 | Bacteria | 6654 |
| 484 | Ga0373937_0009784 | 3300036401 | Bacteria | 8358 |
| 485 | Ga0373937_0654475 | 3300036401 | Bacteria | 996 |
| 486 | Ga0395899_0110016 | 3300037312 | Bacteria | 1982 |
| 487 | Ga0395900_0066207 | 3300037418 | Bacteria | 3713 |
| 488 | Ga0395898_0116174 | 3300037466 | Bacteria | 2564 |
| 489 | Ga0395905_0006883 | 3300037471 | Bacteria | 11367 |
| 490 | Ga0395905_0141882 | 3300037471 | Bacteria | 2260 |
| 491 | Ga0395901_0103552 | 3300038443 | Bacteria | 2986 |
| 492 | Ga0436365_0262337 | 3300039437 | Bacteria | 7273 |
| 493 | Ga0436365_0614410 | 3300039437 | Bacteria | 1502 |
| 494 | Ga0451807_0077717 | 3300041486 | Bacteria | 1283 |
| 495 | Ga0439462_0060789 | 3300042015 | Bacteria | 1022 |
| 496 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 497 | Ga0451577_0029136 | 3300042876 | Bacteria | 4991 |
| 498 | Ga0451577_0045506 | 3300042876 | Bacteria | 3928 |
| 499 | Ga0451577_0121515 | 3300042876 | Bacteria | 2339 |
| 500 | Ga0451577_0623837 | 3300042876 | Unclassified | 978 |
| 501 | Ga0453684_0036233 | 3300044712 | Bacteria | 6801 |
| 502 | Ga0453684_0918023 | 3300044712 | Unclassified | 936 |
| 503 | Ga0451576_0106572 | 3300045051 | Bacteria | 2916 |
| 504 | Ga0451576_0793667 | 3300045051 | Unclassified | 994 |
| 505 | Ga0466967_0147298 | 3300045976 | Bacteria | 2197 |
| 506 | Ga0466967_0244092 | 3300045976 | Bacteria | 1714 |
| 507 | Ga0466967_0918418 | 3300045976 | Bacteria | 871 |
| 508 | Ga0495592_0069656 | 3300046454 | Bacteria | 2564 |
| 509 | Ga0495651_0001301 | 3300046462 | Bacteria | 19332 |
| 510 | Ga0495653_0017208 | 3300046463 | Bacteria | 5878 |
| 511 | Ga0495664_0067927 | 3300046477 | Bacteria | 2127 |
| 512 | Ga0495608_0009500 | 3300046511 | Bacteria | 6795 |
| 513 | Ga0495608_0225593 | 3300046511 | Bacteria | 1174 |
| 514 | Ga0495618_0453374 | 3300046514 | Unclassified | 778 |
| 515 | Ga0495628_0000494 | 3300046516 | Bacteria | 36135 |
| 516 | Ga0495630_0265247 | 3300046517 | Unclassified | 1312 |
| 517 | Ga0495652_0004653 | 3300046529 | Bacteria | 13086 |
| 518 | Ga0495665_0429092 | 3300046531 | Unclassified | 669 |
| 519 | Ga0495586_0610060 | 3300046535 | Unclassified | 630 |
| 520 | Ga0495587_0000269 | 3300046536 | Bacteria | 37262 |
| 521 | Ga0495645_0076410 | 3300046543 | Bacteria | 2409 |
| 522 | Ga0495645_0467804 | 3300046543 | Unclassified | 793 |
| 523 | Ga0495667_0090743 | 3300046559 | Bacteria | 1979 |
| 524 | Ga0495635_0000200 | 3300046663 | Bacteria | 37911 |
| 525 | Ga0495657_0001237 | 3300046675 | Bacteria | 22362 |
| 526 | Ga0495599_0004010 | 3300046678 | Bacteria | 8674 |
| 527 | Ga0495599_0229830 | 3300046678 | Unclassified | 1133 |
| 528 | Ga0495623_0000156 | 3300046679 | Bacteria | 42279 |
| 529 | Ga0495646_0139099 | 3300046680 | Bacteria | 1359 |
| 530 | Ga0495613_0345732 | 3300046689 | Unclassified | 1022 |
| 531 | Ga0495670_0038861 | 3300046691 | Bacteria | 2373 |
| 532 | Ga0495600_0005770 | 3300046809 | Bacteria | 7477 |
| 533 | Ga0495604_0345792 | 3300047317 | Unclassified | 989 |
| 534 | Ga0495674_0004839 | 3300047319 | Bacteria | 12950 |
| 535 | Ga0495680_0432590 | 3300047322 | Unclassified | 903 |
| 536 | Ga0495675_0058505 | 3300047444 | Bacteria | 2444 |
| 537 | Ga0495684_0028480 | 3300047471 | Bacteria | 4288 |
| 538 | Ga0495602_0022321 | 3300048088 | Bacteria | 6198 |
| 539 | Ga0496104_0827413 | 3300048907 | Unclassified | 832 |
| 540 | Ga0496106_0208930 | 3300048909 | Bacteria | 1554 |
| 541 | Ga0496107_0220874 | 3300048910 | Bacteria | 1410 |
| 542 | Ga0496108_0020209 | 3300048911 | Bacteria | 5473 |
| 543 | Ga0496108_0139525 | 3300048911 | Bacteria | 2088 |
| 544 | Ga0496109_0031858 | 3300048912 | Bacteria | 4736 |
| 545 | Ga0496112_0000196 | 3300048915 | Bacteria | 39516 |
| 546 | Ga0496112_0088854 | 3300048915 | Bacteria | 3058 |
| 547 | Ga0496113_0014762 | 3300048916 | Bacteria | 5343 |
| 548 | Ga0496113_0203528 | 3300048916 | Bacteria | 1574 |
| 549 | Ga0496114_0133646 | 3300048917 | Bacteria | 2144 |
| 550 | Ga0496114_0308843 | 3300048917 | Unclassified | 1397 |
| 551 | Ga0496115_0023520 | 3300048918 | Bacteria | 4781 |
| 552 | Ga0496115_0128735 | 3300048918 | Bacteria | 2086 |
| 553 | Ga0501032_0261876 | 3300049569 | Bacteria | 1121 |
| 554 | Ga0501033_0026915 | 3300049570 | Bacteria | 4326 |
| 555 | Ga0501034_0023281 | 3300049571 | Bacteria | 6311 |
| 556 | Ga0501040_0085139 | 3300049576 | Bacteria | 2194 |
| 557 | Ga0501042_0629947 | 3300049578 | Unclassified | 780 |
| 558 | Ga0501046_0391768 | 3300049580 | Bacteria | 1004 |
| 559 | Ga0501047_0030185 | 3300049581 | Bacteria | 5227 |
| 560 | Ga0501076_0071229 | 3300049592 | Bacteria | 2781 |
| 561 | Ga0501206_020164 | 3300049653 | Unclassified | 946 |
| 562 | Ga0501233_065594 | 3300049668 | Unclassified | 910 |
| 563 | Ga0501259_011575 | 3300049688 | Bacteria | 1461 |
| 564 | Ga0501259_064161 | 3300049688 | Unclassified | 774 |
| 565 | Ga0501079_0330498 | 3300049741 | Unclassified | 1194 |
| 566 | Ga0501080_0102262 | 3300049742 | Bacteria | 2658 |
| 567 | Ga0501080_0442693 | 3300049742 | Unclassified | 1166 |
| 568 | Ga0501080_1112539 | 3300049742 | Unclassified | 682 |
| 569 | Ga0501081_0412949 | 3300049743 | Unclassified | 1000 |
| 570 | Ga0501035_0028174 | 3300049822 | Bacteria | 5127 |
| 571 | Ga0501035_0879961 | 3300049822 | Bacteria | 711 |
| 572 | Ga0501044_0042149 | 3300049823 | Bacteria | 4750 |
| 573 | Ga0501045_0351037 | 3300049824 | Bacteria | 1098 |
| 574 | nmdc:mga05p37_1508813_c1 | 3300050507 | Unclassified | 669 |
| 575 | nmdc:mga05p37_272908_c1 | 3300050507 | Bacteria | 2020 |
| 576 | nmdc:mga09592_137749_c1 | 3300050508 | Bacteria | 2103 |
| 577 | nmdc:mga09592_33595_c1 | 3300050508 | Unclassified | 4283 |
| 578 | nmdc:mga0qj67_39857_c1 | 3300050509 | Bacteria | 3690 |
| 579 | nmdc:mga0qj67_422506_c1 | 3300050509 | Bacteria | 1075 |
| 580 | nmdc:mga0qj67_71620_c1 | 3300050509 | Bacteria | 2767 |
| 581 | nmdc:mga06r32_189904_c1 | 3300050510 | Bacteria | 2042 |
| 582 | nmdc:mga06r32_321556_c1 | 3300050510 | Bacteria | 1533 |
| 583 | nmdc:mga06r32_414762_c1 | 3300050510 | Bacteria | 1328 |
| 584 | nmdc:mga06r32_92915_c1 | 3300050510 | Bacteria | 2950 |
| 585 | nmdc:mga08y16_335477_c1 | 3300050511 | Bacteria | 1555 |
| 586 | nmdc:mga08y16_66250_c1 | 3300050511 | Bacteria | 3769 |
| 587 | nmdc:mga0n895_18729_c1 | 3300050512 | Bacteria | 6415 |
| 588 | nmdc:mga0n895_342946_c1 | 3300050512 | Bacteria | 1513 |
| 589 | nmdc:mga0rr50_553955_c1 | 3300050513 | Unclassified | 979 |
| 590 | nmdc:mga08x19_44349_c1 | 3300050514 | Bacteria | 2839 |
| 591 | nmdc:mga0a205_24539_c1 | 3300050515 | Bacteria | 5736 |
| 592 | Ga0495601_0088017 | 3300053077 | Bacteria | 1997 |
| 593 | Ga0495612_0074613 | 3300053078 | Unclassified | 1418 |
| 594 | Ga0495595_0311602 | 3300053084 | Unclassified | 792 |
| 595 | Ga0495619_0076356 | 3300053085 | Bacteria | 2249 |
| 596 | Ga0590071_055781 | 3300059421 | Unclassified | 961 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046531 | Ga0495665_0429092 | Ga0495665_0429092_129_656 | 173 |
| 2 | 3300046535 | Ga0495586_0610060 | Ga0495586_0610060_82_609 | 173 |
| 3 | 3300046543 | Ga0495645_0467804 | Ga0495645_0467804_14_553 | 176 |
| 4 | 3300006847 | Ga0075431_100276052 | Ga0075431_1002760522 | 182 |
| 5 | 3300046678 | Ga0495599_0229830 | Ga0495599_0229830_196_846 | 185 |
| 6 | 3300031548 | Ga0307408_100187332 | Ga0307408_1001873321 | 187 |
| 7 | 3300031731 | Ga0307405_10006095 | Ga0307405_100060957 | 187 |
| 8 | 3300031824 | Ga0307413_10029397 | Ga0307413_100293972 | 187 |
| 9 | 3300031852 | Ga0307410_10005473 | Ga0307410_100054734 | 187 |
| 10 | 3300031901 | Ga0307406_10003135 | Ga0307406_100031358 | 187 |
| 11 | 3300031903 | Ga0307407_10006846 | Ga0307407_100068464 | 187 |
| 12 | 3300031911 | Ga0307412_10482307 | Ga0307412_104823072 | 187 |
| 13 | 3300031995 | Ga0307409_100039847 | Ga0307409_1000398473 | 187 |
| 14 | 3300032002 | Ga0307416_100020574 | Ga0307416_1000205743 | 187 |
| 15 | 3300032004 | Ga0307414_10023255 | Ga0307414_100232554 | 187 |
| 16 | 3300032005 | Ga0307411_10097853 | Ga0307411_100978532 | 187 |
| 17 | 3300032126 | Ga0307415_100010501 | Ga0307415_1000105014 | 187 |
| 18 | 3300005564 | Ga0070664_100271366 | Ga0070664_1002713662 | 190 |
| 19 | 3300049822 | Ga0501035_0879961 | Ga0501035_0879961_14_586 | 190 |
| 20 | 3300042876 | Ga0451577_0029136 | Ga0451577_0029136_3581_4243 | 193 |
| 21 | 3300042876 | Ga0451577_0121515 | Ga0451577_0121515_310_1065 | 193 |
| 22 | 3300044712 | Ga0453684_0036233 | Ga0453684_0036233_3797_4459 | 193 |
| 23 | 3300005518 | Ga0070699_100115930 | Ga0070699_1001159302 | 196 |
| 24 | 3300050510 | nmdc:mga06r32_189904_c1 | nmdc:mga06r32_189904_c1_14_637 | 197 |
| 25 | 3300042015 | Ga0439462_0060789 | Ga0439462_0060789_295_939 | 198 |
| 26 | 3300006846 | Ga0075430_100024856 | Ga0075430_1000248563 | 199 |
| 27 | 3300035691 | Ga0373931_0004289 | Ga0373931_0004289_5406_6005 | 199 |
| 28 | 3300045051 | Ga0451576_0793667 | Ga0451576_0793667_117_716 | 199 |
| 29 | 3300048911 | Ga0496108_0139525 | Ga0496108_0139525_1281_1880 | 199 |
| 30 | 3300048912 | Ga0496109_0031858 | Ga0496109_0031858_2891_3490 | 199 |
| 31 | 3300048915 | Ga0496112_0000196 | Ga0496112_0000196_12700_13299 | 199 |
| 32 | 3300050509 | nmdc:mga0qj67_39857_c1 | nmdc:mga0qj67_39857_c1_1874_2530 | 199 |
| 33 | 3300005937 | Ga0081455_10028128 | Ga0081455_100281285 | 200 |
| 34 | 3300006846 | Ga0075430_100058837 | Ga0075430_1000588373 | 200 |
| 35 | 3300006847 | Ga0075431_100264535 | Ga0075431_1002645352 | 200 |
| 36 | 3300050510 | nmdc:mga06r32_92915_c1 | nmdc:mga06r32_92915_c1_1090_1779 | 200 |
| 37 | 3300005530 | Ga0070679_100285648 | Ga0070679_1002856482 | 201 |
| 38 | 3300006846 | Ga0075430_100016806 | Ga0075430_1000168067 | 201 |
| 39 | 3300006847 | Ga0075431_100031621 | Ga0075431_1000316215 | 201 |
| 40 | 3300025921 | Ga0207652_10393495 | Ga0207652_103934952 | 201 |
| 41 | 3300005329 | Ga0070683_100010079 | Ga0070683_1000100793 | 202 |
| 42 | 3300005334 | Ga0068869_100000336 | Ga0068869_10000033625 | 202 |
| 43 | 3300005335 | Ga0070666_10357363 | Ga0070666_103573631 | 202 |
| 44 | 3300005336 | Ga0070680_100016663 | Ga0070680_1000166631 | 202 |
| 45 | 3300005337 | Ga0070682_100006710 | Ga0070682_1000067103 | 202 |
| 46 | 3300005338 | Ga0068868_100054291 | Ga0068868_1000542912 | 202 |
| 47 | 3300005339 | Ga0070660_100126897 | Ga0070660_1001268972 | 202 |
| 48 | 3300005344 | Ga0070661_100007742 | Ga0070661_1000077426 | 202 |
| 49 | 3300005345 | Ga0070692_10006391 | Ga0070692_100063913 | 202 |
| 50 | 3300005354 | Ga0070675_100000547 | Ga0070675_10000054711 | 202 |
| 51 | 3300005364 | Ga0070673_100029330 | Ga0070673_1000293302 | 202 |
| 52 | 3300005366 | Ga0070659_100006929 | Ga0070659_1000069294 | 202 |
| 53 | 3300005367 | Ga0070667_100414056 | Ga0070667_1004140562 | 202 |
| 54 | 3300005457 | Ga0070662_100135797 | Ga0070662_1001357972 | 202 |
| 55 | 3300005458 | Ga0070681_10009028 | Ga0070681_100090286 | 202 |
| 56 | 3300005530 | Ga0070679_100045506 | Ga0070679_1000455063 | 202 |
| 57 | 3300005535 | Ga0070684_100010020 | Ga0070684_1000100204 | 202 |
| 58 | 3300005544 | Ga0070686_100642005 | Ga0070686_1006420051 | 202 |
| 59 | 3300005545 | Ga0070695_100035292 | Ga0070695_1000352922 | 202 |
| 60 | 3300005547 | Ga0070693_100030580 | Ga0070693_1000305804 | 202 |
| 61 | 3300005564 | Ga0070664_100005450 | Ga0070664_1000054506 | 202 |
| 62 | 3300005577 | Ga0068857_100003188 | Ga0068857_1000031886 | 202 |
| 63 | 3300005614 | Ga0068856_100004404 | Ga0068856_10000440414 | 202 |
| 64 | 3300005615 | Ga0070702_100003041 | Ga0070702_1000030416 | 202 |
| 65 | 3300005616 | Ga0068852_100026250 | Ga0068852_1000262502 | 202 |
| 66 | 3300005616 | Ga0068852_100050273 | Ga0068852_1000502734 | 202 |
| 67 | 3300005617 | Ga0068859_100040566 | Ga0068859_1000405664 | 202 |
| 68 | 3300005618 | Ga0068864_100029675 | Ga0068864_1000296754 | 202 |
| 69 | 3300005841 | Ga0068863_100013838 | Ga0068863_1000138386 | 202 |
| 70 | 3300005842 | Ga0068858_100117492 | Ga0068858_1001174921 | 202 |
| 71 | 3300005843 | Ga0068860_100006907 | Ga0068860_1000069075 | 202 |
| 72 | 3300006237 | Ga0097621_100012625 | Ga0097621_1000126256 | 202 |
| 73 | 3300006358 | Ga0068871_100020170 | Ga0068871_1000201704 | 202 |
| 74 | 3300006931 | Ga0097620_100040566 | Ga0097620_1000405664 | 202 |
| 75 | 3300009098 | Ga0105245_10004762 | Ga0105245_100047629 | 202 |
| 76 | 3300009098 | Ga0105245_10028583 | Ga0105245_100285834 | 202 |
| 77 | 3300009174 | Ga0105241_10003558 | Ga0105241_100035585 | 202 |
| 78 | 3300009176 | Ga0105242_10277538 | Ga0105242_102775382 | 202 |
| 79 | 3300009177 | Ga0105248_10015710 | Ga0105248_100157103 | 202 |
| 80 | 3300009177 | Ga0105248_10047581 | Ga0105248_100475813 | 202 |
| 81 | 3300010375 | Ga0105239_10012515 | Ga0105239_100125156 | 202 |
| 82 | 3300011119 | Ga0105246_10000533 | Ga0105246_100005336 | 202 |
| 83 | 3300013100 | Ga0157373_10044476 | Ga0157373_100444763 | 202 |
| 84 | 3300013307 | Ga0157372_10021746 | Ga0157372_100217466 | 202 |
| 85 | 3300013308 | Ga0157375_10007703 | Ga0157375_100077039 | 202 |
| 86 | 3300014325 | Ga0163163_10050780 | Ga0163163_100507804 | 202 |
| 87 | 3300014745 | Ga0157377_10001214 | Ga0157377_100012144 | 202 |
| 88 | 3300014968 | Ga0157379_10460801 | Ga0157379_104608012 | 202 |
| 89 | 3300014969 | Ga0157376_10021797 | Ga0157376_100217972 | 202 |
| 90 | 3300025911 | Ga0207654_10006351 | Ga0207654_100063514 | 202 |
| 91 | 3300025912 | Ga0207707_10008044 | Ga0207707_100080445 | 202 |
| 92 | 3300025913 | Ga0207695_10494519 | Ga0207695_104945192 | 202 |
| 93 | 3300025920 | Ga0207649_10001792 | Ga0207649_1000179212 | 202 |
| 94 | 3300025921 | Ga0207652_10052768 | Ga0207652_100527682 | 202 |
| 95 | 3300025926 | Ga0207659_10030744 | Ga0207659_100307443 | 202 |
| 96 | 3300025927 | Ga0207687_10004209 | Ga0207687_100042096 | 202 |
| 97 | 3300025933 | Ga0207706_10004509 | Ga0207706_1000450910 | 202 |
| 98 | 3300025941 | Ga0207711_10012482 | Ga0207711_100124826 | 202 |
| 99 | 3300025942 | Ga0207689_10000838 | Ga0207689_1000083822 | 202 |
| 100 | 3300025944 | Ga0207661_10002707 | Ga0207661_1000270712 | 202 |
| 101 | 3300025945 | Ga0207679_10098064 | Ga0207679_100980643 | 202 |
| 102 | 3300025960 | Ga0207651_10013040 | Ga0207651_100130403 | 202 |
| 103 | 3300026023 | Ga0207677_10034060 | Ga0207677_100340604 | 202 |
| 104 | 3300026035 | Ga0207703_10086685 | Ga0207703_100866853 | 202 |
| 105 | 3300026078 | Ga0207702_10008970 | Ga0207702_100089709 | 202 |
| 106 | 3300026088 | Ga0207641_10015530 | Ga0207641_100155303 | 202 |
| 107 | 3300026095 | Ga0207676_10006741 | Ga0207676_100067418 | 202 |
| 108 | 3300026116 | Ga0207674_10001189 | Ga0207674_1000118933 | 202 |
| 109 | 3300026142 | Ga0207698_10038232 | Ga0207698_100382324 | 202 |
| 110 | 3300028381 | Ga0268264_10007527 | Ga0268264_100075275 | 202 |
| 111 | 3300005535 | Ga0070684_100336089 | Ga0070684_1003360892 | 203 |
| 112 | 3300005614 | Ga0068856_100097012 | Ga0068856_1000970121 | 203 |
| 113 | 3300005614 | Ga0068856_100143304 | Ga0068856_1001433043 | 203 |
| 114 | 3300005614 | Ga0068856_100856444 | Ga0068856_1008564441 | 203 |
| 115 | 3300013307 | Ga0157372_10036682 | Ga0157372_100366824 | 203 |
| 116 | 3300017792 | Ga0163161_10587099 | Ga0163161_105870992 | 203 |
| 117 | 3300025941 | Ga0207711_10377280 | Ga0207711_103772802 | 203 |
| 118 | 3300025986 | Ga0207658_10294159 | Ga0207658_102941592 | 203 |
| 119 | 3300026078 | Ga0207702_10111929 | Ga0207702_101119293 | 203 |
| 120 | 3300026078 | Ga0207702_10149450 | Ga0207702_101494502 | 203 |
| 121 | 3300026095 | Ga0207676_10013795 | Ga0207676_100137954 | 203 |
| 122 | 3300035691 | Ga0373931_0274986 | Ga0373931_0274986_165_815 | 203 |
| 123 | 3300036401 | Ga0373937_0654475 | Ga0373937_0654475_95_745 | 203 |
| 124 | 3300042876 | Ga0451577_0000016 | Ga0451577_0000016_359416_360066 | 203 |
| 125 | 3300042876 | Ga0451577_0045506 | Ga0451577_0045506_2846_3496 | 203 |
| 126 | 3300042876 | Ga0451577_0623837 | Ga0451577_0623837_143_793 | 203 |
| 127 | 3300044712 | Ga0453684_0918023 | Ga0453684_0918023_99_749 | 203 |
| 128 | 3300005329 | Ga0070683_100336243 | Ga0070683_1003362432 | 204 |
| 129 | 3300005336 | Ga0070680_100000247 | Ga0070680_1000002473 | 204 |
| 130 | 3300005337 | Ga0070682_100295135 | Ga0070682_1002951352 | 204 |
| 131 | 3300005434 | Ga0070709_10203843 | Ga0070709_102038431 | 204 |
| 132 | 3300005458 | Ga0070681_10150059 | Ga0070681_101500592 | 204 |
| 133 | 3300005458 | Ga0070681_10324247 | Ga0070681_103242472 | 204 |
| 134 | 3300005535 | Ga0070684_100319602 | Ga0070684_1003196022 | 204 |
| 135 | 3300005536 | Ga0070697_100448262 | Ga0070697_1004482622 | 204 |
| 136 | 3300009147 | Ga0114129_10544237 | Ga0114129_105442371 | 204 |
| 137 | 3300013100 | Ga0157373_10309231 | Ga0157373_103092311 | 204 |
| 138 | 3300013105 | Ga0157369_10231304 | Ga0157369_102313043 | 204 |
| 139 | 3300014325 | Ga0163163_10399946 | Ga0163163_103999462 | 204 |
| 140 | 3300025912 | Ga0207707_10264225 | Ga0207707_102642252 | 204 |
| 141 | 3300025913 | Ga0207695_10055931 | Ga0207695_100559312 | 204 |
| 142 | 3300025917 | Ga0207660_10000019 | Ga0207660_100000195 | 204 |
| 143 | 3300025944 | Ga0207661_10221446 | Ga0207661_102214462 | 204 |
| 144 | 3300039437 | Ga0436365_0262337 | Ga0436365_0262337_2185_2868 | 204 |
| 145 | 3300039437 | Ga0436365_0614410 | Ga0436365_0614410_70_702 | 204 |
| 146 | 3300046517 | Ga0495630_0265247 | Ga0495630_0265247_655_1287 | 204 |
| 147 | 3300048915 | Ga0496112_0088854 | Ga0496112_0088854_149_763 | 204 |
| 148 | 3300048916 | Ga0496113_0014762 | Ga0496113_0014762_3136_3750 | 204 |
| 149 | 3300049570 | Ga0501033_0026915 | Ga0501033_0026915_2211_2843 | 204 |
| 150 | 3300049571 | Ga0501034_0023281 | Ga0501034_0023281_171_803 | 204 |
| 151 | 3300049580 | Ga0501046_0391768 | Ga0501046_0391768_133_765 | 204 |
| 152 | 3300049581 | Ga0501047_0030185 | Ga0501047_0030185_2254_2886 | 204 |
| 153 | 3300049653 | Ga0501206_020164 | Ga0501206_020164_30_653 | 204 |
| 154 | 3300049668 | Ga0501233_065594 | Ga0501233_065594_272_895 | 204 |
| 155 | 3300049688 | Ga0501259_064161 | Ga0501259_064161_16_639 | 204 |
| 156 | 3300049742 | Ga0501080_0102262 | Ga0501080_0102262_1046_1678 | 204 |
| 157 | 3300049742 | Ga0501080_1112539 | Ga0501080_1112539_37_654 | 204 |
| 158 | 3300049822 | Ga0501035_0028174 | Ga0501035_0028174_2013_2645 | 204 |
| 159 | 3300049823 | Ga0501044_0042149 | Ga0501044_0042149_2649_3281 | 204 |
| 160 | 3300050507 | nmdc:mga05p37_1508813_c1 | nmdc:mga05p37_1508813_c1_20_643 | 204 |
| 161 | 3300050511 | nmdc:mga08y16_335477_c1 | nmdc:mga08y16_335477_c1_16_639 | 204 |
| 162 | 3300050512 | nmdc:mga0n895_342946_c1 | nmdc:mga0n895_342946_c1_770_1393 | 204 |
| 163 | 3300005530 | Ga0070679_100092366 | Ga0070679_1000923662 | 205 |
| 164 | 3300025921 | Ga0207652_10069352 | Ga0207652_100693523 | 205 |
| 165 | 3300045976 | Ga0466967_0147298 | Ga0466967_0147298_1148_1783 | 205 |
| 166 | 3300049569 | Ga0501032_0261876 | Ga0501032_0261876_311_961 | 205 |
| 167 | 3300005530 | Ga0070679_100469149 | Ga0070679_1004691492 | 206 |
| 168 | 3300009551 | Ga0105238_10542294 | Ga0105238_105422942 | 206 |
| 169 | 3300025909 | Ga0207705_10510233 | Ga0207705_105102332 | 206 |
| 170 | 3300035086 | Ga0373934_0009118 | Ga0373934_0009118_342_986 | 206 |
| 171 | 3300035111 | Ga0373923_0048579 | Ga0373923_0048579_1001_1645 | 206 |
| 172 | 3300035119 | Ga0373956_0010506 | Ga0373956_0010506_1638_2282 | 206 |
| 173 | 3300035120 | Ga0373957_0105396 | Ga0373957_0105396_418_1062 | 206 |
| 174 | 3300035410 | Ga0373924_0110981 | Ga0373924_0110981_110_754 | 206 |
| 175 | 3300035692 | Ga0373935_0259841 | Ga0373935_0259841_283_927 | 206 |
| 176 | 3300035724 | Ga0373933_0005918 | Ga0373933_0005918_5353_5997 | 206 |
| 177 | 3300036401 | Ga0373937_0009784 | Ga0373937_0009784_1590_2234 | 206 |
| 178 | 3300046454 | Ga0495592_0069656 | Ga0495592_0069656_1724_2368 | 206 |
| 179 | 3300046462 | Ga0495651_0001301 | Ga0495651_0001301_14663_15307 | 206 |
| 180 | 3300046463 | Ga0495653_0017208 | Ga0495653_0017208_2196_2840 | 206 |
| 181 | 3300046477 | Ga0495664_0067927 | Ga0495664_0067927_1408_2052 | 206 |
| 182 | 3300046511 | Ga0495608_0009500 | Ga0495608_0009500_828_1472 | 206 |
| 183 | 3300046514 | Ga0495618_0453374 | Ga0495618_0453374_43_687 | 206 |
| 184 | 3300046516 | Ga0495628_0000494 | Ga0495628_0000494_183_827 | 206 |
| 185 | 3300046529 | Ga0495652_0004653 | Ga0495652_0004653_7083_7727 | 206 |
| 186 | 3300046536 | Ga0495587_0000269 | Ga0495587_0000269_2128_2772 | 206 |
| 187 | 3300046543 | Ga0495645_0076410 | Ga0495645_0076410_1571_2215 | 206 |
| 188 | 3300046559 | Ga0495667_0090743 | Ga0495667_0090743_118_762 | 206 |
| 189 | 3300046663 | Ga0495635_0000200 | Ga0495635_0000200_2785_3429 | 206 |
| 190 | 3300046675 | Ga0495657_0001237 | Ga0495657_0001237_4945_5589 | 206 |
| 191 | 3300046678 | Ga0495599_0004010 | Ga0495599_0004010_2043_2687 | 206 |
| 192 | 3300046679 | Ga0495623_0000156 | Ga0495623_0000156_39781_40425 | 206 |
| 193 | 3300046680 | Ga0495646_0139099 | Ga0495646_0139099_345_989 | 206 |
| 194 | 3300046689 | Ga0495613_0345732 | Ga0495613_0345732_162_806 | 206 |
| 195 | 3300046809 | Ga0495600_0005770 | Ga0495600_0005770_5644_6288 | 206 |
| 196 | 3300047319 | Ga0495674_0004839 | Ga0495674_0004839_7690_8334 | 206 |
| 197 | 3300047322 | Ga0495680_0432590 | Ga0495680_0432590_88_732 | 206 |
| 198 | 3300047444 | Ga0495675_0058505 | Ga0495675_0058505_1668_2312 | 206 |
| 199 | 3300047471 | Ga0495684_0028480 | Ga0495684_0028480_1581_2225 | 206 |
| 200 | 3300048088 | Ga0495602_0022321 | Ga0495602_0022321_5477_6121 | 206 |
| 201 | 3300048918 | Ga0496115_0128735 | Ga0496115_0128735_655_1275 | 206 |
| 202 | 3300053077 | Ga0495601_0088017 | Ga0495601_0088017_858_1502 | 206 |
| 203 | 3300053078 | Ga0495612_0074613 | Ga0495612_0074613_445_1089 | 206 |
| 204 | 3300053084 | Ga0495595_0311602 | Ga0495595_0311602_60_704 | 206 |
| 205 | 3300053085 | Ga0495619_0076356 | Ga0495619_0076356_1546_2190 | 206 |
| 206 | 3300006847 | Ga0075431_100115542 | Ga0075431_1001155423 | 207 |
| 207 | 3300031824 | Ga0307413_10066930 | Ga0307413_100669302 | 207 |
| 208 | 3300031901 | Ga0307406_10244351 | Ga0307406_102443512 | 207 |
| 209 | 3300031911 | Ga0307412_10302608 | Ga0307412_103026082 | 207 |
| 210 | 3300031911 | Ga0307412_10552150 | Ga0307412_105521501 | 207 |
| 211 | 3300031995 | Ga0307409_100115909 | Ga0307409_1001159092 | 207 |
| 212 | 3300032126 | Ga0307415_100238943 | Ga0307415_1002389432 | 207 |
| 213 | 3300049576 | Ga0501040_0085139 | Ga0501040_0085139_394_1038 | 207 |
| 214 | 3300049578 | Ga0501042_0629947 | Ga0501042_0629947_74_718 | 207 |
| 215 | 3300049592 | Ga0501076_0071229 | Ga0501076_0071229_1658_2302 | 207 |
| 216 | 3300049688 | Ga0501259_011575 | Ga0501259_011575_126_749 | 207 |
| 217 | 3300049741 | Ga0501079_0330498 | Ga0501079_0330498_312_956 | 207 |
| 218 | 3300049742 | Ga0501080_0442693 | Ga0501080_0442693_458_1102 | 207 |
| 219 | 3300049743 | Ga0501081_0412949 | Ga0501081_0412949_70_714 | 207 |
| 220 | 3300049824 | Ga0501045_0351037 | Ga0501045_0351037_28_672 | 207 |
| 221 | 3300050509 | nmdc:mga0qj67_422506_c1 | nmdc:mga0qj67_422506_c1_260_904 | 207 |
| 222 | 3300001990 | JGI24737J22298_10029355 | JGI24737J22298_100293552 | 208 |
| 223 | 3300002070 | JGI24750J21931_1003346 | JGI24750J21931_10033462 | 208 |
| 224 | 3300005295 | Ga0065707_10210518 | Ga0065707_102105182 | 208 |
| 225 | 3300005327 | Ga0070658_10023333 | Ga0070658_100233332 | 208 |
| 226 | 3300005327 | Ga0070658_10056809 | Ga0070658_100568091 | 208 |
| 227 | 3300005327 | Ga0070658_10380678 | Ga0070658_103806781 | 208 |
| 228 | 3300005327 | Ga0070658_10653978 | Ga0070658_106539781 | 208 |
| 229 | 3300005328 | Ga0070676_10008120 | Ga0070676_100081204 | 208 |
| 230 | 3300005328 | Ga0070676_10081692 | Ga0070676_100816922 | 208 |
| 231 | 3300005328 | Ga0070676_10093313 | Ga0070676_100933132 | 208 |
| 232 | 3300005329 | Ga0070683_100000681 | Ga0070683_10000068123 | 208 |
| 233 | 3300005329 | Ga0070683_100022880 | Ga0070683_1000228802 | 208 |
| 234 | 3300005329 | Ga0070683_100041535 | Ga0070683_1000415354 | 208 |
| 235 | 3300005329 | Ga0070683_100179991 | Ga0070683_1001799913 | 208 |
| 236 | 3300005331 | Ga0070670_100171030 | Ga0070670_1001710302 | 208 |
| 237 | 3300005331 | Ga0070670_100188933 | Ga0070670_1001889332 | 208 |
| 238 | 3300005331 | Ga0070670_100290336 | Ga0070670_1002903361 | 208 |
| 239 | 3300005331 | Ga0070670_100479235 | Ga0070670_1004792352 | 208 |
| 240 | 3300005334 | Ga0068869_100003185 | Ga0068869_1000031854 | 208 |
| 241 | 3300005334 | Ga0068869_100997942 | Ga0068869_1009979421 | 208 |
| 242 | 3300005335 | Ga0070666_10113294 | Ga0070666_101132942 | 208 |
| 243 | 3300005336 | Ga0070680_100050750 | Ga0070680_1000507503 | 208 |
| 244 | 3300005336 | Ga0070680_100073293 | Ga0070680_1000732932 | 208 |
| 245 | 3300005338 | Ga0068868_100037170 | Ga0068868_1000371702 | 208 |
| 246 | 3300005339 | Ga0070660_100025284 | Ga0070660_1000252844 | 208 |
| 247 | 3300005340 | Ga0070689_100003792 | Ga0070689_1000037927 | 208 |
| 248 | 3300005340 | Ga0070689_100009066 | Ga0070689_1000090664 | 208 |
| 249 | 3300005340 | Ga0070689_100542484 | Ga0070689_1005424842 | 208 |
| 250 | 3300005343 | Ga0070687_100009043 | Ga0070687_1000090434 | 208 |
| 251 | 3300005344 | Ga0070661_100005547 | Ga0070661_1000055476 | 208 |
| 252 | 3300005344 | Ga0070661_100065231 | Ga0070661_1000652312 | 208 |
| 253 | 3300005344 | Ga0070661_100066085 | Ga0070661_1000660852 | 208 |
| 254 | 3300005344 | Ga0070661_100117045 | Ga0070661_1001170452 | 208 |
| 255 | 3300005347 | Ga0070668_100004050 | Ga0070668_1000040504 | 208 |
| 256 | 3300005353 | Ga0070669_100002374 | Ga0070669_10000237412 | 208 |
| 257 | 3300005353 | Ga0070669_100017185 | Ga0070669_1000171854 | 208 |
| 258 | 3300005353 | Ga0070669_100024551 | Ga0070669_1000245513 | 208 |
| 259 | 3300005353 | Ga0070669_100189645 | Ga0070669_1001896452 | 208 |
| 260 | 3300005354 | Ga0070675_100010741 | Ga0070675_1000107413 | 208 |
| 261 | 3300005354 | Ga0070675_100011278 | Ga0070675_1000112784 | 208 |
| 262 | 3300005354 | Ga0070675_100032429 | Ga0070675_1000324292 | 208 |
| 263 | 3300005355 | Ga0070671_100007736 | Ga0070671_1000077366 | 208 |
| 264 | 3300005356 | Ga0070674_100072016 | Ga0070674_1000720162 | 208 |
| 265 | 3300005356 | Ga0070674_100535292 | Ga0070674_1005352921 | 208 |
| 266 | 3300005364 | Ga0070673_100016912 | Ga0070673_1000169123 | 208 |
| 267 | 3300005364 | Ga0070673_100064374 | Ga0070673_1000643742 | 208 |
| 268 | 3300005364 | Ga0070673_100322686 | Ga0070673_1003226861 | 208 |
| 269 | 3300005365 | Ga0070688_100010739 | Ga0070688_1000107394 | 208 |
| 270 | 3300005365 | Ga0070688_100026534 | Ga0070688_1000265344 | 208 |
| 271 | 3300005366 | Ga0070659_100225117 | Ga0070659_1002251172 | 208 |
| 272 | 3300005367 | Ga0070667_100004361 | Ga0070667_10000436110 | 208 |
| 273 | 3300005367 | Ga0070667_100024900 | Ga0070667_1000249003 | 208 |
| 274 | 3300005367 | Ga0070667_100273902 | Ga0070667_1002739022 | 208 |
| 275 | 3300005435 | Ga0070714_100073555 | Ga0070714_1000735553 | 208 |
| 276 | 3300005438 | Ga0070701_10223408 | Ga0070701_102234081 | 208 |
| 277 | 3300005439 | Ga0070711_100817716 | Ga0070711_1008177161 | 208 |
| 278 | 3300005441 | Ga0070700_100101883 | Ga0070700_1001018832 | 208 |
| 279 | 3300005444 | Ga0070694_100092001 | Ga0070694_1000920012 | 208 |
| 280 | 3300005444 | Ga0070694_100127279 | Ga0070694_1001272792 | 208 |
| 281 | 3300005456 | Ga0070678_100368950 | Ga0070678_1003689502 | 208 |
| 282 | 3300005457 | Ga0070662_100010640 | Ga0070662_1000106402 | 208 |
| 283 | 3300005457 | Ga0070662_100079870 | Ga0070662_1000798703 | 208 |
| 284 | 3300005459 | Ga0068867_100019037 | Ga0068867_1000190372 | 208 |
| 285 | 3300005459 | Ga0068867_100042966 | Ga0068867_1000429663 | 208 |
| 286 | 3300005459 | Ga0068867_100143437 | Ga0068867_1001434372 | 208 |
| 287 | 3300005459 | Ga0068867_100265492 | Ga0068867_1002654921 | 208 |
| 288 | 3300005471 | Ga0070698_100099851 | Ga0070698_1000998513 | 208 |
| 289 | 3300005518 | Ga0070699_100200961 | Ga0070699_1002009612 | 208 |
| 290 | 3300005530 | Ga0070679_100163588 | Ga0070679_1001635882 | 208 |
| 291 | 3300005530 | Ga0070679_100189309 | Ga0070679_1001893092 | 208 |
| 292 | 3300005535 | Ga0070684_100004716 | Ga0070684_1000047168 | 208 |
| 293 | 3300005535 | Ga0070684_100006298 | Ga0070684_1000062986 | 208 |
| 294 | 3300005535 | Ga0070684_100012054 | Ga0070684_1000120546 | 208 |
| 295 | 3300005535 | Ga0070684_100146696 | Ga0070684_1001466963 | 208 |
| 296 | 3300005539 | Ga0068853_100008061 | Ga0068853_1000080615 | 208 |
| 297 | 3300005539 | Ga0068853_100024434 | Ga0068853_1000244345 | 208 |
| 298 | 3300005539 | Ga0068853_100590022 | Ga0068853_1005900222 | 208 |
| 299 | 3300005543 | Ga0070672_100029789 | Ga0070672_1000297892 | 208 |
| 300 | 3300005543 | Ga0070672_100071261 | Ga0070672_1000712613 | 208 |
| 301 | 3300005543 | Ga0070672_100098231 | Ga0070672_1000982311 | 208 |
| 302 | 3300005543 | Ga0070672_100103354 | Ga0070672_1001033542 | 208 |
| 303 | 3300005543 | Ga0070672_100228072 | Ga0070672_1002280722 | 208 |
| 304 | 3300005543 | Ga0070672_100558084 | Ga0070672_1005580841 | 208 |
| 305 | 3300005544 | Ga0070686_100763456 | Ga0070686_1007634561 | 208 |
| 306 | 3300005548 | Ga0070665_100181608 | Ga0070665_1001816082 | 208 |
| 307 | 3300005563 | Ga0068855_100059280 | Ga0068855_1000592805 | 208 |
| 308 | 3300005563 | Ga0068855_100087932 | Ga0068855_1000879324 | 208 |
| 309 | 3300005563 | Ga0068855_100294924 | Ga0068855_1002949242 | 208 |
| 310 | 3300005563 | Ga0068855_100333925 | Ga0068855_1003339252 | 208 |
| 311 | 3300005564 | Ga0070664_100010643 | Ga0070664_1000106437 | 208 |
| 312 | 3300005564 | Ga0070664_100013631 | Ga0070664_1000136312 | 208 |
| 313 | 3300005564 | Ga0070664_100033122 | Ga0070664_1000331222 | 208 |
| 314 | 3300005564 | Ga0070664_100100588 | Ga0070664_1001005883 | 208 |
| 315 | 3300005564 | Ga0070664_100127605 | Ga0070664_1001276052 | 208 |
| 316 | 3300005564 | Ga0070664_100543652 | Ga0070664_1005436522 | 208 |
| 317 | 3300005577 | Ga0068857_100012828 | Ga0068857_1000128286 | 208 |
| 318 | 3300005577 | Ga0068857_100027471 | Ga0068857_1000274714 | 208 |
| 319 | 3300005577 | Ga0068857_100030916 | Ga0068857_1000309164 | 208 |
| 320 | 3300005577 | Ga0068857_100078648 | Ga0068857_1000786482 | 208 |
| 321 | 3300005578 | Ga0068854_100075120 | Ga0068854_1000751203 | 208 |
| 322 | 3300005578 | Ga0068854_100584085 | Ga0068854_1005840852 | 208 |
| 323 | 3300005578 | Ga0068854_101185395 | Ga0068854_1011853951 | 208 |
| 324 | 3300005615 | Ga0070702_100157770 | Ga0070702_1001577702 | 208 |
| 325 | 3300005616 | Ga0068852_100006303 | Ga0068852_1000063038 | 208 |
| 326 | 3300005616 | Ga0068852_100055451 | Ga0068852_1000554513 | 208 |
| 327 | 3300005616 | Ga0068852_100192660 | Ga0068852_1001926602 | 208 |
| 328 | 3300005616 | Ga0068852_100720371 | Ga0068852_1007203712 | 208 |
| 329 | 3300005617 | Ga0068859_100132524 | Ga0068859_1001325242 | 208 |
| 330 | 3300005617 | Ga0068859_100182395 | Ga0068859_1001823953 | 208 |
| 331 | 3300005719 | Ga0068861_100014363 | Ga0068861_1000143634 | 208 |
| 332 | 3300005719 | Ga0068861_100031208 | Ga0068861_1000312083 | 208 |
| 333 | 3300005719 | Ga0068861_100523339 | Ga0068861_1005233392 | 208 |
| 334 | 3300005719 | Ga0068861_100740408 | Ga0068861_1007404081 | 208 |
| 335 | 3300005834 | Ga0068851_10003188 | Ga0068851_100031886 | 208 |
| 336 | 3300005840 | Ga0068870_10012379 | Ga0068870_100123793 | 208 |
| 337 | 3300005840 | Ga0068870_10094352 | Ga0068870_100943522 | 208 |
| 338 | 3300005841 | Ga0068863_100178298 | Ga0068863_1001782983 | 208 |
| 339 | 3300005841 | Ga0068863_100875417 | Ga0068863_1008754172 | 208 |
| 340 | 3300005842 | Ga0068858_100012176 | Ga0068858_1000121764 | 208 |
| 341 | 3300005842 | Ga0068858_100082269 | Ga0068858_1000822693 | 208 |
| 342 | 3300005842 | Ga0068858_100086564 | Ga0068858_1000865642 | 208 |
| 343 | 3300005843 | Ga0068860_100014614 | Ga0068860_1000146146 | 208 |
| 344 | 3300005843 | Ga0068860_100166983 | Ga0068860_1001669832 | 208 |
| 345 | 3300005844 | Ga0068862_100008006 | Ga0068862_1000080062 | 208 |
| 346 | 3300005985 | Ga0081539_10012248 | Ga0081539_100122483 | 208 |
| 347 | 3300006358 | Ga0068871_100753928 | Ga0068871_1007539281 | 208 |
| 348 | 3300006844 | Ga0075428_100160807 | Ga0075428_1001608072 | 208 |
| 349 | 3300006844 | Ga0075428_100209060 | Ga0075428_1002090602 | 208 |
| 350 | 3300006844 | Ga0075428_100418508 | Ga0075428_1004185082 | 208 |
| 351 | 3300006846 | Ga0075430_100039628 | Ga0075430_1000396283 | 208 |
| 352 | 3300006847 | Ga0075431_100061920 | Ga0075431_1000619204 | 208 |
| 353 | 3300006847 | Ga0075431_100131271 | Ga0075431_1001312712 | 208 |
| 354 | 3300006852 | Ga0075433_10013303 | Ga0075433_100133034 | 208 |
| 355 | 3300006871 | Ga0075434_100008741 | Ga0075434_1000087412 | 208 |
| 356 | 3300006871 | Ga0075434_100365309 | Ga0075434_1003653091 | 208 |
| 357 | 3300006880 | Ga0075429_100031032 | Ga0075429_1000310325 | 208 |
| 358 | 3300006880 | Ga0075429_100064042 | Ga0075429_1000640423 | 208 |
| 359 | 3300006880 | Ga0075429_100124743 | Ga0075429_1001247433 | 208 |
| 360 | 3300006881 | Ga0068865_100009369 | Ga0068865_1000093694 | 208 |
| 361 | 3300006881 | Ga0068865_100123076 | Ga0068865_1001230763 | 208 |
| 362 | 3300006881 | Ga0068865_100283830 | Ga0068865_1002838302 | 208 |
| 363 | 3300006931 | Ga0097620_100132517 | Ga0097620_1001325173 | 208 |
| 364 | 3300006931 | Ga0097620_100182391 | Ga0097620_1001823913 | 208 |
| 365 | 3300007076 | Ga0075435_100337712 | Ga0075435_1003377122 | 208 |
| 366 | 3300009093 | Ga0105240_10008178 | Ga0105240_1000817814 | 208 |
| 367 | 3300009093 | Ga0105240_10289202 | Ga0105240_102892022 | 208 |
| 368 | 3300009094 | Ga0111539_10034268 | Ga0111539_100342683 | 208 |
| 369 | 3300009094 | Ga0111539_10112864 | Ga0111539_101128643 | 208 |
| 370 | 3300009094 | Ga0111539_10216851 | Ga0111539_102168512 | 208 |
| 371 | 3300009094 | Ga0111539_10264150 | Ga0111539_102641502 | 208 |
| 372 | 3300009098 | Ga0105245_10114634 | Ga0105245_101146343 | 208 |
| 373 | 3300009147 | Ga0114129_10039108 | Ga0114129_100391082 | 208 |
| 374 | 3300009148 | Ga0105243_10048333 | Ga0105243_100483333 | 208 |
| 375 | 3300009176 | Ga0105242_10016201 | Ga0105242_100162012 | 208 |
| 376 | 3300009177 | Ga0105248_10016255 | Ga0105248_100162553 | 208 |
| 377 | 3300009177 | Ga0105248_10082569 | Ga0105248_100825692 | 208 |
| 378 | 3300009177 | Ga0105248_10142839 | Ga0105248_101428392 | 208 |
| 379 | 3300009177 | Ga0105248_10315860 | Ga0105248_103158602 | 208 |
| 380 | 3300009545 | Ga0105237_10638173 | Ga0105237_106381732 | 208 |
| 381 | 3300009551 | Ga0105238_10111041 | Ga0105238_101110413 | 208 |
| 382 | 3300009551 | Ga0105238_10353815 | Ga0105238_103538151 | 208 |
| 383 | 3300009553 | Ga0105249_10000401 | Ga0105249_100004018 | 208 |
| 384 | 3300009553 | Ga0105249_10025142 | Ga0105249_100251424 | 208 |
| 385 | 3300009553 | Ga0105249_10501733 | Ga0105249_105017332 | 208 |
| 386 | 3300010375 | Ga0105239_10025212 | Ga0105239_100252127 | 208 |
| 387 | 3300011119 | Ga0105246_10625396 | Ga0105246_106253962 | 208 |
| 388 | 3300013100 | Ga0157373_10398658 | Ga0157373_103986582 | 208 |
| 389 | 3300013102 | Ga0157371_10020222 | Ga0157371_100202224 | 208 |
| 390 | 3300013104 | Ga0157370_10011107 | Ga0157370_1001110710 | 208 |
| 391 | 3300013104 | Ga0157370_10036679 | Ga0157370_100366795 | 208 |
| 392 | 3300013104 | Ga0157370_10075470 | Ga0157370_100754702 | 208 |
| 393 | 3300013104 | Ga0157370_10315934 | Ga0157370_103159341 | 208 |
| 394 | 3300013105 | Ga0157369_10017079 | Ga0157369_100170794 | 208 |
| 395 | 3300013105 | Ga0157369_10100386 | Ga0157369_101003861 | 208 |
| 396 | 3300013105 | Ga0157369_10202695 | Ga0157369_102026951 | 208 |
| 397 | 3300013296 | Ga0157374_10046567 | Ga0157374_100465674 | 208 |
| 398 | 3300013296 | Ga0157374_10376654 | Ga0157374_103766542 | 208 |
| 399 | 3300013306 | Ga0163162_10006251 | Ga0163162_100062514 | 208 |
| 400 | 3300013306 | Ga0163162_10093767 | Ga0163162_100937673 | 208 |
| 401 | 3300013306 | Ga0163162_10376346 | Ga0163162_103763462 | 208 |
| 402 | 3300013307 | Ga0157372_10012289 | Ga0157372_100122894 | 208 |
| 403 | 3300013307 | Ga0157372_10018962 | Ga0157372_100189626 | 208 |
| 404 | 3300013307 | Ga0157372_10290894 | Ga0157372_102908941 | 208 |
| 405 | 3300013307 | Ga0157372_10458506 | Ga0157372_104585062 | 208 |
| 406 | 3300013307 | Ga0157372_10765478 | Ga0157372_107654781 | 208 |
| 407 | 3300013308 | Ga0157375_10155663 | Ga0157375_101556632 | 208 |
| 408 | 3300013308 | Ga0157375_10162094 | Ga0157375_101620942 | 208 |
| 409 | 3300013308 | Ga0157375_10537380 | Ga0157375_105373802 | 208 |
| 410 | 3300013308 | Ga0157375_10891209 | Ga0157375_108912092 | 208 |
| 411 | 3300014325 | Ga0163163_10199473 | Ga0163163_101994732 | 208 |
| 412 | 3300014326 | Ga0157380_10002943 | Ga0157380_1000294310 | 208 |
| 413 | 3300014326 | Ga0157380_10159520 | Ga0157380_101595202 | 208 |
| 414 | 3300014326 | Ga0157380_10383867 | Ga0157380_103838672 | 208 |
| 415 | 3300014968 | Ga0157379_10002779 | Ga0157379_100027795 | 208 |
| 416 | 3300014969 | Ga0157376_11253349 | Ga0157376_112533491 | 208 |
| 417 | 3300017792 | Ga0163161_10061252 | Ga0163161_100612522 | 208 |
| 418 | 3300020070 | Ga0206356_11452365 | Ga0206356_114523652 | 208 |
| 419 | 3300020082 | Ga0206353_10829339 | Ga0206353_108293392 | 208 |
| 420 | 3300025315 | Ga0207697_10004114 | Ga0207697_100041146 | 208 |
| 421 | 3300025321 | Ga0207656_10008725 | Ga0207656_100087253 | 208 |
| 422 | 3300025893 | Ga0207682_10022945 | Ga0207682_100229452 | 208 |
| 423 | 3300025901 | Ga0207688_10008758 | Ga0207688_100087582 | 208 |
| 424 | 3300025903 | Ga0207680_10145851 | Ga0207680_101458512 | 208 |
| 425 | 3300025903 | Ga0207680_10324758 | Ga0207680_103247582 | 208 |
| 426 | 3300025904 | Ga0207647_10091023 | Ga0207647_100910232 | 208 |
| 427 | 3300025907 | Ga0207645_10000246 | Ga0207645_100002464 | 208 |
| 428 | 3300025907 | Ga0207645_10046076 | Ga0207645_100460762 | 208 |
| 429 | 3300025907 | Ga0207645_10399763 | Ga0207645_103997632 | 208 |
| 430 | 3300025908 | Ga0207643_10005735 | Ga0207643_100057354 | 208 |
| 431 | 3300025909 | Ga0207705_10008483 | Ga0207705_100084832 | 208 |
| 432 | 3300025909 | Ga0207705_10027463 | Ga0207705_100274633 | 208 |
| 433 | 3300025909 | Ga0207705_10337446 | Ga0207705_103374462 | 208 |
| 434 | 3300025912 | Ga0207707_10034532 | Ga0207707_100345321 | 208 |
| 435 | 3300025912 | Ga0207707_10609740 | Ga0207707_106097402 | 208 |
| 436 | 3300025913 | Ga0207695_10015068 | Ga0207695_100150682 | 208 |
| 437 | 3300025913 | Ga0207695_10049287 | Ga0207695_100492872 | 208 |
| 438 | 3300025913 | Ga0207695_10202071 | Ga0207695_102020712 | 208 |
| 439 | 3300025914 | Ga0207671_10725906 | Ga0207671_107259061 | 208 |
| 440 | 3300025917 | Ga0207660_10193439 | Ga0207660_101934392 | 208 |
| 441 | 3300025918 | Ga0207662_10001341 | Ga0207662_100013418 | 208 |
| 442 | 3300025919 | Ga0207657_10035139 | Ga0207657_100351392 | 208 |
| 443 | 3300025919 | Ga0207657_10047429 | Ga0207657_100474292 | 208 |
| 444 | 3300025920 | Ga0207649_10141668 | Ga0207649_101416682 | 208 |
| 445 | 3300025920 | Ga0207649_10404344 | Ga0207649_104043442 | 208 |
| 446 | 3300025921 | Ga0207652_10040959 | Ga0207652_100409594 | 208 |
| 447 | 3300025921 | Ga0207652_10502895 | Ga0207652_105028951 | 208 |
| 448 | 3300025923 | Ga0207681_10004605 | Ga0207681_100046054 | 208 |
| 449 | 3300025923 | Ga0207681_10010274 | Ga0207681_100102743 | 208 |
| 450 | 3300025924 | Ga0207694_10048137 | Ga0207694_100481373 | 208 |
| 451 | 3300025925 | Ga0207650_10028491 | Ga0207650_100284914 | 208 |
| 452 | 3300025926 | Ga0207659_10008740 | Ga0207659_100087404 | 208 |
| 453 | 3300025926 | Ga0207659_10093133 | Ga0207659_100931332 | 208 |
| 454 | 3300025929 | Ga0207664_10019391 | Ga0207664_100193915 | 208 |
| 455 | 3300025932 | Ga0207690_10224469 | Ga0207690_102244692 | 208 |
| 456 | 3300025932 | Ga0207690_10566392 | Ga0207690_105663921 | 208 |
| 457 | 3300025933 | Ga0207706_10000357 | Ga0207706_100003574 | 208 |
| 458 | 3300025934 | Ga0207686_10041324 | Ga0207686_100413242 | 208 |
| 459 | 3300025937 | Ga0207669_10166423 | Ga0207669_101664232 | 208 |
| 460 | 3300025937 | Ga0207669_10212592 | Ga0207669_102125921 | 208 |
| 461 | 3300025937 | Ga0207669_10533466 | Ga0207669_105334662 | 208 |
| 462 | 3300025938 | Ga0207704_10011553 | Ga0207704_100115534 | 208 |
| 463 | 3300025938 | Ga0207704_10093293 | Ga0207704_100932932 | 208 |
| 464 | 3300025938 | Ga0207704_10454829 | Ga0207704_104548292 | 208 |
| 465 | 3300025940 | Ga0207691_10001314 | Ga0207691_1000131411 | 208 |
| 466 | 3300025940 | Ga0207691_10001355 | Ga0207691_1000135521 | 208 |
| 467 | 3300025940 | Ga0207691_10002440 | Ga0207691_100024408 | 208 |
| 468 | 3300025940 | Ga0207691_10017747 | Ga0207691_100177472 | 208 |
| 469 | 3300025940 | Ga0207691_10023156 | Ga0207691_100231562 | 208 |
| 470 | 3300025940 | Ga0207691_10114299 | Ga0207691_101142992 | 208 |
| 471 | 3300025941 | Ga0207711_10188200 | Ga0207711_101882002 | 208 |
| 472 | 3300025941 | Ga0207711_10402317 | Ga0207711_104023172 | 208 |
| 473 | 3300025942 | Ga0207689_10001360 | Ga0207689_100013606 | 208 |
| 474 | 3300025944 | Ga0207661_10012163 | Ga0207661_100121633 | 208 |
| 475 | 3300025944 | Ga0207661_10016359 | Ga0207661_100163592 | 208 |
| 476 | 3300025944 | Ga0207661_10450574 | Ga0207661_104505742 | 208 |
| 477 | 3300025944 | Ga0207661_10559334 | Ga0207661_105593342 | 208 |
| 478 | 3300025945 | Ga0207679_10001293 | Ga0207679_100012936 | 208 |
| 479 | 3300025945 | Ga0207679_10073037 | Ga0207679_100730372 | 208 |
| 480 | 3300025945 | Ga0207679_10089529 | Ga0207679_100895291 | 208 |
| 481 | 3300025945 | Ga0207679_10214924 | Ga0207679_102149242 | 208 |
| 482 | 3300025945 | Ga0207679_10910136 | Ga0207679_109101361 | 208 |
| 483 | 3300025949 | Ga0207667_10067852 | Ga0207667_100678522 | 208 |
| 484 | 3300025949 | Ga0207667_10247351 | Ga0207667_102473513 | 208 |
| 485 | 3300025949 | Ga0207667_10647948 | Ga0207667_106479482 | 208 |
| 486 | 3300025960 | Ga0207651_10221656 | Ga0207651_102216562 | 208 |
| 487 | 3300025960 | Ga0207651_10255050 | Ga0207651_102550502 | 208 |
| 488 | 3300025961 | Ga0207712_10004798 | Ga0207712_100047983 | 208 |
| 489 | 3300025961 | Ga0207712_10294845 | Ga0207712_102948452 | 208 |
| 490 | 3300025972 | Ga0207668_10030244 | Ga0207668_100302444 | 208 |
| 491 | 3300025972 | Ga0207668_10100358 | Ga0207668_101003582 | 208 |
| 492 | 3300025972 | Ga0207668_10163630 | Ga0207668_101636302 | 208 |
| 493 | 3300025972 | Ga0207668_10237780 | Ga0207668_102377802 | 208 |
| 494 | 3300025972 | Ga0207668_10784366 | Ga0207668_107843661 | 208 |
| 495 | 3300025981 | Ga0207640_10018594 | Ga0207640_100185942 | 208 |
| 496 | 3300025981 | Ga0207640_10350857 | Ga0207640_103508572 | 208 |
| 497 | 3300025986 | Ga0207658_10019166 | Ga0207658_100191662 | 208 |
| 498 | 3300025986 | Ga0207658_10635455 | Ga0207658_106354552 | 208 |
| 499 | 3300026035 | Ga0207703_10005549 | Ga0207703_100055496 | 208 |
| 500 | 3300026035 | Ga0207703_10130373 | Ga0207703_101303732 | 208 |
| 501 | 3300026041 | Ga0207639_10103518 | Ga0207639_101035182 | 208 |
| 502 | 3300026041 | Ga0207639_10286049 | Ga0207639_102860491 | 208 |
| 503 | 3300026041 | Ga0207639_10553318 | Ga0207639_105533182 | 208 |
| 504 | 3300026067 | Ga0207678_10052781 | Ga0207678_100527812 | 208 |
| 505 | 3300026075 | Ga0207708_10052601 | Ga0207708_100526013 | 208 |
| 506 | 3300026075 | Ga0207708_10129045 | Ga0207708_101290452 | 208 |
| 507 | 3300026088 | Ga0207641_10023335 | Ga0207641_100233353 | 208 |
| 508 | 3300026088 | Ga0207641_10120792 | Ga0207641_101207922 | 208 |
| 509 | 3300026089 | Ga0207648_10043640 | Ga0207648_100436404 | 208 |
| 510 | 3300026089 | Ga0207648_10048053 | Ga0207648_100480532 | 208 |
| 511 | 3300026089 | Ga0207648_10127878 | Ga0207648_101278781 | 208 |
| 512 | 3300026095 | Ga0207676_11255112 | Ga0207676_112551121 | 208 |
| 513 | 3300026116 | Ga0207674_10005220 | Ga0207674_1000522012 | 208 |
| 514 | 3300026116 | Ga0207674_10012363 | Ga0207674_100123633 | 208 |
| 515 | 3300026116 | Ga0207674_10020068 | Ga0207674_100200686 | 208 |
| 516 | 3300026116 | Ga0207674_10084809 | Ga0207674_100848092 | 208 |
| 517 | 3300026118 | Ga0207675_100000320 | Ga0207675_10000032042 | 208 |
| 518 | 3300026118 | Ga0207675_100024660 | Ga0207675_1000246602 | 208 |
| 519 | 3300026142 | Ga0207698_10052960 | Ga0207698_100529602 | 208 |
| 520 | 3300026142 | Ga0207698_10268896 | Ga0207698_102688961 | 208 |
| 521 | 3300026142 | Ga0207698_10298593 | Ga0207698_102985932 | 208 |
| 522 | 3300027907 | Ga0207428_10092971 | Ga0207428_100929712 | 208 |
| 523 | 3300027907 | Ga0207428_10197484 | Ga0207428_101974842 | 208 |
| 524 | 3300028379 | Ga0268266_10065062 | Ga0268266_100650622 | 208 |
| 525 | 3300028379 | Ga0268266_10303356 | Ga0268266_103033562 | 208 |
| 526 | 3300028379 | Ga0268266_10990145 | Ga0268266_109901451 | 208 |
| 527 | 3300028380 | Ga0268265_10002328 | Ga0268265_100023289 | 208 |
| 528 | 3300028380 | Ga0268265_10002878 | Ga0268265_100028785 | 208 |
| 529 | 3300028381 | Ga0268264_10037773 | Ga0268264_100377732 | 208 |
| 530 | 3300031548 | Ga0307408_100008102 | Ga0307408_1000081028 | 208 |
| 531 | 3300031731 | Ga0307405_10002563 | Ga0307405_100025636 | 208 |
| 532 | 3300031731 | Ga0307405_10011026 | Ga0307405_100110263 | 208 |
| 533 | 3300031731 | Ga0307405_10020285 | Ga0307405_100202852 | 208 |
| 534 | 3300031731 | Ga0307405_10198154 | Ga0307405_101981542 | 208 |
| 535 | 3300031824 | Ga0307413_10002839 | Ga0307413_100028392 | 208 |
| 536 | 3300031852 | Ga0307410_10025754 | Ga0307410_100257542 | 208 |
| 537 | 3300031852 | Ga0307410_10480401 | Ga0307410_104804012 | 208 |
| 538 | 3300031852 | Ga0307410_10560084 | Ga0307410_105600842 | 208 |
| 539 | 3300031901 | Ga0307406_10000997 | Ga0307406_100009978 | 208 |
| 540 | 3300031901 | Ga0307406_10007929 | Ga0307406_100079295 | 208 |
| 541 | 3300031901 | Ga0307406_10190655 | Ga0307406_101906552 | 208 |
| 542 | 3300031901 | Ga0307406_10297630 | Ga0307406_102976302 | 208 |
| 543 | 3300031903 | Ga0307407_10037378 | Ga0307407_100373783 | 208 |
| 544 | 3300031995 | Ga0307409_100023265 | Ga0307409_1000232653 | 208 |
| 545 | 3300031995 | Ga0307409_100038991 | Ga0307409_1000389913 | 208 |
| 546 | 3300031995 | Ga0307409_100212235 | Ga0307409_1002122352 | 208 |
| 547 | 3300031995 | Ga0307409_100422047 | Ga0307409_1004220472 | 208 |
| 548 | 3300032002 | Ga0307416_100017933 | Ga0307416_1000179331 | 208 |
| 549 | 3300032002 | Ga0307416_100018106 | Ga0307416_1000181062 | 208 |
| 550 | 3300032002 | Ga0307416_100079715 | Ga0307416_1000797152 | 208 |
| 551 | 3300032002 | Ga0307416_100124611 | Ga0307416_1001246112 | 208 |
| 552 | 3300032002 | Ga0307416_100334795 | Ga0307416_1003347952 | 208 |
| 553 | 3300032002 | Ga0307416_100442581 | Ga0307416_1004425812 | 208 |
| 554 | 3300032002 | Ga0307416_101117569 | Ga0307416_1011175692 | 208 |
| 555 | 3300032004 | Ga0307414_10004771 | Ga0307414_100047716 | 208 |
| 556 | 3300032004 | Ga0307414_10041511 | Ga0307414_100415112 | 208 |
| 557 | 3300032005 | Ga0307411_10016870 | Ga0307411_100168704 | 208 |
| 558 | 3300032005 | Ga0307411_10017025 | Ga0307411_100170253 | 208 |
| 559 | 3300032126 | Ga0307415_100004642 | Ga0307415_1000046423 | 208 |
| 560 | 3300032126 | Ga0307415_100004895 | Ga0307415_1000048955 | 208 |
| 561 | 3300032126 | Ga0307415_100117207 | Ga0307415_1001172071 | 208 |
| 562 | 3300032126 | Ga0307415_100363626 | Ga0307415_1003636262 | 208 |
| 563 | 3300035121 | Ga0373960_0059628 | Ga0373960_0059628_306_974 | 208 |
| 564 | 3300037312 | Ga0395899_0110016 | Ga0395899_0110016_1095_1823 | 208 |
| 565 | 3300037418 | Ga0395900_0066207 | Ga0395900_0066207_1113_1841 | 208 |
| 566 | 3300037466 | Ga0395898_0116174 | Ga0395898_0116174_1450_2178 | 208 |
| 567 | 3300037471 | Ga0395905_0006883 | Ga0395905_0006883_8785_9513 | 208 |
| 568 | 3300037471 | Ga0395905_0141882 | Ga0395905_0141882_854_1585 | 208 |
| 569 | 3300038443 | Ga0395901_0103552 | Ga0395901_0103552_882_1610 | 208 |
| 570 | 3300041486 | Ga0451807_0077717 | Ga0451807_0077717_553_1221 | 208 |
| 571 | 3300045051 | Ga0451576_0106572 | Ga0451576_0106572_1133_1801 | 208 |
| 572 | 3300045976 | Ga0466967_0244092 | Ga0466967_0244092_74_796 | 208 |
| 573 | 3300045976 | Ga0466967_0918418 | Ga0466967_0918418_91_819 | 208 |
| 574 | 3300046511 | Ga0495608_0225593 | Ga0495608_0225593_316_942 | 208 |
| 575 | 3300046691 | Ga0495670_0038861 | Ga0495670_0038861_300_968 | 208 |
| 576 | 3300047317 | Ga0495604_0345792 | Ga0495604_0345792_39_665 | 208 |
| 577 | 3300048907 | Ga0496104_0827413 | Ga0496104_0827413_164_790 | 208 |
| 578 | 3300048909 | Ga0496106_0208930 | Ga0496106_0208930_257_907 | 208 |
| 579 | 3300048910 | Ga0496107_0220874 | Ga0496107_0220874_425_1051 | 208 |
| 580 | 3300048911 | Ga0496108_0020209 | Ga0496108_0020209_1315_1941 | 208 |
| 581 | 3300048916 | Ga0496113_0203528 | Ga0496113_0203528_157_825 | 208 |
| 582 | 3300048917 | Ga0496114_0133646 | Ga0496114_0133646_308_958 | 208 |
| 583 | 3300048917 | Ga0496114_0308843 | Ga0496114_0308843_109_735 | 208 |
| 584 | 3300048918 | Ga0496115_0023520 | Ga0496115_0023520_2607_3257 | 208 |
| 585 | 3300050507 | nmdc:mga05p37_272908_c1 | nmdc:mga05p37_272908_c1_255_923 | 208 |
| 586 | 3300050508 | nmdc:mga09592_137749_c1 | nmdc:mga09592_137749_c1_821_1474 | 208 |
| 587 | 3300050508 | nmdc:mga09592_33595_c1 | nmdc:mga09592_33595_c1_577_1245 | 208 |
| 588 | 3300050509 | nmdc:mga0qj67_71620_c1 | nmdc:mga0qj67_71620_c1_1286_1939 | 208 |
| 589 | 3300050510 | nmdc:mga06r32_321556_c1 | nmdc:mga06r32_321556_c1_279_932 | 208 |
| 590 | 3300050510 | nmdc:mga06r32_414762_c1 | nmdc:mga06r32_414762_c1_626_1279 | 208 |
| 591 | 3300050511 | nmdc:mga08y16_66250_c1 | nmdc:mga08y16_66250_c1_1848_2516 | 208 |
| 592 | 3300050512 | nmdc:mga0n895_18729_c1 | nmdc:mga0n895_18729_c1_1104_1772 | 208 |
| 593 | 3300050513 | nmdc:mga0rr50_553955_c1 | nmdc:mga0rr50_553955_c1_63_731 | 208 |
| 594 | 3300050514 | nmdc:mga08x19_44349_c1 | nmdc:mga08x19_44349_c1_1079_1732 | 208 |
| 595 | 3300050515 | nmdc:mga0a205_24539_c1 | nmdc:mga0a205_24539_c1_2090_2758 | 208 |
| 596 | 3300059421 | Ga0590071_055781 | Ga0590071_055781_277_927 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2af7-assembly1.cif.gz_F | crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. | 0.905 | 91 | 206 |
| 2af7-assembly1.cif.gz_A | crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. | 0.8899 | 91 | 208 |
| 2af7-assembly1.cif.gz_A | crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. | 0.8763 | 91 | 208 |
| 2af7-assembly1.cif.gz_F | crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. | 0.8635 | 91 | 206 |
| 4g9q-assembly1.cif.gz_A | crystal structure of a 4-carboxymuconolactone decarboxylase | 0.759 | 6 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2af7G00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8751 | 93 | 208 | 1.20.1290.10 |
| 2af7D00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8748 | 92 | 206 | 1.20.1290.10 |
| 2af7G00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8541 | 93 | 208 | 1.20.1290.10 |
| af_Q58906_2_101_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8421 | 110 | 202 | 1.20.1290.10 |
| 2af7F00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8307 | 91 | 206 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D5XEZ3-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9841 | 89 | 207 |
GO:0051920
|
| AF-A0A841HV07-F1-model_v4 | 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) | 0.9754 | 99 | 207 |
GO:0016829
GO:0051920 |
| AF-A0A2V7SID8-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9753 | 1 | 208 |
GO:0051920
|
| AF-A0A7V9U3B1-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9752 | 8 | 205 |
GO:0051920
|
| AF-A0A430RUR7-F1-model_v4 | 4-carboxymuconolactone decarboxylase | 0.9734 | 99 | 207 |
GO:0051920
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar