F467574

General Info

Members Datasets Scaffolds Average Seq Length
596 330 581 121

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10053240|Ga0307516_100532403
Length 116
Sequence MSTSDTFLAVFLGSKTSAKMAAWNALPEAERRSREQQGIWVEKHQASLVELGGPLGKTTRVDSSGIADISNELGAFTVVRAASHEAAAKLFENHPHFAIFPGERVEIMPVLPIPGG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
3 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
4 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
5 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
6 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
7 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
8 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
9 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
217 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
218 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
219 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
220 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
221 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
222 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
223 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
224 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
318 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
319 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
320 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
321 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
322 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
323 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
324 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
325 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
326 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
327 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
328 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
329 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
330 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.17
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.56
Nodule 1.51
Rhizoplane 9.23
Rhizosphere 75.5
Stem 0
Stem Tuber 0
Unclassified 5.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10030504 3300001989 Bacteria 1868
2 JGI24737J22298_10002347 3300001990 Bacteria 6747
3 JGI24735J21928_10101567 3300002067 Bacteria 826
4 rootH1_10019068 3300003323 Bacteria 1033
5 Ga0055529_1049128 3300003763 Bacteria 506
6 Ga0070690_100037484 3300005330 Bacteria 3055
7 Ga0070690_100375042 3300005330 Bacteria 1039
8 Ga0070670_100060834 3300005331 Unclassified 3243
9 Ga0068869_100254987 3300005334 Bacteria 1402
10 Ga0070666_10004960 3300005335 Bacteria 8139
11 Ga0068868_100100778 3300005338 Bacteria 2337
12 Ga0068868_101978623 3300005338 Bacteria 553
13 Ga0070689_100470638 3300005340 Bacteria 1072
14 Ga0070689_100563710 3300005340 Bacteria 983
15 Ga0070691_10256568 3300005341 Bacteria 940
16 Ga0070668_100296204 3300005347 Bacteria 1355
17 Ga0070668_101140734 3300005347 Bacteria 705
18 Ga0070668_101579991 3300005347 Bacteria 601
19 Ga0070668_102149887 3300005347 Bacteria 515
20 Ga0070669_100235249 3300005353 Bacteria 1453
21 Ga0070675_100256096 3300005354 Bacteria 1533
22 Ga0070671_100674123 3300005355 Bacteria 896
23 Ga0070671_101096899 3300005355 Bacteria 699
24 Ga0070674_100888105 3300005356 Bacteria 776
25 Ga0070688_100137146 3300005365 Bacteria 1658
26 Ga0070659_101001387 3300005366 Bacteria 734
27 Ga0070667_100089815 3300005367 Bacteria 2639
28 Ga0070667_100495448 3300005367 Bacteria 1120
29 Ga0070667_101540081 3300005367 Bacteria 625
30 Ga0070703_10241851 3300005406 Bacteria 728
31 Ga0070709_10236761 3300005434 Unclassified 1309
32 Ga0070709_11203803 3300005434 Bacteria 609
33 Ga0070714_100290700 3300005435 Bacteria 1521
34 Ga0070714_101118137 3300005435 Bacteria 768
35 Ga0070713_100005990 3300005436 Bacteria 8366
36 Ga0070713_100291741 3300005436 Bacteria 1499
37 Ga0070713_100330419 3300005436 Bacteria 1410
38 Ga0070710_11148947 3300005437 Bacteria 572
39 Ga0070711_100004982 3300005439 Bacteria 7886
40 Ga0070711_100379279 3300005439 Bacteria 1143
41 Ga0070711_101062359 3300005439 Bacteria 696
42 Ga0070705_100951340 3300005440 Bacteria 694
43 Ga0070700_101974506 3300005441 Bacteria 506
44 Ga0070663_100073751 3300005455 Bacteria 2490
45 Ga0070663_100239235 3300005455 Bacteria 1432
46 Ga0070663_100319448 3300005455 Bacteria 1248
47 Ga0070663_100320808 3300005455 Bacteria 1246
48 Ga0070663_100505009 3300005455 Bacteria 1005
49 Ga0070663_101653058 3300005455 Bacteria 572
50 Ga0070678_100345611 3300005456 Bacteria 1277
51 Ga0070678_100483667 3300005456 Bacteria 1090
52 Ga0070678_100827993 3300005456 Unclassified 842
53 Ga0070678_101516938 3300005456 Bacteria 628
54 Ga0070662_100742709 3300005457 Bacteria 832
55 Ga0070662_101146000 3300005457 Bacteria 668
56 Ga0070681_10024432 3300005458 Bacteria 6084
57 Ga0070681_10080702 3300005458 Bacteria 3209
58 Ga0070681_10258569 3300005458 Bacteria 1653
59 Ga0070706_100415779 3300005467 Bacteria 1252
60 Ga0070698_100028998 3300005471 Bacteria 5744
61 Ga0070698_100911268 3300005471 Bacteria 825
62 Ga0070679_100009248 3300005530 Bacteria 9314
63 Ga0070679_100075893 3300005530 Bacteria 3351
64 Ga0068853_100210598 3300005539 Bacteria 1771
65 Ga0068853_100517318 3300005539 Bacteria 1128
66 Ga0070672_100968967 3300005543 Bacteria 753
67 Ga0070672_101091826 3300005543 Bacteria 709
68 Ga0070686_100487026 3300005544 Bacteria 955
69 Ga0070686_101570809 3300005544 Bacteria 556
70 Ga0070695_100359125 3300005545 Bacteria 1093
71 Ga0070693_100228290 3300005547 Bacteria 1223
72 Ga0070665_100013100 3300005548 Bacteria 8350
73 Ga0070665_100080609 3300005548 Bacteria 3260
74 Ga0070665_100732835 3300005548 Bacteria 1001
75 Ga0070665_101571943 3300005548 Bacteria 666
76 Ga0070704_101604942 3300005549 Bacteria 600
77 Ga0068855_100051001 3300005563 Bacteria 4875
78 Ga0068855_100193304 3300005563 Bacteria 2294
79 Ga0068855_101188578 3300005563 Bacteria 793
80 Ga0068855_101243336 3300005563 Bacteria 773
81 Ga0068857_100028661 3300005577 Bacteria 4913
82 Ga0068857_100980136 3300005577 Bacteria 813
83 Ga0068854_100014717 3300005578 Bacteria 5162
84 Ga0068856_100035106 3300005614 Bacteria 4913
85 Ga0068856_101039525 3300005614 Bacteria 837
86 Ga0070702_100256668 3300005615 Bacteria 1188
87 Ga0068859_100040226 3300005617 Bacteria 4693
88 Ga0068864_100235961 3300005618 Bacteria 1693
89 Ga0068864_100486535 3300005618 Bacteria 1185
90 Ga0068866_10302007 3300005718 Bacteria 1000
91 Ga0068861_100748718 3300005719 Bacteria 912
92 Ga0068861_102715415 3300005719 Bacteria 500
93 Ga0068870_10453388 3300005840 Bacteria 846
94 Ga0068870_11039597 3300005840 Bacteria 586
95 Ga0068863_100206790 3300005841 Bacteria 1889
96 Ga0068860_100027726 3300005843 Bacteria 5454
97 Ga0068860_100292732 3300005843 Bacteria 1593
98 Ga0068860_101015534 3300005843 Bacteria 848
99 Ga0068860_101759025 3300005843 Bacteria 642
100 Ga0068862_100228976 3300005844 Bacteria 1685
101 Ga0068862_100638985 3300005844 Bacteria 1025
102 Ga0081540_1005216 3300005983 Bacteria 9725
103 Ga0081540_1007193 3300005983 Bacteria 7985
104 Ga0081540_1076704 3300005983 Bacteria 1522
105 Ga0070717_10000460 3300006028 Bacteria 25862
106 Ga0070717_10110309 3300006028 Bacteria 2346
107 Ga0070717_11077288 3300006028 Bacteria 732
108 Ga0075365_10016437 3300006038 Bacteria 4501
109 Ga0075365_10075675 3300006038 Bacteria 2272
110 Ga0075365_10144811 3300006038 Bacteria 1651
111 Ga0075365_11209712 3300006038 Bacteria 531
112 Ga0075368_10070444 3300006042 Bacteria 1411
113 Ga0075368_10122637 3300006042 Bacteria 1077
114 Ga0075363_100014770 3300006048 Bacteria 3825
115 Ga0070715_10107371 3300006163 Bacteria 1312
116 Ga0070716_100034174 3300006173 Bacteria 2786
117 Ga0070716_100154821 3300006173 Bacteria 1478
118 Ga0070716_100970695 3300006173 Bacteria 670
119 Ga0070712_100073635 3300006175 Bacteria 2451
120 Ga0070712_101622439 3300006175 Bacteria 566
121 Ga0075362_10130809 3300006177 Bacteria 1193
122 Ga0075367_10040157 3300006178 Bacteria 2731
123 Ga0075367_10136379 3300006178 Bacteria 1518
124 Ga0075369_10117031 3300006186 Bacteria 1204
125 Ga0075369_10142974 3300006186 Bacteria 1091
126 Ga0075369_10191822 3300006186 Bacteria 942
127 Ga0075366_10032034 3300006195 Bacteria 3094
128 Ga0075366_10107607 3300006195 Bacteria 1676
129 Ga0075366_10874182 3300006195 Bacteria 560
130 Ga0097621_100774264 3300006237 Bacteria 888
131 Ga0075370_10020322 3300006353 Bacteria 3627
132 Ga0075370_10138407 3300006353 Bacteria 1423
133 Ga0068871_100154020 3300006358 Bacteria 1961
134 Ga0075428_101303858 3300006844 Bacteria 764
135 Ga0075433_10377914 3300006852 Bacteria 1251
136 Ga0075434_100016328 3300006871 Bacteria 7137
137 Ga0068865_100041421 3300006881 Bacteria 3134
138 Ga0068865_100109505 3300006881 Bacteria 2035
139 Ga0068865_100559409 3300006881 Bacteria 962
140 Ga0068865_101931941 3300006881 Bacteria 535
141 Ga0075436_100057729 3300006914 Bacteria 2680
142 Ga0075436_100059273 3300006914 Bacteria 2644
143 Ga0097620_100040226 3300006931 Bacteria 4693
144 Ga0075435_100704487 3300007076 Bacteria 878
145 Ga0099795_10000005 3300007788 Bacteria 107614
146 Ga0099795_10366344 3300007788 Bacteria 648
147 Ga0105240_10016877 3300009093 Bacteria 9867
148 Ga0105240_10087516 3300009093 Bacteria 3815
149 Ga0105240_10888648 3300009093 Unclassified 959
150 Ga0111539_10124402 3300009094 Bacteria 3022
151 Ga0111539_11133052 3300009094 Bacteria 909
152 Ga0111539_13203975 3300009094 Unclassified 527
153 Ga0105245_10014079 3300009098 Bacteria 6968
154 Ga0105245_10464643 3300009098 Bacteria 1276
155 Ga0105245_11950086 3300009098 Bacteria 640
156 Ga0105247_10080734 3300009101 Bacteria 2049
157 Ga0105247_10177383 3300009101 Bacteria 1420
158 Ga0105247_10207519 3300009101 Bacteria 1320
159 Ga0105247_10244064 3300009101 Bacteria 1225
160 Ga0105247_10394507 3300009101 Bacteria 984
161 Ga0105247_10583282 3300009101 Bacteria 827
162 Ga0105247_10913872 3300009101 Bacteria 679
163 Ga0114129_10144511 3300009147 Bacteria 3259
164 Ga0105243_10353713 3300009148 Bacteria 1350
165 Ga0105243_10501348 3300009148 Bacteria 1150
166 Ga0105243_10562906 3300009148 Bacteria 1091
167 Ga0105243_11385250 3300009148 Bacteria 723
168 Ga0105243_12123316 3300009148 Bacteria 598
169 Ga0105241_10225918 3300009174 Bacteria 1576
170 Ga0105242_10015747 3300009176 Bacteria 5874
171 Ga0105248_10330687 3300009177 Bacteria 1716
172 Ga0105248_10410344 3300009177 Bacteria 1525
173 Ga0105237_10106632 3300009545 Bacteria 2794
174 Ga0105237_10273970 3300009545 Bacteria 1690
175 Ga0105237_10276157 3300009545 Bacteria 1683
176 Ga0105237_10342514 3300009545 Bacteria 1499
177 Ga0105237_11336302 3300009545 Bacteria 723
178 Ga0105238_10305586 3300009551 Bacteria 1575
179 Ga0105238_10524792 3300009551 Bacteria 1187
180 Ga0105238_11735058 3300009551 Bacteria 656
181 Ga0105249_10513667 3300009553 Bacteria 1245
182 Ga0105249_10681283 3300009553 Bacteria 1087
183 Ga0105249_11022958 3300009553 Bacteria 895
184 Ga0105249_11065330 3300009553 Bacteria 878
185 Ga0105249_11122386 3300009553 Bacteria 857
186 Ga0099796_10000023 3300010159 Bacteria 39177
187 Ga0099796_10099297 3300010159 Bacteria 1093
188 Ga0105239_10015287 3300010375 Bacteria 8506
189 Ga0105239_10658645 3300010375 Bacteria 1196
190 Ga0105239_11224090 3300010375 Bacteria 865
191 Ga0105246_10206627 3300011119 Bacteria 1530
192 Ga0157369_10307557 3300013105 Bacteria 1648
193 Ga0157369_10488407 3300013105 Bacteria 1274
194 Ga0157374_10035603 3300013296 Bacteria 4555
195 Ga0157378_10677672 3300013297 Bacteria 1049
196 Ga0163162_10159796 3300013306 Bacteria 2375
197 Ga0163162_10351084 3300013306 Bacteria 1608
198 Ga0163162_10980066 3300013306 Bacteria 955
199 Ga0163162_11499894 3300013306 Bacteria 768
200 Ga0163162_11624024 3300013306 Bacteria 737
201 Ga0163162_12163275 3300013306 Bacteria 638
202 Ga0157375_10406560 3300013308 Bacteria 1528
203 Ga0157375_11029961 3300013308 Bacteria 962
204 Ga0157375_12416927 3300013308 Bacteria 627
205 Ga0157375_12758439 3300013308 Bacteria 587
206 Ga0157375_13293055 3300013308 Bacteria 538
207 Ga0163163_10012089 3300014325 Bacteria 7854
208 Ga0163163_10073225 3300014325 Bacteria 3416
209 Ga0163163_10203034 3300014325 Bacteria 2031
210 Ga0157380_10109465 3300014326 Bacteria 2318
211 Ga0157380_10283829 3300014326 Bacteria 1516
212 Ga0157380_10428354 3300014326 Bacteria 1264
213 Ga0157380_11317117 3300014326 Bacteria 770
214 Ga0157377_10356285 3300014745 Bacteria 983
215 Ga0157379_10023444 3300014968 Bacteria 5478
216 Ga0157379_10148040 3300014968 Bacteria 2118
217 Ga0157376_10014415 3300014969 Bacteria 5934
218 Ga0157376_10095961 3300014969 Bacteria 2580
219 Ga0157376_11195247 3300014969 Bacteria 788
220 Ga0157376_11385431 3300014969 Bacteria 734
221 Ga0157376_12989432 3300014969 Bacteria 512
222 Ga0163161_10149977 3300017792 Bacteria 1771
223 Ga0163161_10410046 3300017792 Bacteria 1088
224 Ga0163161_10790755 3300017792 Bacteria 796
225 Ga0163161_11129742 3300017792 Bacteria 675
226 Ga0228598_1013692 3300024227 Bacteria 1605
227 Ga0209148_1016579 3300025254 Bacteria 1265
228 Ga0209233_1000694 3300025261 Bacteria 15931
229 Ga0209455_1001710 3300025272 Bacteria 9395
230 Ga0207692_10474809 3300025898 Bacteria 790
231 Ga0207710_10201434 3300025900 Bacteria 983
232 Ga0207688_10088637 3300025901 Bacteria 1774
233 Ga0207688_10094246 3300025901 Bacteria 1722
234 Ga0207688_10187461 3300025901 Bacteria 1236
235 Ga0207680_10625090 3300025903 Bacteria 771
236 Ga0207680_10697480 3300025903 Unclassified 727
237 Ga0207647_10001253 3300025904 Bacteria 19532
238 Ga0207685_10117700 3300025905 Bacteria 1161
239 Ga0207699_10230614 3300025906 Bacteria 1268
240 Ga0207699_10646900 3300025906 Bacteria 772
241 Ga0207699_10801374 3300025906 Bacteria 692
242 Ga0207645_10267439 3300025907 Bacteria 1133
243 Ga0207643_10399027 3300025908 Bacteria 869
244 Ga0207643_10642631 3300025908 Bacteria 684
245 Ga0207684_10596827 3300025910 Bacteria 943
246 Ga0207707_10032842 3300025912 Bacteria 4542
247 Ga0207707_10089803 3300025912 Bacteria 2685
248 Ga0207695_10109077 3300025913 Bacteria 2751
249 Ga0207695_10112712 3300025913 Bacteria 2697
250 Ga0207695_10981668 3300025913 Unclassified 724
251 Ga0207671_10232053 3300025914 Bacteria 1448
252 Ga0207671_10307417 3300025914 Bacteria 1253
253 Ga0207671_10413225 3300025914 Bacteria 1073
254 Ga0207693_10009325 3300025915 Bacteria 8001
255 Ga0207693_10244528 3300025915 Bacteria 1408
256 Ga0207693_11156517 3300025915 Bacteria 585
257 Ga0207663_10025502 3300025916 Bacteria 3419
258 Ga0207663_10852348 3300025916 Bacteria 727
259 Ga0207660_11630639 3300025917 Bacteria 520
260 Ga0207662_10173318 3300025918 Bacteria 1384
261 Ga0207652_10010710 3300025921 Bacteria 7381
262 Ga0207681_10620603 3300025923 Bacteria 895
263 Ga0207650_10074994 3300025925 Bacteria 2551
264 Ga0207687_10441628 3300025927 Bacteria 1078
265 Ga0207687_10618365 3300025927 Bacteria 914
266 Ga0207700_10010911 3300025928 Bacteria 5768
267 Ga0207700_11183912 3300025928 Bacteria 682
268 Ga0207700_11922123 3300025928 Bacteria 518
269 Ga0207664_10059318 3300025929 Bacteria 3046
270 Ga0207664_10440064 3300025929 Bacteria 1163
271 Ga0207644_10871198 3300025931 Bacteria 754
272 Ga0207644_11143662 3300025931 Bacteria 654
273 Ga0207706_10231959 3300025933 Bacteria 1615
274 Ga0207706_11455376 3300025933 Bacteria 560
275 Ga0207686_10063429 3300025934 Bacteria 2350
276 Ga0207709_10613756 3300025935 Bacteria 862
277 Ga0207670_10388045 3300025936 Bacteria 1114
278 Ga0207669_10345806 3300025937 Bacteria 1147
279 Ga0207704_10568657 3300025938 Bacteria 924
280 Ga0207704_11232176 3300025938 Bacteria 638
281 Ga0207665_10023296 3300025939 Bacteria 4078
282 Ga0207665_10091265 3300025939 Bacteria 2112
283 Ga0207665_10412065 3300025939 Bacteria 1031
284 Ga0207665_10456128 3300025939 Bacteria 982
285 Ga0207711_10125296 3300025941 Bacteria 2297
286 Ga0207711_10333584 3300025941 Bacteria 1403
287 Ga0207711_10630299 3300025941 Bacteria 1000
288 Ga0207689_10184753 3300025942 Bacteria 1719
289 Ga0207667_10039623 3300025949 Bacteria 5021
290 Ga0207667_10108706 3300025949 Bacteria 2860
291 Ga0207667_10786977 3300025949 Bacteria 949
292 Ga0207667_10974270 3300025949 Bacteria 837
293 Ga0207651_10612600 3300025960 Bacteria 953
294 Ga0207712_10867750 3300025961 Bacteria 796
295 Ga0207668_10173030 3300025972 Bacteria 1695
296 Ga0207668_10624358 3300025972 Bacteria 941
297 Ga0207668_10951351 3300025972 Bacteria 766
298 Ga0207668_10979695 3300025972 Bacteria 755
299 Ga0207640_10021128 3300025981 Bacteria 3874
300 Ga0207658_10262033 3300025986 Bacteria 1474
301 Ga0207658_10312079 3300025986 Bacteria 1359
302 Ga0207658_10681309 3300025986 Unclassified 928
303 Ga0207658_11647929 3300025986 Bacteria 586
304 Ga0207677_10063069 3300026023 Bacteria 2574
305 Ga0207677_10535789 3300026023 Bacteria 1018
306 Ga0207677_12014990 3300026023 Bacteria 537
307 Ga0207703_10103043 3300026035 Bacteria 2422
308 Ga0207639_10474867 3300026041 Bacteria 1139
309 Ga0207639_10564999 3300026041 Bacteria 1046
310 Ga0207678_10025952 3300026067 Bacteria 5112
311 Ga0207678_10268443 3300026067 Bacteria 1463
312 Ga0207678_10402078 3300026067 Bacteria 1186
313 Ga0207678_11546810 3300026067 Bacteria 585
314 Ga0207708_10353523 3300026075 Bacteria 1206
315 Ga0207702_10013602 3300026078 Bacteria 6756
316 Ga0207641_10805947 3300026088 Bacteria 929
317 Ga0207641_11314141 3300026088 Bacteria 724
318 Ga0207641_11543134 3300026088 Bacteria 666
319 Ga0207676_11853785 3300026095 Bacteria 602
320 Ga0207674_10016173 3300026116 Bacteria 8171
321 Ga0207674_11053503 3300026116 Bacteria 782
322 Ga0207675_100251674 3300026118 Bacteria 1710
323 Ga0207675_101133473 3300026118 Bacteria 802
324 Ga0207683_10051305 3300026121 Bacteria 3614
325 Ga0207683_10155090 3300026121 Bacteria 2068
326 Ga0207683_10323726 3300026121 Bacteria 1412
327 Ga0209179_1000175 3300027512 Bacteria 6059
328 Ga0209813_10128353 3300027866 Bacteria 889
329 Ga0207428_10306685 3300027907 Bacteria 1174
330 Ga0207428_10368040 3300027907 Bacteria 1056
331 Ga0268266_10001136 3300028379 Bacteria 33101
332 Ga0268266_10124447 3300028379 Bacteria 2299
333 Ga0268266_11104722 3300028379 Bacteria 767
334 Ga0268265_10192550 3300028380 Bacteria 1762
335 Ga0268265_10198444 3300028380 Bacteria 1738
336 Ga0268264_10062809 3300028381 Bacteria 3120
337 Ga0268264_10865538 3300028381 Bacteria 906
338 Ga0307517_10000098 3300028786 Bacteria 126044
339 Ga0307515_10104075 3300028794 Bacteria 3396
340 Ga0265760_10333543 3300031090 Bacteria 541
341 Ga0265332_10113667 3300031238 Bacteria 1139
342 Ga0265325_10030068 3300031241 Bacteria 2915
343 Ga0265339_10102808 3300031249 Bacteria 1485
344 Ga0265339_10220362 3300031249 Bacteria 928
345 Ga0265331_10161814 3300031250 Bacteria 1014
346 Ga0265316_11123974 3300031344 Bacteria 544
347 Ga0307513_10418783 3300031456 Bacteria 1070
348 Ga0307508_10127944 3300031616 Bacteria 2143
349 Ga0265314_10156693 3300031711 Bacteria 1390
350 Ga0265342_10115041 3300031712 Bacteria 1519
351 Ga0307516_10053240 3300031730 Bacteria 3958
352 Ga0307516_10171105 3300031730 Bacteria 1913
353 Ga0307412_10627228 3300031911 Bacteria 914
354 Ga0307416_100665573 3300032002 Bacteria 1127
355 Ga0307510_10327889 3300033180 Bacteria 986
356 Ga0307510_10453756 3300033180 Bacteria 723
357 Ga0307510_10587261 3300033180 Bacteria 564
358 Ga0373938_0012168 3300034957 Bacteria 1610
359 Ga0373938_0082383 3300034957 Bacteria 785
360 Ga0373929_0073539 3300035085 Bacteria 821
361 Ga0373940_0012825 3300035088 Bacteria 2014
362 Ga0373949_0023335 3300035090 Bacteria 1432
363 Ga0373949_0278187 3300035090 Unclassified 525
364 Ga0373923_0460800 3300035111 Bacteria 617
365 Ga0373939_0059957 3300035114 Bacteria 1208
366 Ga0373941_0041926 3300035115 Bacteria 1419
367 Ga0373941_0391181 3300035115 Bacteria 573
368 Ga0373945_0075784 3300035116 Bacteria 1281
369 Ga0373945_0467734 3300035116 Bacteria 559
370 Ga0373957_0342591 3300035120 Bacteria 638
371 Ga0373943_0136937 3300035170 Bacteria 1316
372 Ga0373961_0075393 3300035241 Bacteria 1051
373 Ga0373962_0030285 3300035242 Bacteria 1480
374 Ga0373962_0056827 3300035242 Bacteria 1140
375 Ga0373924_0161939 3300035410 Bacteria 981
376 Ga0373931_0003428 3300035691 Bacteria 7118
377 Ga0373931_0004512 3300035691 Bacteria 6368
378 Ga0373931_0020927 3300035691 Bacteria 3277
379 Ga0373935_0097809 3300035692 Bacteria 1931
380 Ga0373935_0344725 3300035692 Bacteria 1061
381 Ga0373927_0005938 3300035695 Bacteria 8359
382 Ga0373927_0039246 3300035695 Bacteria 3073
383 Ga0373927_0470479 3300035695 Bacteria 830
384 Ga0373933_0000026 3300035724 Bacteria 90309
385 Ga0373947_0052793 3300035725 Bacteria 2449
386 Ga0373947_0331050 3300035725 Bacteria 1020
387 Ga0373937_0613407 3300036401 Bacteria 1033
388 Ga0373925_0013452 3300037068 Bacteria 5923
389 Ga0373925_0120413 3300037068 Bacteria 2037
390 Ga0373925_0165062 3300037068 Bacteria 1746
391 Ga0395898_0035872 3300037466 Bacteria 4928
392 Ga0395898_0620566 3300037466 Bacteria 1024
393 Ga0395898_0991435 3300037466 Bacteria 776
394 Ga0395905_0462821 3300037471 Bacteria 1167
395 Ga0395901_0181283 3300038443 Bacteria 2209
396 Ga0436365_0939476 3300039437 Bacteria 1745
397 Ga0436363_0400675 3300039450 Bacteria 706
398 Ga0436362_0741099 3300039453 Bacteria 4353
399 Ga0451789_0967346 3300041443 Bacteria 611
400 Ga0451791_0402788 3300041451 Bacteria 642
401 Ga0451791_1176742 3300041451 Bacteria 584
402 Ga0451793_0828375 3300041452 Bacteria 623
403 Ga0451798_0016358 3300041458 Bacteria 1101
404 Ga0451802_1435137 3300041460 Bacteria 1094
405 Ga0451807_1414763 3300041486 Bacteria 738
406 Ga0451837_0986133 3300041494 Bacteria 611
407 Ga0451841_1414058 3300041498 Bacteria 504
408 Ga0451855_0305929 3300041511 Bacteria 576
409 Ga0466966_0038431 3300044684 Unclassified 3085
410 Ga0466961_0572202 3300044693 Bacteria 680
411 Ga0466963_0540088 3300044694 Bacteria 823
412 Ga0466964_0663256 3300044706 Bacteria 578
413 Ga0466959_0053125 3300045049 Bacteria 2963
414 Ga0466959_0394516 3300045049 Unclassified 941
415 Ga0466958_0752862 3300045836 Bacteria 635
416 Ga0466958_1080037 3300045836 Unclassified 524
417 Ga0466967_0563761 3300045976 Bacteria 1122
418 Ga0495617_015095 3300046452 Bacteria 2621
419 Ga0495627_124392 3300046453 Bacteria 727
420 Ga0495603_0043229 3300046455 Bacteria 2691
421 Ga0495603_0074854 3300046455 Bacteria 1988
422 Ga0495603_0689354 3300046455 Bacteria 584
423 Ga0495590_0220458 3300046457 Bacteria 700
424 Ga0495638_0576889 3300046460 Bacteria 555
425 Ga0495641_0092177 3300046461 Bacteria 1354
426 Ga0495651_0259012 3300046462 Bacteria 1184
427 Ga0495650_0063664 3300046471 Bacteria 1470
428 Ga0495650_0113151 3300046471 Bacteria 1006
429 Ga0495582_0357182 3300046473 Bacteria 842
430 Ga0495582_0812928 3300046473 Bacteria 541
431 Ga0495605_0241247 3300046474 Bacteria 776
432 Ga0495639_0050090 3300046475 Bacteria 1897
433 Ga0495585_0311796 3300046492 Bacteria 771
434 Ga0495596_0141335 3300046500 Bacteria 935
435 Ga0495596_0163228 3300046500 Bacteria 866
436 Ga0495607_0429765 3300046501 Bacteria 596
437 Ga0495607_0510177 3300046501 Bacteria 532
438 Ga0495630_0269329 3300046517 Bacteria 1301
439 Ga0495643_0074090 3300046522 Bacteria 1784
440 Ga0495644_0052273 3300046523 Bacteria 1534
441 Ga0495644_0088630 3300046523 Bacteria 1167
442 Ga0495663_0120853 3300046525 Bacteria 877
443 Ga0495665_0489016 3300046531 Bacteria 620
444 Ga0495598_0046091 3300046537 Bacteria 1294
445 Ga0495621_0018971 3300046539 Bacteria 2240
446 Ga0495621_0441835 3300046539 Bacteria 556
447 Ga0495645_0363161 3300046543 Bacteria 930
448 Ga0495622_0269882 3300046557 Bacteria 746
449 Ga0495633_0053651 3300046558 Bacteria 1897
450 Ga0495656_0084365 3300046615 Bacteria 1440
451 Ga0495656_0214078 3300046615 Bacteria 961
452 Ga0495656_0788141 3300046615 Bacteria 513
453 Ga0495668_0029504 3300046616 Bacteria 3099
454 Ga0495668_0052320 3300046616 Bacteria 2260
455 Ga0495668_0082172 3300046616 Bacteria 1767
456 Ga0495668_0332061 3300046616 Bacteria 834
457 Ga0495611_0442893 3300046648 Bacteria 592
458 Ga0495625_0376015 3300046660 Bacteria 892
459 Ga0495635_0145633 3300046663 Bacteria 1613
460 Ga0495588_0007336 3300046674 Bacteria 5012
461 Ga0495588_0110523 3300046674 Bacteria 1448
462 Ga0495647_0538129 3300046681 Bacteria 546
463 Ga0495669_0269583 3300046684 Bacteria 818
464 Ga0495670_0039207 3300046691 Bacteria 2362
465 Ga0495670_0112447 3300046691 Bacteria 1410
466 Ga0495670_0163148 3300046691 Bacteria 1171
467 Ga0495671_0089738 3300046692 Bacteria 1505
468 Ga0495589_0103033 3300046794 Bacteria 1380
469 Ga0495589_0111160 3300046794 Bacteria 1322
470 Ga0495604_0498872 3300047317 Bacteria 790
471 Ga0495636_0077561 3300047318 Bacteria 1426
472 Ga0495683_0474998 3300047323 Bacteria 510
473 Ga0495675_0606690 3300047444 Bacteria 620
474 Ga0495677_0067538 3300047445 Bacteria 1330
475 Ga0495677_0191472 3300047445 Bacteria 794
476 Ga0495679_160933 3300047446 Bacteria 600
477 Ga0495673_0083456 3300047469 Bacteria 1319
478 Ga0495673_0186672 3300047469 Bacteria 782
479 Ga0495684_0547276 3300047471 Bacteria 789
480 Ga0495615_0052012 3300048090 Bacteria 1057
481 Ga0495626_0127656 3300048091 Bacteria 1088
482 Ga0496100_0394592 3300048903 Bacteria 1053
483 Ga0496100_0641603 3300048903 Bacteria 826
484 Ga0496100_1409896 3300048903 Bacteria 550
485 Ga0496101_0075055 3300048904 Bacteria 2488
486 Ga0496101_0105094 3300048904 Bacteria 2119
487 Ga0496101_0453350 3300048904 Bacteria 1012
488 Ga0496101_0514497 3300048904 Bacteria 946
489 Ga0496102_0380154 3300048905 Bacteria 1329
490 Ga0496102_0962906 3300048905 Bacteria 774
491 Ga0496102_1057104 3300048905 Bacteria 732
492 Ga0496103_0296231 3300048906 Bacteria 1041
493 Ga0496103_0332347 3300048906 Bacteria 977
494 Ga0496103_0789321 3300048906 Bacteria 599
495 Ga0496104_0003553 3300048907 Bacteria 13448
496 Ga0496104_0026734 3300048907 Bacteria 5332
497 Ga0496104_0208151 3300048907 Bacteria 1868
498 Ga0496104_0273637 3300048907 Bacteria 1601
499 Ga0496104_0436381 3300048907 Bacteria 1221
500 Ga0496104_0558364 3300048907 Bacteria 1055
501 Ga0496105_0005843 3300048908 Bacteria 9384
502 Ga0496105_0066489 3300048908 Bacteria 2976
503 Ga0496105_0258568 3300048908 Bacteria 1409
504 Ga0496105_0345596 3300048908 Bacteria 1189
505 Ga0496106_0355229 3300048909 Bacteria 1177
506 Ga0496106_0806805 3300048909 Bacteria 744
507 Ga0496107_0537257 3300048910 Bacteria 866
508 Ga0496107_1132600 3300048910 Bacteria 564
509 Ga0496108_0020730 3300048911 Bacteria 5403
510 Ga0496108_0262230 3300048911 Bacteria 1504
511 Ga0496109_0188347 3300048912 Bacteria 1938
512 Ga0496109_1789872 3300048912 Bacteria 547
513 Ga0496110_0107424 3300048913 Bacteria 2505
514 Ga0496110_0371924 3300048913 Bacteria 1302
515 Ga0496110_0595230 3300048913 Bacteria 1003
516 Ga0496110_0615947 3300048913 Bacteria 984
517 Ga0496111_0040302 3300048914 Bacteria 3350
518 Ga0496111_0147239 3300048914 Bacteria 1746
519 Ga0496111_0209481 3300048914 Bacteria 1448
520 Ga0496111_0469200 3300048914 Bacteria 928
521 Ga0496112_0012229 3300048915 Bacteria 7879
522 Ga0496112_0025634 3300048915 Bacteria 5663
523 Ga0496113_0662113 3300048916 Bacteria 834
524 Ga0496114_0004423 3300048917 Bacteria 10907
525 Ga0496114_0913209 3300048917 Bacteria 759
526 Ga0496115_0014949 3300048918 Bacteria 5883
527 Ga0496115_0019746 3300048918 Bacteria 5189
528 Ga0496115_0128737 3300048918 Bacteria 2086
529 Ga0496115_0159969 3300048918 Bacteria 1861
530 Ga0496117_0125246 3300048920 Bacteria 1570
531 Ga0496118_0497839 3300048921 Bacteria 607
532 Ga0496121_0120593 3300048924 Bacteria 1981
533 Ga0496121_0270060 3300048924 Bacteria 1169
534 Ga0496121_0609782 3300048924 Bacteria 672
535 Ga0496124_0213718 3300048927 Bacteria 1457
536 Ga0496126_0005831 3300048929 Bacteria 13924
537 Ga0496126_0032606 3300048929 Bacteria 4906
538 Ga0496126_0389043 3300048929 Bacteria 1133
539 Ga0496126_0399776 3300048929 Bacteria 1114
540 Ga0501067_0383592 3300049583 Bacteria 784
541 nmdc:mga03683_491508_c1 3300050489 Bacteria 593
542 nmdc:mga03683_637886_c1 3300050489 Bacteria 523
543 nmdc:mga00v17_834495_c1 3300050491 Bacteria 586
544 nmdc:mga0yw44_125590_c1 3300050492 Bacteria 1657
545 nmdc:mga0yw44_31797_c1 3300050492 Bacteria 3071
546 nmdc:mga0yw44_503758_c1 3300050492 Bacteria 822
547 nmdc:mga0yw44_91277_c1 3300050492 Bacteria 1925
548 nmdc:mga0k408_148173_c1 3300050493 Bacteria 1397
549 nmdc:mga0k408_205461_c2 3300050493 Bacteria 800
550 nmdc:mga0k408_459337_c1 3300050493 Bacteria 756
551 nmdc:mga06z11_262640_c1 3300050494 Bacteria 1019
552 nmdc:mga06z11_452217_c1 3300050494 Bacteria 776
553 nmdc:mga06z11_8466_c1 3300050494 Bacteria 4291
554 nmdc:mga04h51_110906_c1 3300050495 Bacteria 1011
555 nmdc:mga04h51_55291_c1 3300050495 Bacteria 1344
556 nmdc:mga07m45_6750_c1 3300050496 Bacteria 1179
557 nmdc:mga05p37_196622_c1 3300050507 Bacteria 2445
558 nmdc:mga08y16_805746_c1 3300050511 Unclassified 932
559 nmdc:mga0n895_13760_c1 3300050512 Bacteria 7317
560 nmdc:mga0rr50_144231_c1 3300050513 Bacteria 1918
561 nmdc:mga0rr50_741232_c1 3300050513 Bacteria 838
562 nmdc:mga08x19_50119_c1 3300050514 Bacteria 2678
563 nmdc:mga08x19_61530_c1 3300050514 Bacteria 2433
564 nmdc:mga08x19_619177_c1 3300050514 Bacteria 767
565 nmdc:mga0a205_653515_c1 3300050515 Bacteria 903
566 nmdc:mga0sz30_145405_c1 3300050516 Bacteria 1047
567 nmdc:mga0sz30_360742_c1 3300050516 Bacteria 650
568 nmdc:mga0sz30_397579_c1 3300050516 Bacteria 617
569 Ga0495601_0301777 3300053077 Bacteria 1043
570 Ga0495612_0157977 3300053078 Bacteria 989
571 Ga0495595_0183165 3300053084 Bacteria 1039
572 Ga0495619_0059248 3300053085 Bacteria 2544
573 Ga0500583_0108192 3300053092 Bacteria 1367
574 Ga0500655_009005 3300053133 Bacteria 1796
575 Ga0500658_0072704 3300053134 Bacteria 1455
576 Ga0500559_0009452 3300053136 Bacteria 4218
577 Ga0500603_051358 3300053150 Bacteria 1129
578 Ga0500639_097955 3300053163 Bacteria 1449
579 Ga0500636_0049352 3300053177 Bacteria 2476
580 Ga0500645_029720 3300053730 Bacteria 1648
581 Ga0500601_003418 3300053737 Bacteria 1721

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2791355199 2793078833 100
2 3300006852 Ga0075433_10377914 Ga0075433_103779142 105
3 3300006871 Ga0075434_100016328 Ga0075434_1000163288 105
4 3300006914 Ga0075436_100057729 Ga0075436_1000577293 105
5 3300050512 nmdc:mga0n895_13760_c1 nmdc:mga0n895_13760_c1_6788_7156 105
6 3300050513 nmdc:mga0rr50_144231_c1 nmdc:mga0rr50_144231_c1_253_621 105
7 3300050514 nmdc:mga08x19_50119_c1 nmdc:mga08x19_50119_c1_987_1355 105
8 3300050515 nmdc:mga0a205_653515_c1 nmdc:mga0a205_653515_c1_48_416 105
9 3300053133 Ga0500655_009005 Ga0500655_009005_1086_1541 107
10 3300046474 Ga0495605_0241247 Ga0495605_0241247_388_753 113
11 3300053134 Ga0500658_0072704 Ga0500658_0072704_297_662 113
12 3300006038 Ga0075365_10144811 Ga0075365_101448113 114
13 3300050492 nmdc:mga0yw44_91277_c1 nmdc:mga0yw44_91277_c1_549_911 114
14 3300031730 Ga0307516_10053240 Ga0307516_100532403 116
15 3300046517 Ga0495630_0269329 Ga0495630_0269329_879_1244 116
16 3300048903 Ga0496100_1409896 Ga0496100_1409896_37_402 116
17 3300053078 Ga0495612_0157977 Ga0495612_0157977_556_921 116
18 iso_pu_bacteria 8006926726 8006932930 116
19 iso_pu_bacteria 2508501128 2509147817 117
20 iso_pu_bacteria 2824679649 2824685738 117
21 iso_pu_bacteria 2876808645 2876817820 117
22 iso_pu_bacteria 2879110137 2879116804 117
23 iso_pu_bacteria 2885383462 2885387304 117
24 iso_pu_bacteria 2889033259 2889034458 117
25 iso_pu_bacteria 2922361189 2922366554 117
26 iso_pu_bacteria 2922386360 2922389536 117
27 iso_pu_bacteria 2922393267 2922398332 117
28 iso_pu_bacteria 8006964411 8006971083 117
29 iso_pu_bacteria 8006994254 8006996797 117
30 iso_pu_bacteria 8056673599 8056675377 117
31 iso_pu_bacteria 8056681323 8056685556 117
32 3300006028 Ga0070717_11077288 Ga0070717_110772881 118
33 3300005338 Ga0068868_101978623 Ga0068868_1019786231 119
34 3300005456 Ga0070678_101516938 Ga0070678_1015169381 119
35 3300005458 Ga0070681_10024432 Ga0070681_100244325 119
36 3300005530 Ga0070679_100075893 Ga0070679_1000758934 119
37 3300005539 Ga0068853_100517318 Ga0068853_1005173182 119
38 3300005543 Ga0070672_100968967 Ga0070672_1009689671 119
39 3300005563 Ga0068855_100193304 Ga0068855_1001933044 119
40 3300005577 Ga0068857_100980136 Ga0068857_1009801362 119
41 3300005840 Ga0068870_10453388 Ga0068870_104533882 119
42 3300009098 Ga0105245_11950086 Ga0105245_119500862 119
43 3300013308 Ga0157375_12758439 Ga0157375_127584392 119
44 3300014326 Ga0157380_10283829 Ga0157380_102838292 119
45 3300014745 Ga0157377_10356285 Ga0157377_103562852 119
46 3300025901 Ga0207688_10187461 Ga0207688_101874612 119
47 3300025908 Ga0207643_10399027 Ga0207643_103990272 119
48 3300025912 Ga0207707_10032842 Ga0207707_100328428 119
49 3300025917 Ga0207660_11630639 Ga0207660_116306391 119
50 3300025949 Ga0207667_10108706 Ga0207667_101087062 119
51 3300026023 Ga0207677_12014990 Ga0207677_120149902 119
52 3300026041 Ga0207639_10474867 Ga0207639_104748672 119
53 3300026116 Ga0207674_11053503 Ga0207674_110535031 119
54 3300026121 Ga0207683_10155090 Ga0207683_101550902 119
55 3300035170 Ga0373943_0136937 Ga0373943_0136937_768_1127 119
56 3300035410 Ga0373924_0161939 Ga0373924_0161939_176_535 119
57 3300035692 Ga0373935_0097809 Ga0373935_0097809_316_675 119
58 3300035695 Ga0373927_0005938 Ga0373927_0005938_5037_5396 119
59 3300035725 Ga0373947_0052793 Ga0373947_0052793_1047_1406 119
60 3300037068 Ga0373925_0120413 Ga0373925_0120413_267_626 119
61 3300037068 Ga0373925_0165062 Ga0373925_0165062_928_1287 119
62 3300044694 Ga0466963_0540088 Ga0466963_0540088_141_500 119
63 3300046473 Ga0495582_0812928 Ga0495582_0812928_21_380 119
64 3300046531 Ga0495665_0489016 Ga0495665_0489016_206_565 119
65 3300046543 Ga0495645_0363161 Ga0495645_0363161_407_766 119
66 3300047317 Ga0495604_0498872 Ga0495604_0498872_376_735 119
67 3300047471 Ga0495684_0547276 Ga0495684_0547276_114_473 119
68 3300053077 Ga0495601_0301777 Ga0495601_0301777_441_800 119
69 3300053085 Ga0495619_0059248 Ga0495619_0059248_1501_1860 119
70 3300003323 rootH1_10019068 rootH1_100190682 120
71 3300005439 Ga0070711_100379279 Ga0070711_1003792792 120
72 3300005544 Ga0070686_101570809 Ga0070686_1015708091 120
73 3300005548 Ga0070665_100732835 Ga0070665_1007328352 120
74 3300005983 Ga0081540_1005216 Ga0081540_10052161 120
75 3300006042 Ga0075368_10122637 Ga0075368_101226372 120
76 3300009148 Ga0105243_10353713 Ga0105243_103537132 120
77 3300027866 Ga0209813_10128353 Ga0209813_101283531 120
78 3300039437 Ga0436365_0939476 Ga0436365_0939476_946_1308 120
79 3300041511 Ga0451855_0305929 Ga0451855_0305929_52_414 120
80 3300049583 Ga0501067_0383592 Ga0501067_0383592_121_483 120
81 3300050495 nmdc:mga04h51_110906_c1 nmdc:mga04h51_110906_c1_376_738 120
82 3300053136 Ga0500559_0009452 Ga0500559_0009452_274_639 120
83 3300053163 Ga0500639_097955 Ga0500639_097955_132_497 120
84 3300003763 Ga0055529_1049128 Ga0055529_10491281 121
85 3300005330 Ga0070690_100037484 Ga0070690_1000374842 121
86 3300005330 Ga0070690_100375042 Ga0070690_1003750422 121
87 3300005331 Ga0070670_100060834 Ga0070670_1000608345 121
88 3300005334 Ga0068869_100254987 Ga0068869_1002549872 121
89 3300005335 Ga0070666_10004960 Ga0070666_100049602 121
90 3300005338 Ga0068868_100100778 Ga0068868_1001007783 121
91 3300005340 Ga0070689_100470638 Ga0070689_1004706382 121
92 3300005340 Ga0070689_100563710 Ga0070689_1005637101 121
93 3300005341 Ga0070691_10256568 Ga0070691_102565682 121
94 3300005347 Ga0070668_100296204 Ga0070668_1002962042 121
95 3300005347 Ga0070668_101140734 Ga0070668_1011407341 121
96 3300005347 Ga0070668_101579991 Ga0070668_1015799911 121
97 3300005347 Ga0070668_102149887 Ga0070668_1021498871 121
98 3300005353 Ga0070669_100235249 Ga0070669_1002352492 121
99 3300005354 Ga0070675_100256096 Ga0070675_1002560961 121
100 3300005355 Ga0070671_100674123 Ga0070671_1006741232 121
101 3300005355 Ga0070671_101096899 Ga0070671_1010968991 121
102 3300005356 Ga0070674_100888105 Ga0070674_1008881052 121
103 3300005365 Ga0070688_100137146 Ga0070688_1001371462 121
104 3300005366 Ga0070659_101001387 Ga0070659_1010013871 121
105 3300005367 Ga0070667_100089815 Ga0070667_1000898153 121
106 3300005367 Ga0070667_100495448 Ga0070667_1004954481 121
107 3300005367 Ga0070667_101540081 Ga0070667_1015400811 121
108 3300005406 Ga0070703_10241851 Ga0070703_102418512 121
109 3300005434 Ga0070709_10236761 Ga0070709_102367612 121
110 3300005434 Ga0070709_11203803 Ga0070709_112038031 121
111 3300005435 Ga0070714_100290700 Ga0070714_1002907003 121
112 3300005435 Ga0070714_101118137 Ga0070714_1011181372 121
113 3300005436 Ga0070713_100005990 Ga0070713_1000059902 121
114 3300005436 Ga0070713_100291741 Ga0070713_1002917412 121
115 3300005436 Ga0070713_100330419 Ga0070713_1003304193 121
116 3300005437 Ga0070710_11148947 Ga0070710_111489471 121
117 3300005439 Ga0070711_100004982 Ga0070711_1000049823 121
118 3300005439 Ga0070711_101062359 Ga0070711_1010623591 121
119 3300005440 Ga0070705_100951340 Ga0070705_1009513401 121
120 3300005441 Ga0070700_101974506 Ga0070700_1019745061 121
121 3300005455 Ga0070663_100073751 Ga0070663_1000737515 121
122 3300005455 Ga0070663_100239235 Ga0070663_1002392351 121
123 3300005455 Ga0070663_100320808 Ga0070663_1003208082 121
124 3300005455 Ga0070663_100505009 Ga0070663_1005050093 121
125 3300005455 Ga0070663_101653058 Ga0070663_1016530581 121
126 3300005456 Ga0070678_100345611 Ga0070678_1003456113 121
127 3300005456 Ga0070678_100483667 Ga0070678_1004836672 121
128 3300005456 Ga0070678_100827993 Ga0070678_1008279932 121
129 3300005457 Ga0070662_100742709 Ga0070662_1007427091 121
130 3300005457 Ga0070662_101146000 Ga0070662_1011460001 121
131 3300005458 Ga0070681_10080702 Ga0070681_100807022 121
132 3300005458 Ga0070681_10258569 Ga0070681_102585692 121
133 3300005467 Ga0070706_100415779 Ga0070706_1004157792 121
134 3300005471 Ga0070698_100028998 Ga0070698_1000289983 121
135 3300005471 Ga0070698_100911268 Ga0070698_1009112682 121
136 3300005530 Ga0070679_100009248 Ga0070679_1000092482 121
137 3300005544 Ga0070686_100487026 Ga0070686_1004870262 121
138 3300005545 Ga0070695_100359125 Ga0070695_1003591252 121
139 3300005547 Ga0070693_100228290 Ga0070693_1002282901 121
140 3300005548 Ga0070665_100013100 Ga0070665_1000131004 121
141 3300005548 Ga0070665_100080609 Ga0070665_1000806091 121
142 3300005548 Ga0070665_101571943 Ga0070665_1015719432 121
143 3300005549 Ga0070704_101604942 Ga0070704_1016049422 121
144 3300005563 Ga0068855_101188578 Ga0068855_1011885782 121
145 3300005563 Ga0068855_101243336 Ga0068855_1012433361 121
146 3300005614 Ga0068856_101039525 Ga0068856_1010395252 121
147 3300005615 Ga0070702_100256668 Ga0070702_1002566682 121
148 3300005617 Ga0068859_100040226 Ga0068859_1000402262 121
149 3300005618 Ga0068864_100235961 Ga0068864_1002359612 121
150 3300005618 Ga0068864_100486535 Ga0068864_1004865352 121
151 3300005718 Ga0068866_10302007 Ga0068866_103020072 121
152 3300005719 Ga0068861_100748718 Ga0068861_1007487182 121
153 3300005719 Ga0068861_102715415 Ga0068861_1027154152 121
154 3300005840 Ga0068870_11039597 Ga0068870_110395971 121
155 3300005841 Ga0068863_100206790 Ga0068863_1002067902 121
156 3300005843 Ga0068860_100027726 Ga0068860_1000277262 121
157 3300005843 Ga0068860_100292732 Ga0068860_1002927322 121
158 3300005843 Ga0068860_101015534 Ga0068860_1010155342 121
159 3300005843 Ga0068860_101759025 Ga0068860_1017590251 121
160 3300005844 Ga0068862_100228976 Ga0068862_1002289763 121
161 3300005844 Ga0068862_100638985 Ga0068862_1006389852 121
162 3300005983 Ga0081540_1007193 Ga0081540_10071939 121
163 3300005983 Ga0081540_1076704 Ga0081540_10767042 121
164 3300006028 Ga0070717_10000460 Ga0070717_100004609 121
165 3300006028 Ga0070717_10110309 Ga0070717_101103094 121
166 3300006038 Ga0075365_10016437 Ga0075365_100164376 121
167 3300006038 Ga0075365_10075675 Ga0075365_100756755 121
168 3300006038 Ga0075365_11209712 Ga0075365_112097121 121
169 3300006042 Ga0075368_10070444 Ga0075368_100704442 121
170 3300006048 Ga0075363_100014770 Ga0075363_1000147708 121
171 3300006163 Ga0070715_10107371 Ga0070715_101073712 121
172 3300006173 Ga0070716_100034174 Ga0070716_1000341742 121
173 3300006173 Ga0070716_100154821 Ga0070716_1001548212 121
174 3300006173 Ga0070716_100970695 Ga0070716_1009706952 121
175 3300006175 Ga0070712_100073635 Ga0070712_1000736353 121
176 3300006175 Ga0070712_101622439 Ga0070712_1016224392 121
177 3300006177 Ga0075362_10130809 Ga0075362_101308092 121
178 3300006178 Ga0075367_10040157 Ga0075367_100401573 121
179 3300006178 Ga0075367_10136379 Ga0075367_101363792 121
180 3300006186 Ga0075369_10117031 Ga0075369_101170312 121
181 3300006186 Ga0075369_10142974 Ga0075369_101429742 121
182 3300006186 Ga0075369_10191822 Ga0075369_101918222 121
183 3300006195 Ga0075366_10032034 Ga0075366_100320342 121
184 3300006195 Ga0075366_10107607 Ga0075366_101076073 121
185 3300006195 Ga0075366_10874182 Ga0075366_108741821 121
186 3300006237 Ga0097621_100774264 Ga0097621_1007742642 121
187 3300006353 Ga0075370_10020322 Ga0075370_100203227 121
188 3300006353 Ga0075370_10138407 Ga0075370_101384072 121
189 3300006358 Ga0068871_100154020 Ga0068871_1001540201 121
190 3300006844 Ga0075428_101303858 Ga0075428_1013038581 121
191 3300006881 Ga0068865_100041421 Ga0068865_1000414212 121
192 3300006881 Ga0068865_100109505 Ga0068865_1001095053 121
193 3300006881 Ga0068865_100559409 Ga0068865_1005594092 121
194 3300006881 Ga0068865_101931941 Ga0068865_1019319411 121
195 3300006914 Ga0075436_100059273 Ga0075436_1000592735 121
196 3300006931 Ga0097620_100040226 Ga0097620_1000402263 121
197 3300007076 Ga0075435_100704487 Ga0075435_1007044872 121
198 3300007788 Ga0099795_10366344 Ga0099795_103663442 121
199 3300009093 Ga0105240_10087516 Ga0105240_100875166 121
200 3300009093 Ga0105240_10888648 Ga0105240_108886482 121
201 3300009094 Ga0111539_10124402 Ga0111539_101244022 121
202 3300009094 Ga0111539_11133052 Ga0111539_111330522 121
203 3300009094 Ga0111539_13203975 Ga0111539_132039751 121
204 3300009098 Ga0105245_10014079 Ga0105245_100140796 121
205 3300009098 Ga0105245_10464643 Ga0105245_104646432 121
206 3300009101 Ga0105247_10080734 Ga0105247_100807343 121
207 3300009101 Ga0105247_10177383 Ga0105247_101773832 121
208 3300009101 Ga0105247_10207519 Ga0105247_102075191 121
209 3300009101 Ga0105247_10244064 Ga0105247_102440643 121
210 3300009101 Ga0105247_10394507 Ga0105247_103945072 121
211 3300009101 Ga0105247_10583282 Ga0105247_105832822 121
212 3300009101 Ga0105247_10913872 Ga0105247_109138722 121
213 3300009147 Ga0114129_10144511 Ga0114129_101445114 121
214 3300009148 Ga0105243_10501348 Ga0105243_105013481 121
215 3300009148 Ga0105243_10562906 Ga0105243_105629062 121
216 3300009148 Ga0105243_11385250 Ga0105243_113852502 121
217 3300009148 Ga0105243_12123316 Ga0105243_121233162 121
218 3300009174 Ga0105241_10225918 Ga0105241_102259182 121
219 3300009176 Ga0105242_10015747 Ga0105242_100157475 121
220 3300009177 Ga0105248_10330687 Ga0105248_103306872 121
221 3300009177 Ga0105248_10410344 Ga0105248_104103442 121
222 3300009545 Ga0105237_10106632 Ga0105237_101066325 121
223 3300009545 Ga0105237_10276157 Ga0105237_102761572 121
224 3300009545 Ga0105237_11336302 Ga0105237_113363021 121
225 3300009551 Ga0105238_10305586 Ga0105238_103055863 121
226 3300009551 Ga0105238_11735058 Ga0105238_117350581 121
227 3300009553 Ga0105249_10513667 Ga0105249_105136671 121
228 3300009553 Ga0105249_10681283 Ga0105249_106812832 121
229 3300009553 Ga0105249_11022958 Ga0105249_110229582 121
230 3300009553 Ga0105249_11065330 Ga0105249_110653302 121
231 3300009553 Ga0105249_11122386 Ga0105249_111223862 121
232 3300010159 Ga0099796_10099297 Ga0099796_100992972 121
233 3300010375 Ga0105239_10658645 Ga0105239_106586452 121
234 3300010375 Ga0105239_11224090 Ga0105239_112240902 121
235 3300011119 Ga0105246_10206627 Ga0105246_102066272 121
236 3300013105 Ga0157369_10307557 Ga0157369_103075572 121
237 3300013105 Ga0157369_10488407 Ga0157369_104884073 121
238 3300013296 Ga0157374_10035603 Ga0157374_100356031 121
239 3300013297 Ga0157378_10677672 Ga0157378_106776722 121
240 3300013306 Ga0163162_10159796 Ga0163162_101597961 121
241 3300013306 Ga0163162_10351084 Ga0163162_103510841 121
242 3300013306 Ga0163162_10980066 Ga0163162_109800662 121
243 3300013306 Ga0163162_11499894 Ga0163162_114998942 121
244 3300013306 Ga0163162_11624024 Ga0163162_116240242 121
245 3300013306 Ga0163162_12163275 Ga0163162_121632752 121
246 3300013308 Ga0157375_10406560 Ga0157375_104065601 121
247 3300013308 Ga0157375_11029961 Ga0157375_110299612 121
248 3300013308 Ga0157375_12416927 Ga0157375_124169271 121
249 3300013308 Ga0157375_13293055 Ga0157375_132930551 121
250 3300014325 Ga0163163_10012089 Ga0163163_100120896 121
251 3300014325 Ga0163163_10073225 Ga0163163_100732253 121
252 3300014325 Ga0163163_10203034 Ga0163163_102030342 121
253 3300014326 Ga0157380_10109465 Ga0157380_101094653 121
254 3300014326 Ga0157380_10428354 Ga0157380_104283541 121
255 3300014326 Ga0157380_11317117 Ga0157380_113171172 121
256 3300014968 Ga0157379_10023444 Ga0157379_100234442 121
257 3300014968 Ga0157379_10148040 Ga0157379_101480403 121
258 3300014969 Ga0157376_10014415 Ga0157376_100144151 121
259 3300014969 Ga0157376_10095961 Ga0157376_100959612 121
260 3300014969 Ga0157376_11195247 Ga0157376_111952472 121
261 3300014969 Ga0157376_11385431 Ga0157376_113854312 121
262 3300014969 Ga0157376_12989432 Ga0157376_129894322 121
263 3300017792 Ga0163161_10149977 Ga0163161_101499772 121
264 3300017792 Ga0163161_10410046 Ga0163161_104100462 121
265 3300017792 Ga0163161_10790755 Ga0163161_107907551 121
266 3300017792 Ga0163161_11129742 Ga0163161_111297422 121
267 3300024227 Ga0228598_1013692 Ga0228598_10136921 121
268 3300025254 Ga0209148_1016579 Ga0209148_10165792 121
269 3300025261 Ga0209233_1000694 Ga0209233_10006941 121
270 3300025272 Ga0209455_1001710 Ga0209455_10017105 121
271 3300025898 Ga0207692_10474809 Ga0207692_104748092 121
272 3300025900 Ga0207710_10201434 Ga0207710_102014342 121
273 3300025901 Ga0207688_10088637 Ga0207688_100886374 121
274 3300025901 Ga0207688_10094246 Ga0207688_100942462 121
275 3300025903 Ga0207680_10625090 Ga0207680_106250901 121
276 3300025903 Ga0207680_10697480 Ga0207680_106974801 121
277 3300025905 Ga0207685_10117700 Ga0207685_101177002 121
278 3300025906 Ga0207699_10230614 Ga0207699_102306143 121
279 3300025906 Ga0207699_10646900 Ga0207699_106469002 121
280 3300025906 Ga0207699_10801374 Ga0207699_108013741 121
281 3300025907 Ga0207645_10267439 Ga0207645_102674392 121
282 3300025908 Ga0207643_10642631 Ga0207643_106426312 121
283 3300025910 Ga0207684_10596827 Ga0207684_105968272 121
284 3300025912 Ga0207707_10089803 Ga0207707_100898035 121
285 3300025913 Ga0207695_10112712 Ga0207695_101127124 121
286 3300025913 Ga0207695_10981668 Ga0207695_109816681 121
287 3300025914 Ga0207671_10232053 Ga0207671_102320533 121
288 3300025914 Ga0207671_10307417 Ga0207671_103074173 121
289 3300025915 Ga0207693_10009325 Ga0207693_1000932511 121
290 3300025915 Ga0207693_10244528 Ga0207693_102445282 121
291 3300025915 Ga0207693_11156517 Ga0207693_111565172 121
292 3300025916 Ga0207663_10025502 Ga0207663_100255025 121
293 3300025916 Ga0207663_10852348 Ga0207663_108523481 121
294 3300025918 Ga0207662_10173318 Ga0207662_101733182 121
295 3300025921 Ga0207652_10010710 Ga0207652_100107101 121
296 3300025923 Ga0207681_10620603 Ga0207681_106206032 121
297 3300025925 Ga0207650_10074994 Ga0207650_100749942 121
298 3300025927 Ga0207687_10441628 Ga0207687_104416281 121
299 3300025927 Ga0207687_10618365 Ga0207687_106183651 121
300 3300025928 Ga0207700_10010911 Ga0207700_100109116 121
301 3300025928 Ga0207700_11183912 Ga0207700_111839122 121
302 3300025928 Ga0207700_11922123 Ga0207700_119221231 121
303 3300025929 Ga0207664_10059318 Ga0207664_100593182 121
304 3300025929 Ga0207664_10440064 Ga0207664_104400642 121
305 3300025931 Ga0207644_10871198 Ga0207644_108711982 121
306 3300025931 Ga0207644_11143662 Ga0207644_111436622 121
307 3300025933 Ga0207706_10231959 Ga0207706_102319592 121
308 3300025933 Ga0207706_11455376 Ga0207706_114553761 121
309 3300025934 Ga0207686_10063429 Ga0207686_100634292 121
310 3300025935 Ga0207709_10613756 Ga0207709_106137562 121
311 3300025936 Ga0207670_10388045 Ga0207670_103880451 121
312 3300025937 Ga0207669_10345806 Ga0207669_103458062 121
313 3300025938 Ga0207704_10568657 Ga0207704_105686572 121
314 3300025938 Ga0207704_11232176 Ga0207704_112321761 121
315 3300025939 Ga0207665_10023296 Ga0207665_100232967 121
316 3300025939 Ga0207665_10091265 Ga0207665_100912652 121
317 3300025939 Ga0207665_10412065 Ga0207665_104120652 121
318 3300025939 Ga0207665_10456128 Ga0207665_104561282 121
319 3300025941 Ga0207711_10125296 Ga0207711_101252962 121
320 3300025941 Ga0207711_10333584 Ga0207711_103335842 121
321 3300025941 Ga0207711_10630299 Ga0207711_106302992 121
322 3300025942 Ga0207689_10184753 Ga0207689_101847533 121
323 3300025949 Ga0207667_10786977 Ga0207667_107869772 121
324 3300025949 Ga0207667_10974270 Ga0207667_109742702 121
325 3300025960 Ga0207651_10612600 Ga0207651_106126002 121
326 3300025961 Ga0207712_10867750 Ga0207712_108677502 121
327 3300025972 Ga0207668_10173030 Ga0207668_101730302 121
328 3300025972 Ga0207668_10624358 Ga0207668_106243582 121
329 3300025972 Ga0207668_10951351 Ga0207668_109513512 121
330 3300025972 Ga0207668_10979695 Ga0207668_109796952 121
331 3300025986 Ga0207658_10262033 Ga0207658_102620332 121
332 3300025986 Ga0207658_10312079 Ga0207658_103120791 121
333 3300025986 Ga0207658_10681309 Ga0207658_106813091 121
334 3300025986 Ga0207658_11647929 Ga0207658_116479291 121
335 3300026023 Ga0207677_10063069 Ga0207677_100630692 121
336 3300026023 Ga0207677_10535789 Ga0207677_105357891 121
337 3300026035 Ga0207703_10103043 Ga0207703_101030432 121
338 3300026041 Ga0207639_10564999 Ga0207639_105649991 121
339 3300026067 Ga0207678_10268443 Ga0207678_102684432 121
340 3300026067 Ga0207678_10402078 Ga0207678_104020782 121
341 3300026067 Ga0207678_11546810 Ga0207678_115468101 121
342 3300026075 Ga0207708_10353523 Ga0207708_103535232 121
343 3300026088 Ga0207641_10805947 Ga0207641_108059471 121
344 3300026088 Ga0207641_11314141 Ga0207641_113141411 121
345 3300026088 Ga0207641_11543134 Ga0207641_115431341 121
346 3300026095 Ga0207676_11853785 Ga0207676_118537851 121
347 3300026118 Ga0207675_100251674 Ga0207675_1002516742 121
348 3300026118 Ga0207675_101133473 Ga0207675_1011334731 121
349 3300026121 Ga0207683_10051305 Ga0207683_100513056 121
350 3300026121 Ga0207683_10323726 Ga0207683_103237261 121
351 3300027907 Ga0207428_10306685 Ga0207428_103066852 121
352 3300027907 Ga0207428_10368040 Ga0207428_103680401 121
353 3300028379 Ga0268266_10001136 Ga0268266_1000113621 121
354 3300028379 Ga0268266_10124447 Ga0268266_101244473 121
355 3300028379 Ga0268266_11104722 Ga0268266_111047222 121
356 3300028380 Ga0268265_10192550 Ga0268265_101925502 121
357 3300028380 Ga0268265_10198444 Ga0268265_101984443 121
358 3300028381 Ga0268264_10062809 Ga0268264_100628091 121
359 3300028381 Ga0268264_10865538 Ga0268264_108655382 121
360 3300028786 Ga0307517_10000098 Ga0307517_10000098108 121
361 3300028794 Ga0307515_10104075 Ga0307515_101040752 121
362 3300031090 Ga0265760_10333543 Ga0265760_103335431 121
363 3300031238 Ga0265332_10113667 Ga0265332_101136671 121
364 3300031241 Ga0265325_10030068 Ga0265325_100300682 121
365 3300031249 Ga0265339_10102808 Ga0265339_101028082 121
366 3300031249 Ga0265339_10220362 Ga0265339_102203622 121
367 3300031250 Ga0265331_10161814 Ga0265331_101618142 121
368 3300031344 Ga0265316_11123974 Ga0265316_111239741 121
369 3300031456 Ga0307513_10418783 Ga0307513_104187832 121
370 3300031616 Ga0307508_10127944 Ga0307508_101279443 121
371 3300031711 Ga0265314_10156693 Ga0265314_101566932 121
372 3300031712 Ga0265342_10115041 Ga0265342_101150412 121
373 3300031730 Ga0307516_10171105 Ga0307516_101711052 121
374 3300031911 Ga0307412_10627228 Ga0307412_106272282 121
375 3300032002 Ga0307416_100665573 Ga0307416_1006655732 121
376 3300033180 Ga0307510_10327889 Ga0307510_103278891 121
377 3300033180 Ga0307510_10453756 Ga0307510_104537562 121
378 3300033180 Ga0307510_10587261 Ga0307510_105872611 121
379 3300034957 Ga0373938_0012168 Ga0373938_0012168_30_395 121
380 3300034957 Ga0373938_0082383 Ga0373938_0082383_323_703 121
381 3300035085 Ga0373929_0073539 Ga0373929_0073539_139_504 121
382 3300035088 Ga0373940_0012825 Ga0373940_0012825_709_1074 121
383 3300035090 Ga0373949_0023335 Ga0373949_0023335_804_1184 121
384 3300035090 Ga0373949_0278187 Ga0373949_0278187_56_421 121
385 3300035111 Ga0373923_0460800 Ga0373923_0460800_28_393 121
386 3300035114 Ga0373939_0059957 Ga0373939_0059957_566_931 121
387 3300035115 Ga0373941_0041926 Ga0373941_0041926_1020_1400 121
388 3300035115 Ga0373941_0391181 Ga0373941_0391181_169_534 121
389 3300035116 Ga0373945_0075784 Ga0373945_0075784_42_407 121
390 3300035116 Ga0373945_0467734 Ga0373945_0467734_40_405 121
391 3300035120 Ga0373957_0342591 Ga0373957_0342591_76_441 121
392 3300035241 Ga0373961_0075393 Ga0373961_0075393_347_712 121
393 3300035242 Ga0373962_0030285 Ga0373962_0030285_254_634 121
394 3300035242 Ga0373962_0056827 Ga0373962_0056827_548_913 121
395 3300035691 Ga0373931_0003428 Ga0373931_0003428_1256_1636 121
396 3300035691 Ga0373931_0004512 Ga0373931_0004512_976_1341 121
397 3300035691 Ga0373931_0020927 Ga0373931_0020927_461_826 121
398 3300035692 Ga0373935_0344725 Ga0373935_0344725_260_625 121
399 3300035695 Ga0373927_0039246 Ga0373927_0039246_1722_2087 121
400 3300035695 Ga0373927_0470479 Ga0373927_0470479_43_408 121
401 3300035724 Ga0373933_0000026 Ga0373933_0000026_70113_70478 121
402 3300035725 Ga0373947_0331050 Ga0373947_0331050_422_787 121
403 3300036401 Ga0373937_0613407 Ga0373937_0613407_28_393 121
404 3300037068 Ga0373925_0013452 Ga0373925_0013452_3992_4357 121
405 3300037466 Ga0395898_0035872 Ga0395898_0035872_3085_3450 121
406 3300037466 Ga0395898_0620566 Ga0395898_0620566_87_467 121
407 3300037466 Ga0395898_0991435 Ga0395898_0991435_177_578 121
408 3300037471 Ga0395905_0462821 Ga0395905_0462821_367_732 121
409 3300038443 Ga0395901_0181283 Ga0395901_0181283_688_1089 121
410 3300039450 Ga0436363_0400675 Ga0436363_0400675_45_413 121
411 3300041443 Ga0451789_0967346 Ga0451789_0967346_147_512 121
412 3300041451 Ga0451791_0402788 Ga0451791_0402788_239_604 121
413 3300041451 Ga0451791_1176742 Ga0451791_1176742_58_423 121
414 3300041452 Ga0451793_0828375 Ga0451793_0828375_75_440 121
415 3300041458 Ga0451798_0016358 Ga0451798_0016358_396_761 121
416 3300041460 Ga0451802_1435137 Ga0451802_1435137_634_999 121
417 3300041486 Ga0451807_1414763 Ga0451807_1414763_350_715 121
418 3300041494 Ga0451837_0986133 Ga0451837_0986133_74_439 121
419 3300041498 Ga0451841_1414058 Ga0451841_1414058_89_454 121
420 3300044684 Ga0466966_0038431 Ga0466966_0038431_1471_1836 121
421 3300044693 Ga0466961_0572202 Ga0466961_0572202_96_461 121
422 3300044706 Ga0466964_0663256 Ga0466964_0663256_184_549 121
423 3300045049 Ga0466959_0053125 Ga0466959_0053125_297_662 121
424 3300045049 Ga0466959_0394516 Ga0466959_0394516_399_764 121
425 3300045836 Ga0466958_0752862 Ga0466958_0752862_175_540 121
426 3300045836 Ga0466958_1080037 Ga0466958_1080037_34_399 121
427 3300045976 Ga0466967_0563761 Ga0466967_0563761_427_825 121
428 3300046452 Ga0495617_015095 Ga0495617_015095_823_1188 121
429 3300046453 Ga0495627_124392 Ga0495627_124392_279_644 121
430 3300046455 Ga0495603_0043229 Ga0495603_0043229_1344_1709 121
431 3300046455 Ga0495603_0074854 Ga0495603_0074854_1106_1528 121
432 3300046455 Ga0495603_0689354 Ga0495603_0689354_189_554 121
433 3300046457 Ga0495590_0220458 Ga0495590_0220458_324_689 121
434 3300046460 Ga0495638_0576889 Ga0495638_0576889_120_542 121
435 3300046461 Ga0495641_0092177 Ga0495641_0092177_15_380 121
436 3300046462 Ga0495651_0259012 Ga0495651_0259012_39_404 121
437 3300046471 Ga0495650_0063664 Ga0495650_0063664_790_1212 121
438 3300046471 Ga0495650_0113151 Ga0495650_0113151_447_812 121
439 3300046473 Ga0495582_0357182 Ga0495582_0357182_399_764 121
440 3300046475 Ga0495639_0050090 Ga0495639_0050090_1006_1371 121
441 3300046492 Ga0495585_0311796 Ga0495585_0311796_59_424 121
442 3300046500 Ga0495596_0141335 Ga0495596_0141335_506_871 121
443 3300046500 Ga0495596_0163228 Ga0495596_0163228_165_530 121
444 3300046501 Ga0495607_0429765 Ga0495607_0429765_194_559 121
445 3300046501 Ga0495607_0510177 Ga0495607_0510177_119_484 121
446 3300046522 Ga0495643_0074090 Ga0495643_0074090_452_817 121
447 3300046523 Ga0495644_0052273 Ga0495644_0052273_223_588 121
448 3300046523 Ga0495644_0088630 Ga0495644_0088630_700_1122 121
449 3300046525 Ga0495663_0120853 Ga0495663_0120853_358_723 121
450 3300046537 Ga0495598_0046091 Ga0495598_0046091_129_494 121
451 3300046539 Ga0495621_0018971 Ga0495621_0018971_893_1258 121
452 3300046539 Ga0495621_0441835 Ga0495621_0441835_10_375 121
453 3300046557 Ga0495622_0269882 Ga0495622_0269882_329_694 121
454 3300046558 Ga0495633_0053651 Ga0495633_0053651_52_417 121
455 3300046615 Ga0495656_0084365 Ga0495656_0084365_211_576 121
456 3300046615 Ga0495656_0214078 Ga0495656_0214078_506_928 121
457 3300046615 Ga0495656_0788141 Ga0495656_0788141_23_388 121
458 3300046616 Ga0495668_0029504 Ga0495668_0029504_2267_2632 121
459 3300046616 Ga0495668_0052320 Ga0495668_0052320_1698_2120 121
460 3300046616 Ga0495668_0082172 Ga0495668_0082172_406_771 121
461 3300046616 Ga0495668_0332061 Ga0495668_0332061_284_649 121
462 3300046648 Ga0495611_0442893 Ga0495611_0442893_142_564 121
463 3300046660 Ga0495625_0376015 Ga0495625_0376015_220_585 121
464 3300046663 Ga0495635_0145633 Ga0495635_0145633_615_1007 121
465 3300046674 Ga0495588_0007336 Ga0495588_0007336_2113_2478 121
466 3300046674 Ga0495588_0110523 Ga0495588_0110523_953_1375 121
467 3300046681 Ga0495647_0538129 Ga0495647_0538129_43_408 121
468 3300046684 Ga0495669_0269583 Ga0495669_0269583_330_695 121
469 3300046691 Ga0495670_0039207 Ga0495670_0039207_195_560 121
470 3300046691 Ga0495670_0112447 Ga0495670_0112447_143_508 121
471 3300046691 Ga0495670_0163148 Ga0495670_0163148_130_552 121
472 3300046692 Ga0495671_0089738 Ga0495671_0089738_370_792 121
473 3300046794 Ga0495589_0103033 Ga0495589_0103033_454_876 121
474 3300046794 Ga0495589_0111160 Ga0495589_0111160_122_487 121
475 3300047318 Ga0495636_0077561 Ga0495636_0077561_349_714 121
476 3300047323 Ga0495683_0474998 Ga0495683_0474998_63_428 121
477 3300047444 Ga0495675_0606690 Ga0495675_0606690_24_389 121
478 3300047445 Ga0495677_0067538 Ga0495677_0067538_93_458 121
479 3300047445 Ga0495677_0191472 Ga0495677_0191472_198_563 121
480 3300047446 Ga0495679_160933 Ga0495679_160933_77_499 121
481 3300047469 Ga0495673_0083456 Ga0495673_0083456_232_597 121
482 3300047469 Ga0495673_0186672 Ga0495673_0186672_364_729 121
483 3300048090 Ga0495615_0052012 Ga0495615_0052012_220_642 121
484 3300048091 Ga0495626_0127656 Ga0495626_0127656_242_607 121
485 3300048903 Ga0496100_0394592 Ga0496100_0394592_341_706 121
486 3300048903 Ga0496100_0641603 Ga0496100_0641603_45_410 121
487 3300048904 Ga0496101_0075055 Ga0496101_0075055_362_742 121
488 3300048904 Ga0496101_0105094 Ga0496101_0105094_1561_1926 121
489 3300048904 Ga0496101_0453350 Ga0496101_0453350_113_478 121
490 3300048904 Ga0496101_0514497 Ga0496101_0514497_322_687 121
491 3300048905 Ga0496102_0380154 Ga0496102_0380154_122_487 121
492 3300048905 Ga0496102_0962906 Ga0496102_0962906_177_542 121
493 3300048905 Ga0496102_1057104 Ga0496102_1057104_221_586 121
494 3300048906 Ga0496103_0296231 Ga0496103_0296231_328_693 121
495 3300048906 Ga0496103_0332347 Ga0496103_0332347_572_952 121
496 3300048906 Ga0496103_0789321 Ga0496103_0789321_46_411 121
497 3300048907 Ga0496104_0003553 Ga0496104_0003553_12534_12899 121
498 3300048907 Ga0496104_0026734 Ga0496104_0026734_936_1301 121
499 3300048907 Ga0496104_0208151 Ga0496104_0208151_964_1329 121
500 3300048907 Ga0496104_0273637 Ga0496104_0273637_69_434 121
501 3300048907 Ga0496104_0436381 Ga0496104_0436381_807_1187 121
502 3300048907 Ga0496104_0558364 Ga0496104_0558364_473_853 121
503 3300048908 Ga0496105_0005843 Ga0496105_0005843_3092_3457 121
504 3300048908 Ga0496105_0066489 Ga0496105_0066489_82_462 121
505 3300048908 Ga0496105_0258568 Ga0496105_0258568_351_716 121
506 3300048908 Ga0496105_0345596 Ga0496105_0345596_544_909 121
507 3300048909 Ga0496106_0355229 Ga0496106_0355229_48_413 121
508 3300048909 Ga0496106_0806805 Ga0496106_0806805_53_418 121
509 3300048910 Ga0496107_0537257 Ga0496107_0537257_249_629 121
510 3300048910 Ga0496107_1132600 Ga0496107_1132600_64_429 121
511 3300048911 Ga0496108_0020730 Ga0496108_0020730_1119_1484 121
512 3300048911 Ga0496108_0262230 Ga0496108_0262230_698_1078 121
513 3300048912 Ga0496109_0188347 Ga0496109_0188347_936_1301 121
514 3300048912 Ga0496109_1789872 Ga0496109_1789872_87_467 121
515 3300048913 Ga0496110_0107424 Ga0496110_0107424_398_763 121
516 3300048913 Ga0496110_0371924 Ga0496110_0371924_886_1251 121
517 3300048913 Ga0496110_0595230 Ga0496110_0595230_386_766 121
518 3300048913 Ga0496110_0615947 Ga0496110_0615947_407_772 121
519 3300048914 Ga0496111_0040302 Ga0496111_0040302_981_1346 121
520 3300048914 Ga0496111_0147239 Ga0496111_0147239_10_375 121
521 3300048914 Ga0496111_0209481 Ga0496111_0209481_640_1020 121
522 3300048914 Ga0496111_0469200 Ga0496111_0469200_528_893 121
523 3300048915 Ga0496112_0012229 Ga0496112_0012229_2036_2416 121
524 3300048915 Ga0496112_0025634 Ga0496112_0025634_4432_4797 121
525 3300048916 Ga0496113_0662113 Ga0496113_0662113_32_412 121
526 3300048917 Ga0496114_0004423 Ga0496114_0004423_4588_4953 121
527 3300048917 Ga0496114_0913209 Ga0496114_0913209_180_560 121
528 3300048918 Ga0496115_0014949 Ga0496115_0014949_550_915 121
529 3300048918 Ga0496115_0019746 Ga0496115_0019746_246_626 121
530 3300048918 Ga0496115_0128737 Ga0496115_0128737_1682_2047 121
531 3300048918 Ga0496115_0159969 Ga0496115_0159969_1442_1807 121
532 3300048920 Ga0496117_0125246 Ga0496117_0125246_358_723 121
533 3300048921 Ga0496118_0497839 Ga0496118_0497839_25_390 121
534 3300048924 Ga0496121_0120593 Ga0496121_0120593_1440_1805 121
535 3300048924 Ga0496121_0270060 Ga0496121_0270060_489_854 121
536 3300048924 Ga0496121_0609782 Ga0496121_0609782_278_643 121
537 3300048927 Ga0496124_0213718 Ga0496124_0213718_1007_1372 121
538 3300048929 Ga0496126_0005831 Ga0496126_0005831_10556_10921 121
539 3300048929 Ga0496126_0032606 Ga0496126_0032606_2928_3293 121
540 3300048929 Ga0496126_0389043 Ga0496126_0389043_318_683 121
541 3300048929 Ga0496126_0399776 Ga0496126_0399776_332_697 121
542 3300050489 nmdc:mga03683_491508_c1 nmdc:mga03683_491508_c1_78_443 121
543 3300050489 nmdc:mga03683_637886_c1 nmdc:mga03683_637886_c1_67_432 121
544 3300050491 nmdc:mga00v17_834495_c1 nmdc:mga00v17_834495_c1_52_417 121
545 3300050492 nmdc:mga0yw44_125590_c1 nmdc:mga0yw44_125590_c1_933_1298 121
546 3300050492 nmdc:mga0yw44_31797_c1 nmdc:mga0yw44_31797_c1_2417_2782 121
547 3300050492 nmdc:mga0yw44_503758_c1 nmdc:mga0yw44_503758_c1_29_394 121
548 3300050493 nmdc:mga0k408_148173_c1 nmdc:mga0k408_148173_c1_1008_1373 121
549 3300050493 nmdc:mga0k408_205461_c2 nmdc:mga0k408_205461_c2_149_514 121
550 3300050493 nmdc:mga0k408_459337_c1 nmdc:mga0k408_459337_c1_373_738 121
551 3300050494 nmdc:mga06z11_262640_c1 nmdc:mga06z11_262640_c1_154_519 121
552 3300050494 nmdc:mga06z11_452217_c1 nmdc:mga06z11_452217_c1_392_757 121
553 3300050494 nmdc:mga06z11_8466_c1 nmdc:mga06z11_8466_c1_1810_2175 121
554 3300050495 nmdc:mga04h51_55291_c1 nmdc:mga04h51_55291_c1_22_387 121
555 3300050496 nmdc:mga07m45_6750_c1 nmdc:mga07m45_6750_c1_117_482 121
556 3300050507 nmdc:mga05p37_196622_c1 nmdc:mga05p37_196622_c1_424_789 121
557 3300050511 nmdc:mga08y16_805746_c1 nmdc:mga08y16_805746_c1_270_635 121
558 3300050513 nmdc:mga0rr50_741232_c1 nmdc:mga0rr50_741232_c1_76_441 121
559 3300050514 nmdc:mga08x19_61530_c1 nmdc:mga08x19_61530_c1_753_1118 121
560 3300050514 nmdc:mga08x19_619177_c1 nmdc:mga08x19_619177_c1_32_397 121
561 3300050516 nmdc:mga0sz30_145405_c1 nmdc:mga0sz30_145405_c1_135_500 121
562 3300050516 nmdc:mga0sz30_360742_c1 nmdc:mga0sz30_360742_c1_255_620 121
563 3300050516 nmdc:mga0sz30_397579_c1 nmdc:mga0sz30_397579_c1_28_393 121
564 3300053084 Ga0495595_0183165 Ga0495595_0183165_619_1011 121
565 3300053092 Ga0500583_0108192 Ga0500583_0108192_96_461 121
566 3300053150 Ga0500603_051358 Ga0500603_051358_308_676 121
567 3300053177 Ga0500636_0049352 Ga0500636_0049352_710_1078 121
568 3300053730 Ga0500645_029720 Ga0500645_029720_961_1326 121
569 3300053737 Ga0500601_003418 Ga0500601_003418_600_968 121
570 3300001989 JGI24739J22299_10030504 JGI24739J22299_100305043 122
571 3300001990 JGI24737J22298_10002347 JGI24737J22298_100023474 122
572 3300002067 JGI24735J21928_10101567 JGI24735J21928_101015672 122
573 3300005455 Ga0070663_100319448 Ga0070663_1003194482 122
574 3300005539 Ga0068853_100210598 Ga0068853_1002105981 122
575 3300005543 Ga0070672_101091826 Ga0070672_1010918262 122
576 3300005563 Ga0068855_100051001 Ga0068855_1000510014 122
577 3300005577 Ga0068857_100028661 Ga0068857_1000286614 122
578 3300005578 Ga0068854_100014717 Ga0068854_1000147174 122
579 3300005614 Ga0068856_100035106 Ga0068856_1000351064 122
580 3300007788 Ga0099795_10000005 Ga0099795_1000000583 122
581 3300009093 Ga0105240_10016877 Ga0105240_1001687712 122
582 3300009545 Ga0105237_10273970 Ga0105237_102739702 122
583 3300009545 Ga0105237_10342514 Ga0105237_103425142 122
584 3300009551 Ga0105238_10524792 Ga0105238_105247922 122
585 3300010159 Ga0099796_10000023 Ga0099796_1000002317 122
586 3300010375 Ga0105239_10015287 Ga0105239_100152879 122
587 3300025904 Ga0207647_10001253 Ga0207647_100012533 122
588 3300025913 Ga0207695_10109077 Ga0207695_101090773 122
589 3300025914 Ga0207671_10413225 Ga0207671_104132252 122
590 3300025949 Ga0207667_10039623 Ga0207667_100396235 122
591 3300025981 Ga0207640_10021128 Ga0207640_100211283 122
592 3300026067 Ga0207678_10025952 Ga0207678_100259526 122
593 3300026078 Ga0207702_10013602 Ga0207702_100136027 122
594 3300026116 Ga0207674_10016173 Ga0207674_100161733 122
595 3300027512 Ga0209179_1000175 Ga0209179_10001755 122
596 3300039453 Ga0436362_0741099 Ga0436362_0741099_3885_4253 122

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6569 6 113
3nn3-assembly1.cif.gz_C structure of chlorite dismutase from candidatus nitrospira defluvii r173a mutant 0.6161 2 118
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6108 4 115
2nzc-assembly1.cif.gz_C the structure of uncharacterized protein tm1266 from thermotoga maritima. 0.5978 4 116
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.5942 6 113
ID Description Score Start End Superfamily
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6496 5 121 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6467 7 113 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6281 5 121 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6108 4 115 3.30.70.1060
2nzcC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.6062 4 116 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A6N6STJ8-F1-model_v4 YCII-related domain-containing protein 0.9433 5 121
AF-A0A0Q7EPN5-F1-model_v4 YCII-related domain-containing protein 0.9407 4 118
AF-A0A3N8DQT5-F1-model_v4 deleted 0.9401 1 121
AF-A0A1E4FS47-F1-model_v4 YCII-related domain-containing protein 0.9399 2 121
AF-A0A2U0T9G8-F1-model_v4 deleted 0.9397 5 121

Feature Viewer

pLDDT pTM Quality
91.1 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map