F467574
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 596 | 330 | 581 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300031730|Ga0307516_10053240|Ga0307516_100532403 |
| Length | 116 |
| Sequence | MSTSDTFLAVFLGSKTSAKMAAWNALPEAERRSREQQGIWVEKHQASLVELGGPLGKTTRVDSSGIADISNELGAFTVVRAASHEAAAKLFENHPHFAIFPGERVEIMPVLPIPGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 3 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 4 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 5 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 6 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 7 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 8 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 9 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 190 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 196 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 223 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 224 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 294 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 318 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 319 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 322 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 323 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 326 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 327 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 328 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 329 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 330 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.48 |
| Metatranscriptomes | 0.17 |
| Isolates | 2.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.56 |
| Nodule | 1.51 |
| Rhizoplane | 9.23 |
| Rhizosphere | 75.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10030504 | 3300001989 | Bacteria | 1868 |
| 2 | JGI24737J22298_10002347 | 3300001990 | Bacteria | 6747 |
| 3 | JGI24735J21928_10101567 | 3300002067 | Bacteria | 826 |
| 4 | rootH1_10019068 | 3300003323 | Bacteria | 1033 |
| 5 | Ga0055529_1049128 | 3300003763 | Bacteria | 506 |
| 6 | Ga0070690_100037484 | 3300005330 | Bacteria | 3055 |
| 7 | Ga0070690_100375042 | 3300005330 | Bacteria | 1039 |
| 8 | Ga0070670_100060834 | 3300005331 | Unclassified | 3243 |
| 9 | Ga0068869_100254987 | 3300005334 | Bacteria | 1402 |
| 10 | Ga0070666_10004960 | 3300005335 | Bacteria | 8139 |
| 11 | Ga0068868_100100778 | 3300005338 | Bacteria | 2337 |
| 12 | Ga0068868_101978623 | 3300005338 | Bacteria | 553 |
| 13 | Ga0070689_100470638 | 3300005340 | Bacteria | 1072 |
| 14 | Ga0070689_100563710 | 3300005340 | Bacteria | 983 |
| 15 | Ga0070691_10256568 | 3300005341 | Bacteria | 940 |
| 16 | Ga0070668_100296204 | 3300005347 | Bacteria | 1355 |
| 17 | Ga0070668_101140734 | 3300005347 | Bacteria | 705 |
| 18 | Ga0070668_101579991 | 3300005347 | Bacteria | 601 |
| 19 | Ga0070668_102149887 | 3300005347 | Bacteria | 515 |
| 20 | Ga0070669_100235249 | 3300005353 | Bacteria | 1453 |
| 21 | Ga0070675_100256096 | 3300005354 | Bacteria | 1533 |
| 22 | Ga0070671_100674123 | 3300005355 | Bacteria | 896 |
| 23 | Ga0070671_101096899 | 3300005355 | Bacteria | 699 |
| 24 | Ga0070674_100888105 | 3300005356 | Bacteria | 776 |
| 25 | Ga0070688_100137146 | 3300005365 | Bacteria | 1658 |
| 26 | Ga0070659_101001387 | 3300005366 | Bacteria | 734 |
| 27 | Ga0070667_100089815 | 3300005367 | Bacteria | 2639 |
| 28 | Ga0070667_100495448 | 3300005367 | Bacteria | 1120 |
| 29 | Ga0070667_101540081 | 3300005367 | Bacteria | 625 |
| 30 | Ga0070703_10241851 | 3300005406 | Bacteria | 728 |
| 31 | Ga0070709_10236761 | 3300005434 | Unclassified | 1309 |
| 32 | Ga0070709_11203803 | 3300005434 | Bacteria | 609 |
| 33 | Ga0070714_100290700 | 3300005435 | Bacteria | 1521 |
| 34 | Ga0070714_101118137 | 3300005435 | Bacteria | 768 |
| 35 | Ga0070713_100005990 | 3300005436 | Bacteria | 8366 |
| 36 | Ga0070713_100291741 | 3300005436 | Bacteria | 1499 |
| 37 | Ga0070713_100330419 | 3300005436 | Bacteria | 1410 |
| 38 | Ga0070710_11148947 | 3300005437 | Bacteria | 572 |
| 39 | Ga0070711_100004982 | 3300005439 | Bacteria | 7886 |
| 40 | Ga0070711_100379279 | 3300005439 | Bacteria | 1143 |
| 41 | Ga0070711_101062359 | 3300005439 | Bacteria | 696 |
| 42 | Ga0070705_100951340 | 3300005440 | Bacteria | 694 |
| 43 | Ga0070700_101974506 | 3300005441 | Bacteria | 506 |
| 44 | Ga0070663_100073751 | 3300005455 | Bacteria | 2490 |
| 45 | Ga0070663_100239235 | 3300005455 | Bacteria | 1432 |
| 46 | Ga0070663_100319448 | 3300005455 | Bacteria | 1248 |
| 47 | Ga0070663_100320808 | 3300005455 | Bacteria | 1246 |
| 48 | Ga0070663_100505009 | 3300005455 | Bacteria | 1005 |
| 49 | Ga0070663_101653058 | 3300005455 | Bacteria | 572 |
| 50 | Ga0070678_100345611 | 3300005456 | Bacteria | 1277 |
| 51 | Ga0070678_100483667 | 3300005456 | Bacteria | 1090 |
| 52 | Ga0070678_100827993 | 3300005456 | Unclassified | 842 |
| 53 | Ga0070678_101516938 | 3300005456 | Bacteria | 628 |
| 54 | Ga0070662_100742709 | 3300005457 | Bacteria | 832 |
| 55 | Ga0070662_101146000 | 3300005457 | Bacteria | 668 |
| 56 | Ga0070681_10024432 | 3300005458 | Bacteria | 6084 |
| 57 | Ga0070681_10080702 | 3300005458 | Bacteria | 3209 |
| 58 | Ga0070681_10258569 | 3300005458 | Bacteria | 1653 |
| 59 | Ga0070706_100415779 | 3300005467 | Bacteria | 1252 |
| 60 | Ga0070698_100028998 | 3300005471 | Bacteria | 5744 |
| 61 | Ga0070698_100911268 | 3300005471 | Bacteria | 825 |
| 62 | Ga0070679_100009248 | 3300005530 | Bacteria | 9314 |
| 63 | Ga0070679_100075893 | 3300005530 | Bacteria | 3351 |
| 64 | Ga0068853_100210598 | 3300005539 | Bacteria | 1771 |
| 65 | Ga0068853_100517318 | 3300005539 | Bacteria | 1128 |
| 66 | Ga0070672_100968967 | 3300005543 | Bacteria | 753 |
| 67 | Ga0070672_101091826 | 3300005543 | Bacteria | 709 |
| 68 | Ga0070686_100487026 | 3300005544 | Bacteria | 955 |
| 69 | Ga0070686_101570809 | 3300005544 | Bacteria | 556 |
| 70 | Ga0070695_100359125 | 3300005545 | Bacteria | 1093 |
| 71 | Ga0070693_100228290 | 3300005547 | Bacteria | 1223 |
| 72 | Ga0070665_100013100 | 3300005548 | Bacteria | 8350 |
| 73 | Ga0070665_100080609 | 3300005548 | Bacteria | 3260 |
| 74 | Ga0070665_100732835 | 3300005548 | Bacteria | 1001 |
| 75 | Ga0070665_101571943 | 3300005548 | Bacteria | 666 |
| 76 | Ga0070704_101604942 | 3300005549 | Bacteria | 600 |
| 77 | Ga0068855_100051001 | 3300005563 | Bacteria | 4875 |
| 78 | Ga0068855_100193304 | 3300005563 | Bacteria | 2294 |
| 79 | Ga0068855_101188578 | 3300005563 | Bacteria | 793 |
| 80 | Ga0068855_101243336 | 3300005563 | Bacteria | 773 |
| 81 | Ga0068857_100028661 | 3300005577 | Bacteria | 4913 |
| 82 | Ga0068857_100980136 | 3300005577 | Bacteria | 813 |
| 83 | Ga0068854_100014717 | 3300005578 | Bacteria | 5162 |
| 84 | Ga0068856_100035106 | 3300005614 | Bacteria | 4913 |
| 85 | Ga0068856_101039525 | 3300005614 | Bacteria | 837 |
| 86 | Ga0070702_100256668 | 3300005615 | Bacteria | 1188 |
| 87 | Ga0068859_100040226 | 3300005617 | Bacteria | 4693 |
| 88 | Ga0068864_100235961 | 3300005618 | Bacteria | 1693 |
| 89 | Ga0068864_100486535 | 3300005618 | Bacteria | 1185 |
| 90 | Ga0068866_10302007 | 3300005718 | Bacteria | 1000 |
| 91 | Ga0068861_100748718 | 3300005719 | Bacteria | 912 |
| 92 | Ga0068861_102715415 | 3300005719 | Bacteria | 500 |
| 93 | Ga0068870_10453388 | 3300005840 | Bacteria | 846 |
| 94 | Ga0068870_11039597 | 3300005840 | Bacteria | 586 |
| 95 | Ga0068863_100206790 | 3300005841 | Bacteria | 1889 |
| 96 | Ga0068860_100027726 | 3300005843 | Bacteria | 5454 |
| 97 | Ga0068860_100292732 | 3300005843 | Bacteria | 1593 |
| 98 | Ga0068860_101015534 | 3300005843 | Bacteria | 848 |
| 99 | Ga0068860_101759025 | 3300005843 | Bacteria | 642 |
| 100 | Ga0068862_100228976 | 3300005844 | Bacteria | 1685 |
| 101 | Ga0068862_100638985 | 3300005844 | Bacteria | 1025 |
| 102 | Ga0081540_1005216 | 3300005983 | Bacteria | 9725 |
| 103 | Ga0081540_1007193 | 3300005983 | Bacteria | 7985 |
| 104 | Ga0081540_1076704 | 3300005983 | Bacteria | 1522 |
| 105 | Ga0070717_10000460 | 3300006028 | Bacteria | 25862 |
| 106 | Ga0070717_10110309 | 3300006028 | Bacteria | 2346 |
| 107 | Ga0070717_11077288 | 3300006028 | Bacteria | 732 |
| 108 | Ga0075365_10016437 | 3300006038 | Bacteria | 4501 |
| 109 | Ga0075365_10075675 | 3300006038 | Bacteria | 2272 |
| 110 | Ga0075365_10144811 | 3300006038 | Bacteria | 1651 |
| 111 | Ga0075365_11209712 | 3300006038 | Bacteria | 531 |
| 112 | Ga0075368_10070444 | 3300006042 | Bacteria | 1411 |
| 113 | Ga0075368_10122637 | 3300006042 | Bacteria | 1077 |
| 114 | Ga0075363_100014770 | 3300006048 | Bacteria | 3825 |
| 115 | Ga0070715_10107371 | 3300006163 | Bacteria | 1312 |
| 116 | Ga0070716_100034174 | 3300006173 | Bacteria | 2786 |
| 117 | Ga0070716_100154821 | 3300006173 | Bacteria | 1478 |
| 118 | Ga0070716_100970695 | 3300006173 | Bacteria | 670 |
| 119 | Ga0070712_100073635 | 3300006175 | Bacteria | 2451 |
| 120 | Ga0070712_101622439 | 3300006175 | Bacteria | 566 |
| 121 | Ga0075362_10130809 | 3300006177 | Bacteria | 1193 |
| 122 | Ga0075367_10040157 | 3300006178 | Bacteria | 2731 |
| 123 | Ga0075367_10136379 | 3300006178 | Bacteria | 1518 |
| 124 | Ga0075369_10117031 | 3300006186 | Bacteria | 1204 |
| 125 | Ga0075369_10142974 | 3300006186 | Bacteria | 1091 |
| 126 | Ga0075369_10191822 | 3300006186 | Bacteria | 942 |
| 127 | Ga0075366_10032034 | 3300006195 | Bacteria | 3094 |
| 128 | Ga0075366_10107607 | 3300006195 | Bacteria | 1676 |
| 129 | Ga0075366_10874182 | 3300006195 | Bacteria | 560 |
| 130 | Ga0097621_100774264 | 3300006237 | Bacteria | 888 |
| 131 | Ga0075370_10020322 | 3300006353 | Bacteria | 3627 |
| 132 | Ga0075370_10138407 | 3300006353 | Bacteria | 1423 |
| 133 | Ga0068871_100154020 | 3300006358 | Bacteria | 1961 |
| 134 | Ga0075428_101303858 | 3300006844 | Bacteria | 764 |
| 135 | Ga0075433_10377914 | 3300006852 | Bacteria | 1251 |
| 136 | Ga0075434_100016328 | 3300006871 | Bacteria | 7137 |
| 137 | Ga0068865_100041421 | 3300006881 | Bacteria | 3134 |
| 138 | Ga0068865_100109505 | 3300006881 | Bacteria | 2035 |
| 139 | Ga0068865_100559409 | 3300006881 | Bacteria | 962 |
| 140 | Ga0068865_101931941 | 3300006881 | Bacteria | 535 |
| 141 | Ga0075436_100057729 | 3300006914 | Bacteria | 2680 |
| 142 | Ga0075436_100059273 | 3300006914 | Bacteria | 2644 |
| 143 | Ga0097620_100040226 | 3300006931 | Bacteria | 4693 |
| 144 | Ga0075435_100704487 | 3300007076 | Bacteria | 878 |
| 145 | Ga0099795_10000005 | 3300007788 | Bacteria | 107614 |
| 146 | Ga0099795_10366344 | 3300007788 | Bacteria | 648 |
| 147 | Ga0105240_10016877 | 3300009093 | Bacteria | 9867 |
| 148 | Ga0105240_10087516 | 3300009093 | Bacteria | 3815 |
| 149 | Ga0105240_10888648 | 3300009093 | Unclassified | 959 |
| 150 | Ga0111539_10124402 | 3300009094 | Bacteria | 3022 |
| 151 | Ga0111539_11133052 | 3300009094 | Bacteria | 909 |
| 152 | Ga0111539_13203975 | 3300009094 | Unclassified | 527 |
| 153 | Ga0105245_10014079 | 3300009098 | Bacteria | 6968 |
| 154 | Ga0105245_10464643 | 3300009098 | Bacteria | 1276 |
| 155 | Ga0105245_11950086 | 3300009098 | Bacteria | 640 |
| 156 | Ga0105247_10080734 | 3300009101 | Bacteria | 2049 |
| 157 | Ga0105247_10177383 | 3300009101 | Bacteria | 1420 |
| 158 | Ga0105247_10207519 | 3300009101 | Bacteria | 1320 |
| 159 | Ga0105247_10244064 | 3300009101 | Bacteria | 1225 |
| 160 | Ga0105247_10394507 | 3300009101 | Bacteria | 984 |
| 161 | Ga0105247_10583282 | 3300009101 | Bacteria | 827 |
| 162 | Ga0105247_10913872 | 3300009101 | Bacteria | 679 |
| 163 | Ga0114129_10144511 | 3300009147 | Bacteria | 3259 |
| 164 | Ga0105243_10353713 | 3300009148 | Bacteria | 1350 |
| 165 | Ga0105243_10501348 | 3300009148 | Bacteria | 1150 |
| 166 | Ga0105243_10562906 | 3300009148 | Bacteria | 1091 |
| 167 | Ga0105243_11385250 | 3300009148 | Bacteria | 723 |
| 168 | Ga0105243_12123316 | 3300009148 | Bacteria | 598 |
| 169 | Ga0105241_10225918 | 3300009174 | Bacteria | 1576 |
| 170 | Ga0105242_10015747 | 3300009176 | Bacteria | 5874 |
| 171 | Ga0105248_10330687 | 3300009177 | Bacteria | 1716 |
| 172 | Ga0105248_10410344 | 3300009177 | Bacteria | 1525 |
| 173 | Ga0105237_10106632 | 3300009545 | Bacteria | 2794 |
| 174 | Ga0105237_10273970 | 3300009545 | Bacteria | 1690 |
| 175 | Ga0105237_10276157 | 3300009545 | Bacteria | 1683 |
| 176 | Ga0105237_10342514 | 3300009545 | Bacteria | 1499 |
| 177 | Ga0105237_11336302 | 3300009545 | Bacteria | 723 |
| 178 | Ga0105238_10305586 | 3300009551 | Bacteria | 1575 |
| 179 | Ga0105238_10524792 | 3300009551 | Bacteria | 1187 |
| 180 | Ga0105238_11735058 | 3300009551 | Bacteria | 656 |
| 181 | Ga0105249_10513667 | 3300009553 | Bacteria | 1245 |
| 182 | Ga0105249_10681283 | 3300009553 | Bacteria | 1087 |
| 183 | Ga0105249_11022958 | 3300009553 | Bacteria | 895 |
| 184 | Ga0105249_11065330 | 3300009553 | Bacteria | 878 |
| 185 | Ga0105249_11122386 | 3300009553 | Bacteria | 857 |
| 186 | Ga0099796_10000023 | 3300010159 | Bacteria | 39177 |
| 187 | Ga0099796_10099297 | 3300010159 | Bacteria | 1093 |
| 188 | Ga0105239_10015287 | 3300010375 | Bacteria | 8506 |
| 189 | Ga0105239_10658645 | 3300010375 | Bacteria | 1196 |
| 190 | Ga0105239_11224090 | 3300010375 | Bacteria | 865 |
| 191 | Ga0105246_10206627 | 3300011119 | Bacteria | 1530 |
| 192 | Ga0157369_10307557 | 3300013105 | Bacteria | 1648 |
| 193 | Ga0157369_10488407 | 3300013105 | Bacteria | 1274 |
| 194 | Ga0157374_10035603 | 3300013296 | Bacteria | 4555 |
| 195 | Ga0157378_10677672 | 3300013297 | Bacteria | 1049 |
| 196 | Ga0163162_10159796 | 3300013306 | Bacteria | 2375 |
| 197 | Ga0163162_10351084 | 3300013306 | Bacteria | 1608 |
| 198 | Ga0163162_10980066 | 3300013306 | Bacteria | 955 |
| 199 | Ga0163162_11499894 | 3300013306 | Bacteria | 768 |
| 200 | Ga0163162_11624024 | 3300013306 | Bacteria | 737 |
| 201 | Ga0163162_12163275 | 3300013306 | Bacteria | 638 |
| 202 | Ga0157375_10406560 | 3300013308 | Bacteria | 1528 |
| 203 | Ga0157375_11029961 | 3300013308 | Bacteria | 962 |
| 204 | Ga0157375_12416927 | 3300013308 | Bacteria | 627 |
| 205 | Ga0157375_12758439 | 3300013308 | Bacteria | 587 |
| 206 | Ga0157375_13293055 | 3300013308 | Bacteria | 538 |
| 207 | Ga0163163_10012089 | 3300014325 | Bacteria | 7854 |
| 208 | Ga0163163_10073225 | 3300014325 | Bacteria | 3416 |
| 209 | Ga0163163_10203034 | 3300014325 | Bacteria | 2031 |
| 210 | Ga0157380_10109465 | 3300014326 | Bacteria | 2318 |
| 211 | Ga0157380_10283829 | 3300014326 | Bacteria | 1516 |
| 212 | Ga0157380_10428354 | 3300014326 | Bacteria | 1264 |
| 213 | Ga0157380_11317117 | 3300014326 | Bacteria | 770 |
| 214 | Ga0157377_10356285 | 3300014745 | Bacteria | 983 |
| 215 | Ga0157379_10023444 | 3300014968 | Bacteria | 5478 |
| 216 | Ga0157379_10148040 | 3300014968 | Bacteria | 2118 |
| 217 | Ga0157376_10014415 | 3300014969 | Bacteria | 5934 |
| 218 | Ga0157376_10095961 | 3300014969 | Bacteria | 2580 |
| 219 | Ga0157376_11195247 | 3300014969 | Bacteria | 788 |
| 220 | Ga0157376_11385431 | 3300014969 | Bacteria | 734 |
| 221 | Ga0157376_12989432 | 3300014969 | Bacteria | 512 |
| 222 | Ga0163161_10149977 | 3300017792 | Bacteria | 1771 |
| 223 | Ga0163161_10410046 | 3300017792 | Bacteria | 1088 |
| 224 | Ga0163161_10790755 | 3300017792 | Bacteria | 796 |
| 225 | Ga0163161_11129742 | 3300017792 | Bacteria | 675 |
| 226 | Ga0228598_1013692 | 3300024227 | Bacteria | 1605 |
| 227 | Ga0209148_1016579 | 3300025254 | Bacteria | 1265 |
| 228 | Ga0209233_1000694 | 3300025261 | Bacteria | 15931 |
| 229 | Ga0209455_1001710 | 3300025272 | Bacteria | 9395 |
| 230 | Ga0207692_10474809 | 3300025898 | Bacteria | 790 |
| 231 | Ga0207710_10201434 | 3300025900 | Bacteria | 983 |
| 232 | Ga0207688_10088637 | 3300025901 | Bacteria | 1774 |
| 233 | Ga0207688_10094246 | 3300025901 | Bacteria | 1722 |
| 234 | Ga0207688_10187461 | 3300025901 | Bacteria | 1236 |
| 235 | Ga0207680_10625090 | 3300025903 | Bacteria | 771 |
| 236 | Ga0207680_10697480 | 3300025903 | Unclassified | 727 |
| 237 | Ga0207647_10001253 | 3300025904 | Bacteria | 19532 |
| 238 | Ga0207685_10117700 | 3300025905 | Bacteria | 1161 |
| 239 | Ga0207699_10230614 | 3300025906 | Bacteria | 1268 |
| 240 | Ga0207699_10646900 | 3300025906 | Bacteria | 772 |
| 241 | Ga0207699_10801374 | 3300025906 | Bacteria | 692 |
| 242 | Ga0207645_10267439 | 3300025907 | Bacteria | 1133 |
| 243 | Ga0207643_10399027 | 3300025908 | Bacteria | 869 |
| 244 | Ga0207643_10642631 | 3300025908 | Bacteria | 684 |
| 245 | Ga0207684_10596827 | 3300025910 | Bacteria | 943 |
| 246 | Ga0207707_10032842 | 3300025912 | Bacteria | 4542 |
| 247 | Ga0207707_10089803 | 3300025912 | Bacteria | 2685 |
| 248 | Ga0207695_10109077 | 3300025913 | Bacteria | 2751 |
| 249 | Ga0207695_10112712 | 3300025913 | Bacteria | 2697 |
| 250 | Ga0207695_10981668 | 3300025913 | Unclassified | 724 |
| 251 | Ga0207671_10232053 | 3300025914 | Bacteria | 1448 |
| 252 | Ga0207671_10307417 | 3300025914 | Bacteria | 1253 |
| 253 | Ga0207671_10413225 | 3300025914 | Bacteria | 1073 |
| 254 | Ga0207693_10009325 | 3300025915 | Bacteria | 8001 |
| 255 | Ga0207693_10244528 | 3300025915 | Bacteria | 1408 |
| 256 | Ga0207693_11156517 | 3300025915 | Bacteria | 585 |
| 257 | Ga0207663_10025502 | 3300025916 | Bacteria | 3419 |
| 258 | Ga0207663_10852348 | 3300025916 | Bacteria | 727 |
| 259 | Ga0207660_11630639 | 3300025917 | Bacteria | 520 |
| 260 | Ga0207662_10173318 | 3300025918 | Bacteria | 1384 |
| 261 | Ga0207652_10010710 | 3300025921 | Bacteria | 7381 |
| 262 | Ga0207681_10620603 | 3300025923 | Bacteria | 895 |
| 263 | Ga0207650_10074994 | 3300025925 | Bacteria | 2551 |
| 264 | Ga0207687_10441628 | 3300025927 | Bacteria | 1078 |
| 265 | Ga0207687_10618365 | 3300025927 | Bacteria | 914 |
| 266 | Ga0207700_10010911 | 3300025928 | Bacteria | 5768 |
| 267 | Ga0207700_11183912 | 3300025928 | Bacteria | 682 |
| 268 | Ga0207700_11922123 | 3300025928 | Bacteria | 518 |
| 269 | Ga0207664_10059318 | 3300025929 | Bacteria | 3046 |
| 270 | Ga0207664_10440064 | 3300025929 | Bacteria | 1163 |
| 271 | Ga0207644_10871198 | 3300025931 | Bacteria | 754 |
| 272 | Ga0207644_11143662 | 3300025931 | Bacteria | 654 |
| 273 | Ga0207706_10231959 | 3300025933 | Bacteria | 1615 |
| 274 | Ga0207706_11455376 | 3300025933 | Bacteria | 560 |
| 275 | Ga0207686_10063429 | 3300025934 | Bacteria | 2350 |
| 276 | Ga0207709_10613756 | 3300025935 | Bacteria | 862 |
| 277 | Ga0207670_10388045 | 3300025936 | Bacteria | 1114 |
| 278 | Ga0207669_10345806 | 3300025937 | Bacteria | 1147 |
| 279 | Ga0207704_10568657 | 3300025938 | Bacteria | 924 |
| 280 | Ga0207704_11232176 | 3300025938 | Bacteria | 638 |
| 281 | Ga0207665_10023296 | 3300025939 | Bacteria | 4078 |
| 282 | Ga0207665_10091265 | 3300025939 | Bacteria | 2112 |
| 283 | Ga0207665_10412065 | 3300025939 | Bacteria | 1031 |
| 284 | Ga0207665_10456128 | 3300025939 | Bacteria | 982 |
| 285 | Ga0207711_10125296 | 3300025941 | Bacteria | 2297 |
| 286 | Ga0207711_10333584 | 3300025941 | Bacteria | 1403 |
| 287 | Ga0207711_10630299 | 3300025941 | Bacteria | 1000 |
| 288 | Ga0207689_10184753 | 3300025942 | Bacteria | 1719 |
| 289 | Ga0207667_10039623 | 3300025949 | Bacteria | 5021 |
| 290 | Ga0207667_10108706 | 3300025949 | Bacteria | 2860 |
| 291 | Ga0207667_10786977 | 3300025949 | Bacteria | 949 |
| 292 | Ga0207667_10974270 | 3300025949 | Bacteria | 837 |
| 293 | Ga0207651_10612600 | 3300025960 | Bacteria | 953 |
| 294 | Ga0207712_10867750 | 3300025961 | Bacteria | 796 |
| 295 | Ga0207668_10173030 | 3300025972 | Bacteria | 1695 |
| 296 | Ga0207668_10624358 | 3300025972 | Bacteria | 941 |
| 297 | Ga0207668_10951351 | 3300025972 | Bacteria | 766 |
| 298 | Ga0207668_10979695 | 3300025972 | Bacteria | 755 |
| 299 | Ga0207640_10021128 | 3300025981 | Bacteria | 3874 |
| 300 | Ga0207658_10262033 | 3300025986 | Bacteria | 1474 |
| 301 | Ga0207658_10312079 | 3300025986 | Bacteria | 1359 |
| 302 | Ga0207658_10681309 | 3300025986 | Unclassified | 928 |
| 303 | Ga0207658_11647929 | 3300025986 | Bacteria | 586 |
| 304 | Ga0207677_10063069 | 3300026023 | Bacteria | 2574 |
| 305 | Ga0207677_10535789 | 3300026023 | Bacteria | 1018 |
| 306 | Ga0207677_12014990 | 3300026023 | Bacteria | 537 |
| 307 | Ga0207703_10103043 | 3300026035 | Bacteria | 2422 |
| 308 | Ga0207639_10474867 | 3300026041 | Bacteria | 1139 |
| 309 | Ga0207639_10564999 | 3300026041 | Bacteria | 1046 |
| 310 | Ga0207678_10025952 | 3300026067 | Bacteria | 5112 |
| 311 | Ga0207678_10268443 | 3300026067 | Bacteria | 1463 |
| 312 | Ga0207678_10402078 | 3300026067 | Bacteria | 1186 |
| 313 | Ga0207678_11546810 | 3300026067 | Bacteria | 585 |
| 314 | Ga0207708_10353523 | 3300026075 | Bacteria | 1206 |
| 315 | Ga0207702_10013602 | 3300026078 | Bacteria | 6756 |
| 316 | Ga0207641_10805947 | 3300026088 | Bacteria | 929 |
| 317 | Ga0207641_11314141 | 3300026088 | Bacteria | 724 |
| 318 | Ga0207641_11543134 | 3300026088 | Bacteria | 666 |
| 319 | Ga0207676_11853785 | 3300026095 | Bacteria | 602 |
| 320 | Ga0207674_10016173 | 3300026116 | Bacteria | 8171 |
| 321 | Ga0207674_11053503 | 3300026116 | Bacteria | 782 |
| 322 | Ga0207675_100251674 | 3300026118 | Bacteria | 1710 |
| 323 | Ga0207675_101133473 | 3300026118 | Bacteria | 802 |
| 324 | Ga0207683_10051305 | 3300026121 | Bacteria | 3614 |
| 325 | Ga0207683_10155090 | 3300026121 | Bacteria | 2068 |
| 326 | Ga0207683_10323726 | 3300026121 | Bacteria | 1412 |
| 327 | Ga0209179_1000175 | 3300027512 | Bacteria | 6059 |
| 328 | Ga0209813_10128353 | 3300027866 | Bacteria | 889 |
| 329 | Ga0207428_10306685 | 3300027907 | Bacteria | 1174 |
| 330 | Ga0207428_10368040 | 3300027907 | Bacteria | 1056 |
| 331 | Ga0268266_10001136 | 3300028379 | Bacteria | 33101 |
| 332 | Ga0268266_10124447 | 3300028379 | Bacteria | 2299 |
| 333 | Ga0268266_11104722 | 3300028379 | Bacteria | 767 |
| 334 | Ga0268265_10192550 | 3300028380 | Bacteria | 1762 |
| 335 | Ga0268265_10198444 | 3300028380 | Bacteria | 1738 |
| 336 | Ga0268264_10062809 | 3300028381 | Bacteria | 3120 |
| 337 | Ga0268264_10865538 | 3300028381 | Bacteria | 906 |
| 338 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 339 | Ga0307515_10104075 | 3300028794 | Bacteria | 3396 |
| 340 | Ga0265760_10333543 | 3300031090 | Bacteria | 541 |
| 341 | Ga0265332_10113667 | 3300031238 | Bacteria | 1139 |
| 342 | Ga0265325_10030068 | 3300031241 | Bacteria | 2915 |
| 343 | Ga0265339_10102808 | 3300031249 | Bacteria | 1485 |
| 344 | Ga0265339_10220362 | 3300031249 | Bacteria | 928 |
| 345 | Ga0265331_10161814 | 3300031250 | Bacteria | 1014 |
| 346 | Ga0265316_11123974 | 3300031344 | Bacteria | 544 |
| 347 | Ga0307513_10418783 | 3300031456 | Bacteria | 1070 |
| 348 | Ga0307508_10127944 | 3300031616 | Bacteria | 2143 |
| 349 | Ga0265314_10156693 | 3300031711 | Bacteria | 1390 |
| 350 | Ga0265342_10115041 | 3300031712 | Bacteria | 1519 |
| 351 | Ga0307516_10053240 | 3300031730 | Bacteria | 3958 |
| 352 | Ga0307516_10171105 | 3300031730 | Bacteria | 1913 |
| 353 | Ga0307412_10627228 | 3300031911 | Bacteria | 914 |
| 354 | Ga0307416_100665573 | 3300032002 | Bacteria | 1127 |
| 355 | Ga0307510_10327889 | 3300033180 | Bacteria | 986 |
| 356 | Ga0307510_10453756 | 3300033180 | Bacteria | 723 |
| 357 | Ga0307510_10587261 | 3300033180 | Bacteria | 564 |
| 358 | Ga0373938_0012168 | 3300034957 | Bacteria | 1610 |
| 359 | Ga0373938_0082383 | 3300034957 | Bacteria | 785 |
| 360 | Ga0373929_0073539 | 3300035085 | Bacteria | 821 |
| 361 | Ga0373940_0012825 | 3300035088 | Bacteria | 2014 |
| 362 | Ga0373949_0023335 | 3300035090 | Bacteria | 1432 |
| 363 | Ga0373949_0278187 | 3300035090 | Unclassified | 525 |
| 364 | Ga0373923_0460800 | 3300035111 | Bacteria | 617 |
| 365 | Ga0373939_0059957 | 3300035114 | Bacteria | 1208 |
| 366 | Ga0373941_0041926 | 3300035115 | Bacteria | 1419 |
| 367 | Ga0373941_0391181 | 3300035115 | Bacteria | 573 |
| 368 | Ga0373945_0075784 | 3300035116 | Bacteria | 1281 |
| 369 | Ga0373945_0467734 | 3300035116 | Bacteria | 559 |
| 370 | Ga0373957_0342591 | 3300035120 | Bacteria | 638 |
| 371 | Ga0373943_0136937 | 3300035170 | Bacteria | 1316 |
| 372 | Ga0373961_0075393 | 3300035241 | Bacteria | 1051 |
| 373 | Ga0373962_0030285 | 3300035242 | Bacteria | 1480 |
| 374 | Ga0373962_0056827 | 3300035242 | Bacteria | 1140 |
| 375 | Ga0373924_0161939 | 3300035410 | Bacteria | 981 |
| 376 | Ga0373931_0003428 | 3300035691 | Bacteria | 7118 |
| 377 | Ga0373931_0004512 | 3300035691 | Bacteria | 6368 |
| 378 | Ga0373931_0020927 | 3300035691 | Bacteria | 3277 |
| 379 | Ga0373935_0097809 | 3300035692 | Bacteria | 1931 |
| 380 | Ga0373935_0344725 | 3300035692 | Bacteria | 1061 |
| 381 | Ga0373927_0005938 | 3300035695 | Bacteria | 8359 |
| 382 | Ga0373927_0039246 | 3300035695 | Bacteria | 3073 |
| 383 | Ga0373927_0470479 | 3300035695 | Bacteria | 830 |
| 384 | Ga0373933_0000026 | 3300035724 | Bacteria | 90309 |
| 385 | Ga0373947_0052793 | 3300035725 | Bacteria | 2449 |
| 386 | Ga0373947_0331050 | 3300035725 | Bacteria | 1020 |
| 387 | Ga0373937_0613407 | 3300036401 | Bacteria | 1033 |
| 388 | Ga0373925_0013452 | 3300037068 | Bacteria | 5923 |
| 389 | Ga0373925_0120413 | 3300037068 | Bacteria | 2037 |
| 390 | Ga0373925_0165062 | 3300037068 | Bacteria | 1746 |
| 391 | Ga0395898_0035872 | 3300037466 | Bacteria | 4928 |
| 392 | Ga0395898_0620566 | 3300037466 | Bacteria | 1024 |
| 393 | Ga0395898_0991435 | 3300037466 | Bacteria | 776 |
| 394 | Ga0395905_0462821 | 3300037471 | Bacteria | 1167 |
| 395 | Ga0395901_0181283 | 3300038443 | Bacteria | 2209 |
| 396 | Ga0436365_0939476 | 3300039437 | Bacteria | 1745 |
| 397 | Ga0436363_0400675 | 3300039450 | Bacteria | 706 |
| 398 | Ga0436362_0741099 | 3300039453 | Bacteria | 4353 |
| 399 | Ga0451789_0967346 | 3300041443 | Bacteria | 611 |
| 400 | Ga0451791_0402788 | 3300041451 | Bacteria | 642 |
| 401 | Ga0451791_1176742 | 3300041451 | Bacteria | 584 |
| 402 | Ga0451793_0828375 | 3300041452 | Bacteria | 623 |
| 403 | Ga0451798_0016358 | 3300041458 | Bacteria | 1101 |
| 404 | Ga0451802_1435137 | 3300041460 | Bacteria | 1094 |
| 405 | Ga0451807_1414763 | 3300041486 | Bacteria | 738 |
| 406 | Ga0451837_0986133 | 3300041494 | Bacteria | 611 |
| 407 | Ga0451841_1414058 | 3300041498 | Bacteria | 504 |
| 408 | Ga0451855_0305929 | 3300041511 | Bacteria | 576 |
| 409 | Ga0466966_0038431 | 3300044684 | Unclassified | 3085 |
| 410 | Ga0466961_0572202 | 3300044693 | Bacteria | 680 |
| 411 | Ga0466963_0540088 | 3300044694 | Bacteria | 823 |
| 412 | Ga0466964_0663256 | 3300044706 | Bacteria | 578 |
| 413 | Ga0466959_0053125 | 3300045049 | Bacteria | 2963 |
| 414 | Ga0466959_0394516 | 3300045049 | Unclassified | 941 |
| 415 | Ga0466958_0752862 | 3300045836 | Bacteria | 635 |
| 416 | Ga0466958_1080037 | 3300045836 | Unclassified | 524 |
| 417 | Ga0466967_0563761 | 3300045976 | Bacteria | 1122 |
| 418 | Ga0495617_015095 | 3300046452 | Bacteria | 2621 |
| 419 | Ga0495627_124392 | 3300046453 | Bacteria | 727 |
| 420 | Ga0495603_0043229 | 3300046455 | Bacteria | 2691 |
| 421 | Ga0495603_0074854 | 3300046455 | Bacteria | 1988 |
| 422 | Ga0495603_0689354 | 3300046455 | Bacteria | 584 |
| 423 | Ga0495590_0220458 | 3300046457 | Bacteria | 700 |
| 424 | Ga0495638_0576889 | 3300046460 | Bacteria | 555 |
| 425 | Ga0495641_0092177 | 3300046461 | Bacteria | 1354 |
| 426 | Ga0495651_0259012 | 3300046462 | Bacteria | 1184 |
| 427 | Ga0495650_0063664 | 3300046471 | Bacteria | 1470 |
| 428 | Ga0495650_0113151 | 3300046471 | Bacteria | 1006 |
| 429 | Ga0495582_0357182 | 3300046473 | Bacteria | 842 |
| 430 | Ga0495582_0812928 | 3300046473 | Bacteria | 541 |
| 431 | Ga0495605_0241247 | 3300046474 | Bacteria | 776 |
| 432 | Ga0495639_0050090 | 3300046475 | Bacteria | 1897 |
| 433 | Ga0495585_0311796 | 3300046492 | Bacteria | 771 |
| 434 | Ga0495596_0141335 | 3300046500 | Bacteria | 935 |
| 435 | Ga0495596_0163228 | 3300046500 | Bacteria | 866 |
| 436 | Ga0495607_0429765 | 3300046501 | Bacteria | 596 |
| 437 | Ga0495607_0510177 | 3300046501 | Bacteria | 532 |
| 438 | Ga0495630_0269329 | 3300046517 | Bacteria | 1301 |
| 439 | Ga0495643_0074090 | 3300046522 | Bacteria | 1784 |
| 440 | Ga0495644_0052273 | 3300046523 | Bacteria | 1534 |
| 441 | Ga0495644_0088630 | 3300046523 | Bacteria | 1167 |
| 442 | Ga0495663_0120853 | 3300046525 | Bacteria | 877 |
| 443 | Ga0495665_0489016 | 3300046531 | Bacteria | 620 |
| 444 | Ga0495598_0046091 | 3300046537 | Bacteria | 1294 |
| 445 | Ga0495621_0018971 | 3300046539 | Bacteria | 2240 |
| 446 | Ga0495621_0441835 | 3300046539 | Bacteria | 556 |
| 447 | Ga0495645_0363161 | 3300046543 | Bacteria | 930 |
| 448 | Ga0495622_0269882 | 3300046557 | Bacteria | 746 |
| 449 | Ga0495633_0053651 | 3300046558 | Bacteria | 1897 |
| 450 | Ga0495656_0084365 | 3300046615 | Bacteria | 1440 |
| 451 | Ga0495656_0214078 | 3300046615 | Bacteria | 961 |
| 452 | Ga0495656_0788141 | 3300046615 | Bacteria | 513 |
| 453 | Ga0495668_0029504 | 3300046616 | Bacteria | 3099 |
| 454 | Ga0495668_0052320 | 3300046616 | Bacteria | 2260 |
| 455 | Ga0495668_0082172 | 3300046616 | Bacteria | 1767 |
| 456 | Ga0495668_0332061 | 3300046616 | Bacteria | 834 |
| 457 | Ga0495611_0442893 | 3300046648 | Bacteria | 592 |
| 458 | Ga0495625_0376015 | 3300046660 | Bacteria | 892 |
| 459 | Ga0495635_0145633 | 3300046663 | Bacteria | 1613 |
| 460 | Ga0495588_0007336 | 3300046674 | Bacteria | 5012 |
| 461 | Ga0495588_0110523 | 3300046674 | Bacteria | 1448 |
| 462 | Ga0495647_0538129 | 3300046681 | Bacteria | 546 |
| 463 | Ga0495669_0269583 | 3300046684 | Bacteria | 818 |
| 464 | Ga0495670_0039207 | 3300046691 | Bacteria | 2362 |
| 465 | Ga0495670_0112447 | 3300046691 | Bacteria | 1410 |
| 466 | Ga0495670_0163148 | 3300046691 | Bacteria | 1171 |
| 467 | Ga0495671_0089738 | 3300046692 | Bacteria | 1505 |
| 468 | Ga0495589_0103033 | 3300046794 | Bacteria | 1380 |
| 469 | Ga0495589_0111160 | 3300046794 | Bacteria | 1322 |
| 470 | Ga0495604_0498872 | 3300047317 | Bacteria | 790 |
| 471 | Ga0495636_0077561 | 3300047318 | Bacteria | 1426 |
| 472 | Ga0495683_0474998 | 3300047323 | Bacteria | 510 |
| 473 | Ga0495675_0606690 | 3300047444 | Bacteria | 620 |
| 474 | Ga0495677_0067538 | 3300047445 | Bacteria | 1330 |
| 475 | Ga0495677_0191472 | 3300047445 | Bacteria | 794 |
| 476 | Ga0495679_160933 | 3300047446 | Bacteria | 600 |
| 477 | Ga0495673_0083456 | 3300047469 | Bacteria | 1319 |
| 478 | Ga0495673_0186672 | 3300047469 | Bacteria | 782 |
| 479 | Ga0495684_0547276 | 3300047471 | Bacteria | 789 |
| 480 | Ga0495615_0052012 | 3300048090 | Bacteria | 1057 |
| 481 | Ga0495626_0127656 | 3300048091 | Bacteria | 1088 |
| 482 | Ga0496100_0394592 | 3300048903 | Bacteria | 1053 |
| 483 | Ga0496100_0641603 | 3300048903 | Bacteria | 826 |
| 484 | Ga0496100_1409896 | 3300048903 | Bacteria | 550 |
| 485 | Ga0496101_0075055 | 3300048904 | Bacteria | 2488 |
| 486 | Ga0496101_0105094 | 3300048904 | Bacteria | 2119 |
| 487 | Ga0496101_0453350 | 3300048904 | Bacteria | 1012 |
| 488 | Ga0496101_0514497 | 3300048904 | Bacteria | 946 |
| 489 | Ga0496102_0380154 | 3300048905 | Bacteria | 1329 |
| 490 | Ga0496102_0962906 | 3300048905 | Bacteria | 774 |
| 491 | Ga0496102_1057104 | 3300048905 | Bacteria | 732 |
| 492 | Ga0496103_0296231 | 3300048906 | Bacteria | 1041 |
| 493 | Ga0496103_0332347 | 3300048906 | Bacteria | 977 |
| 494 | Ga0496103_0789321 | 3300048906 | Bacteria | 599 |
| 495 | Ga0496104_0003553 | 3300048907 | Bacteria | 13448 |
| 496 | Ga0496104_0026734 | 3300048907 | Bacteria | 5332 |
| 497 | Ga0496104_0208151 | 3300048907 | Bacteria | 1868 |
| 498 | Ga0496104_0273637 | 3300048907 | Bacteria | 1601 |
| 499 | Ga0496104_0436381 | 3300048907 | Bacteria | 1221 |
| 500 | Ga0496104_0558364 | 3300048907 | Bacteria | 1055 |
| 501 | Ga0496105_0005843 | 3300048908 | Bacteria | 9384 |
| 502 | Ga0496105_0066489 | 3300048908 | Bacteria | 2976 |
| 503 | Ga0496105_0258568 | 3300048908 | Bacteria | 1409 |
| 504 | Ga0496105_0345596 | 3300048908 | Bacteria | 1189 |
| 505 | Ga0496106_0355229 | 3300048909 | Bacteria | 1177 |
| 506 | Ga0496106_0806805 | 3300048909 | Bacteria | 744 |
| 507 | Ga0496107_0537257 | 3300048910 | Bacteria | 866 |
| 508 | Ga0496107_1132600 | 3300048910 | Bacteria | 564 |
| 509 | Ga0496108_0020730 | 3300048911 | Bacteria | 5403 |
| 510 | Ga0496108_0262230 | 3300048911 | Bacteria | 1504 |
| 511 | Ga0496109_0188347 | 3300048912 | Bacteria | 1938 |
| 512 | Ga0496109_1789872 | 3300048912 | Bacteria | 547 |
| 513 | Ga0496110_0107424 | 3300048913 | Bacteria | 2505 |
| 514 | Ga0496110_0371924 | 3300048913 | Bacteria | 1302 |
| 515 | Ga0496110_0595230 | 3300048913 | Bacteria | 1003 |
| 516 | Ga0496110_0615947 | 3300048913 | Bacteria | 984 |
| 517 | Ga0496111_0040302 | 3300048914 | Bacteria | 3350 |
| 518 | Ga0496111_0147239 | 3300048914 | Bacteria | 1746 |
| 519 | Ga0496111_0209481 | 3300048914 | Bacteria | 1448 |
| 520 | Ga0496111_0469200 | 3300048914 | Bacteria | 928 |
| 521 | Ga0496112_0012229 | 3300048915 | Bacteria | 7879 |
| 522 | Ga0496112_0025634 | 3300048915 | Bacteria | 5663 |
| 523 | Ga0496113_0662113 | 3300048916 | Bacteria | 834 |
| 524 | Ga0496114_0004423 | 3300048917 | Bacteria | 10907 |
| 525 | Ga0496114_0913209 | 3300048917 | Bacteria | 759 |
| 526 | Ga0496115_0014949 | 3300048918 | Bacteria | 5883 |
| 527 | Ga0496115_0019746 | 3300048918 | Bacteria | 5189 |
| 528 | Ga0496115_0128737 | 3300048918 | Bacteria | 2086 |
| 529 | Ga0496115_0159969 | 3300048918 | Bacteria | 1861 |
| 530 | Ga0496117_0125246 | 3300048920 | Bacteria | 1570 |
| 531 | Ga0496118_0497839 | 3300048921 | Bacteria | 607 |
| 532 | Ga0496121_0120593 | 3300048924 | Bacteria | 1981 |
| 533 | Ga0496121_0270060 | 3300048924 | Bacteria | 1169 |
| 534 | Ga0496121_0609782 | 3300048924 | Bacteria | 672 |
| 535 | Ga0496124_0213718 | 3300048927 | Bacteria | 1457 |
| 536 | Ga0496126_0005831 | 3300048929 | Bacteria | 13924 |
| 537 | Ga0496126_0032606 | 3300048929 | Bacteria | 4906 |
| 538 | Ga0496126_0389043 | 3300048929 | Bacteria | 1133 |
| 539 | Ga0496126_0399776 | 3300048929 | Bacteria | 1114 |
| 540 | Ga0501067_0383592 | 3300049583 | Bacteria | 784 |
| 541 | nmdc:mga03683_491508_c1 | 3300050489 | Bacteria | 593 |
| 542 | nmdc:mga03683_637886_c1 | 3300050489 | Bacteria | 523 |
| 543 | nmdc:mga00v17_834495_c1 | 3300050491 | Bacteria | 586 |
| 544 | nmdc:mga0yw44_125590_c1 | 3300050492 | Bacteria | 1657 |
| 545 | nmdc:mga0yw44_31797_c1 | 3300050492 | Bacteria | 3071 |
| 546 | nmdc:mga0yw44_503758_c1 | 3300050492 | Bacteria | 822 |
| 547 | nmdc:mga0yw44_91277_c1 | 3300050492 | Bacteria | 1925 |
| 548 | nmdc:mga0k408_148173_c1 | 3300050493 | Bacteria | 1397 |
| 549 | nmdc:mga0k408_205461_c2 | 3300050493 | Bacteria | 800 |
| 550 | nmdc:mga0k408_459337_c1 | 3300050493 | Bacteria | 756 |
| 551 | nmdc:mga06z11_262640_c1 | 3300050494 | Bacteria | 1019 |
| 552 | nmdc:mga06z11_452217_c1 | 3300050494 | Bacteria | 776 |
| 553 | nmdc:mga06z11_8466_c1 | 3300050494 | Bacteria | 4291 |
| 554 | nmdc:mga04h51_110906_c1 | 3300050495 | Bacteria | 1011 |
| 555 | nmdc:mga04h51_55291_c1 | 3300050495 | Bacteria | 1344 |
| 556 | nmdc:mga07m45_6750_c1 | 3300050496 | Bacteria | 1179 |
| 557 | nmdc:mga05p37_196622_c1 | 3300050507 | Bacteria | 2445 |
| 558 | nmdc:mga08y16_805746_c1 | 3300050511 | Unclassified | 932 |
| 559 | nmdc:mga0n895_13760_c1 | 3300050512 | Bacteria | 7317 |
| 560 | nmdc:mga0rr50_144231_c1 | 3300050513 | Bacteria | 1918 |
| 561 | nmdc:mga0rr50_741232_c1 | 3300050513 | Bacteria | 838 |
| 562 | nmdc:mga08x19_50119_c1 | 3300050514 | Bacteria | 2678 |
| 563 | nmdc:mga08x19_61530_c1 | 3300050514 | Bacteria | 2433 |
| 564 | nmdc:mga08x19_619177_c1 | 3300050514 | Bacteria | 767 |
| 565 | nmdc:mga0a205_653515_c1 | 3300050515 | Bacteria | 903 |
| 566 | nmdc:mga0sz30_145405_c1 | 3300050516 | Bacteria | 1047 |
| 567 | nmdc:mga0sz30_360742_c1 | 3300050516 | Bacteria | 650 |
| 568 | nmdc:mga0sz30_397579_c1 | 3300050516 | Bacteria | 617 |
| 569 | Ga0495601_0301777 | 3300053077 | Bacteria | 1043 |
| 570 | Ga0495612_0157977 | 3300053078 | Bacteria | 989 |
| 571 | Ga0495595_0183165 | 3300053084 | Bacteria | 1039 |
| 572 | Ga0495619_0059248 | 3300053085 | Bacteria | 2544 |
| 573 | Ga0500583_0108192 | 3300053092 | Bacteria | 1367 |
| 574 | Ga0500655_009005 | 3300053133 | Bacteria | 1796 |
| 575 | Ga0500658_0072704 | 3300053134 | Bacteria | 1455 |
| 576 | Ga0500559_0009452 | 3300053136 | Bacteria | 4218 |
| 577 | Ga0500603_051358 | 3300053150 | Bacteria | 1129 |
| 578 | Ga0500639_097955 | 3300053163 | Bacteria | 1449 |
| 579 | Ga0500636_0049352 | 3300053177 | Bacteria | 2476 |
| 580 | Ga0500645_029720 | 3300053730 | Bacteria | 1648 |
| 581 | Ga0500601_003418 | 3300053737 | Bacteria | 1721 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2791355199 | 2793078833 | 100 |
| 2 | 3300006852 | Ga0075433_10377914 | Ga0075433_103779142 | 105 |
| 3 | 3300006871 | Ga0075434_100016328 | Ga0075434_1000163288 | 105 |
| 4 | 3300006914 | Ga0075436_100057729 | Ga0075436_1000577293 | 105 |
| 5 | 3300050512 | nmdc:mga0n895_13760_c1 | nmdc:mga0n895_13760_c1_6788_7156 | 105 |
| 6 | 3300050513 | nmdc:mga0rr50_144231_c1 | nmdc:mga0rr50_144231_c1_253_621 | 105 |
| 7 | 3300050514 | nmdc:mga08x19_50119_c1 | nmdc:mga08x19_50119_c1_987_1355 | 105 |
| 8 | 3300050515 | nmdc:mga0a205_653515_c1 | nmdc:mga0a205_653515_c1_48_416 | 105 |
| 9 | 3300053133 | Ga0500655_009005 | Ga0500655_009005_1086_1541 | 107 |
| 10 | 3300046474 | Ga0495605_0241247 | Ga0495605_0241247_388_753 | 113 |
| 11 | 3300053134 | Ga0500658_0072704 | Ga0500658_0072704_297_662 | 113 |
| 12 | 3300006038 | Ga0075365_10144811 | Ga0075365_101448113 | 114 |
| 13 | 3300050492 | nmdc:mga0yw44_91277_c1 | nmdc:mga0yw44_91277_c1_549_911 | 114 |
| 14 | 3300031730 | Ga0307516_10053240 | Ga0307516_100532403 | 116 |
| 15 | 3300046517 | Ga0495630_0269329 | Ga0495630_0269329_879_1244 | 116 |
| 16 | 3300048903 | Ga0496100_1409896 | Ga0496100_1409896_37_402 | 116 |
| 17 | 3300053078 | Ga0495612_0157977 | Ga0495612_0157977_556_921 | 116 |
| 18 | iso_pu_bacteria | 8006926726 | 8006932930 | 116 |
| 19 | iso_pu_bacteria | 2508501128 | 2509147817 | 117 |
| 20 | iso_pu_bacteria | 2824679649 | 2824685738 | 117 |
| 21 | iso_pu_bacteria | 2876808645 | 2876817820 | 117 |
| 22 | iso_pu_bacteria | 2879110137 | 2879116804 | 117 |
| 23 | iso_pu_bacteria | 2885383462 | 2885387304 | 117 |
| 24 | iso_pu_bacteria | 2889033259 | 2889034458 | 117 |
| 25 | iso_pu_bacteria | 2922361189 | 2922366554 | 117 |
| 26 | iso_pu_bacteria | 2922386360 | 2922389536 | 117 |
| 27 | iso_pu_bacteria | 2922393267 | 2922398332 | 117 |
| 28 | iso_pu_bacteria | 8006964411 | 8006971083 | 117 |
| 29 | iso_pu_bacteria | 8006994254 | 8006996797 | 117 |
| 30 | iso_pu_bacteria | 8056673599 | 8056675377 | 117 |
| 31 | iso_pu_bacteria | 8056681323 | 8056685556 | 117 |
| 32 | 3300006028 | Ga0070717_11077288 | Ga0070717_110772881 | 118 |
| 33 | 3300005338 | Ga0068868_101978623 | Ga0068868_1019786231 | 119 |
| 34 | 3300005456 | Ga0070678_101516938 | Ga0070678_1015169381 | 119 |
| 35 | 3300005458 | Ga0070681_10024432 | Ga0070681_100244325 | 119 |
| 36 | 3300005530 | Ga0070679_100075893 | Ga0070679_1000758934 | 119 |
| 37 | 3300005539 | Ga0068853_100517318 | Ga0068853_1005173182 | 119 |
| 38 | 3300005543 | Ga0070672_100968967 | Ga0070672_1009689671 | 119 |
| 39 | 3300005563 | Ga0068855_100193304 | Ga0068855_1001933044 | 119 |
| 40 | 3300005577 | Ga0068857_100980136 | Ga0068857_1009801362 | 119 |
| 41 | 3300005840 | Ga0068870_10453388 | Ga0068870_104533882 | 119 |
| 42 | 3300009098 | Ga0105245_11950086 | Ga0105245_119500862 | 119 |
| 43 | 3300013308 | Ga0157375_12758439 | Ga0157375_127584392 | 119 |
| 44 | 3300014326 | Ga0157380_10283829 | Ga0157380_102838292 | 119 |
| 45 | 3300014745 | Ga0157377_10356285 | Ga0157377_103562852 | 119 |
| 46 | 3300025901 | Ga0207688_10187461 | Ga0207688_101874612 | 119 |
| 47 | 3300025908 | Ga0207643_10399027 | Ga0207643_103990272 | 119 |
| 48 | 3300025912 | Ga0207707_10032842 | Ga0207707_100328428 | 119 |
| 49 | 3300025917 | Ga0207660_11630639 | Ga0207660_116306391 | 119 |
| 50 | 3300025949 | Ga0207667_10108706 | Ga0207667_101087062 | 119 |
| 51 | 3300026023 | Ga0207677_12014990 | Ga0207677_120149902 | 119 |
| 52 | 3300026041 | Ga0207639_10474867 | Ga0207639_104748672 | 119 |
| 53 | 3300026116 | Ga0207674_11053503 | Ga0207674_110535031 | 119 |
| 54 | 3300026121 | Ga0207683_10155090 | Ga0207683_101550902 | 119 |
| 55 | 3300035170 | Ga0373943_0136937 | Ga0373943_0136937_768_1127 | 119 |
| 56 | 3300035410 | Ga0373924_0161939 | Ga0373924_0161939_176_535 | 119 |
| 57 | 3300035692 | Ga0373935_0097809 | Ga0373935_0097809_316_675 | 119 |
| 58 | 3300035695 | Ga0373927_0005938 | Ga0373927_0005938_5037_5396 | 119 |
| 59 | 3300035725 | Ga0373947_0052793 | Ga0373947_0052793_1047_1406 | 119 |
| 60 | 3300037068 | Ga0373925_0120413 | Ga0373925_0120413_267_626 | 119 |
| 61 | 3300037068 | Ga0373925_0165062 | Ga0373925_0165062_928_1287 | 119 |
| 62 | 3300044694 | Ga0466963_0540088 | Ga0466963_0540088_141_500 | 119 |
| 63 | 3300046473 | Ga0495582_0812928 | Ga0495582_0812928_21_380 | 119 |
| 64 | 3300046531 | Ga0495665_0489016 | Ga0495665_0489016_206_565 | 119 |
| 65 | 3300046543 | Ga0495645_0363161 | Ga0495645_0363161_407_766 | 119 |
| 66 | 3300047317 | Ga0495604_0498872 | Ga0495604_0498872_376_735 | 119 |
| 67 | 3300047471 | Ga0495684_0547276 | Ga0495684_0547276_114_473 | 119 |
| 68 | 3300053077 | Ga0495601_0301777 | Ga0495601_0301777_441_800 | 119 |
| 69 | 3300053085 | Ga0495619_0059248 | Ga0495619_0059248_1501_1860 | 119 |
| 70 | 3300003323 | rootH1_10019068 | rootH1_100190682 | 120 |
| 71 | 3300005439 | Ga0070711_100379279 | Ga0070711_1003792792 | 120 |
| 72 | 3300005544 | Ga0070686_101570809 | Ga0070686_1015708091 | 120 |
| 73 | 3300005548 | Ga0070665_100732835 | Ga0070665_1007328352 | 120 |
| 74 | 3300005983 | Ga0081540_1005216 | Ga0081540_10052161 | 120 |
| 75 | 3300006042 | Ga0075368_10122637 | Ga0075368_101226372 | 120 |
| 76 | 3300009148 | Ga0105243_10353713 | Ga0105243_103537132 | 120 |
| 77 | 3300027866 | Ga0209813_10128353 | Ga0209813_101283531 | 120 |
| 78 | 3300039437 | Ga0436365_0939476 | Ga0436365_0939476_946_1308 | 120 |
| 79 | 3300041511 | Ga0451855_0305929 | Ga0451855_0305929_52_414 | 120 |
| 80 | 3300049583 | Ga0501067_0383592 | Ga0501067_0383592_121_483 | 120 |
| 81 | 3300050495 | nmdc:mga04h51_110906_c1 | nmdc:mga04h51_110906_c1_376_738 | 120 |
| 82 | 3300053136 | Ga0500559_0009452 | Ga0500559_0009452_274_639 | 120 |
| 83 | 3300053163 | Ga0500639_097955 | Ga0500639_097955_132_497 | 120 |
| 84 | 3300003763 | Ga0055529_1049128 | Ga0055529_10491281 | 121 |
| 85 | 3300005330 | Ga0070690_100037484 | Ga0070690_1000374842 | 121 |
| 86 | 3300005330 | Ga0070690_100375042 | Ga0070690_1003750422 | 121 |
| 87 | 3300005331 | Ga0070670_100060834 | Ga0070670_1000608345 | 121 |
| 88 | 3300005334 | Ga0068869_100254987 | Ga0068869_1002549872 | 121 |
| 89 | 3300005335 | Ga0070666_10004960 | Ga0070666_100049602 | 121 |
| 90 | 3300005338 | Ga0068868_100100778 | Ga0068868_1001007783 | 121 |
| 91 | 3300005340 | Ga0070689_100470638 | Ga0070689_1004706382 | 121 |
| 92 | 3300005340 | Ga0070689_100563710 | Ga0070689_1005637101 | 121 |
| 93 | 3300005341 | Ga0070691_10256568 | Ga0070691_102565682 | 121 |
| 94 | 3300005347 | Ga0070668_100296204 | Ga0070668_1002962042 | 121 |
| 95 | 3300005347 | Ga0070668_101140734 | Ga0070668_1011407341 | 121 |
| 96 | 3300005347 | Ga0070668_101579991 | Ga0070668_1015799911 | 121 |
| 97 | 3300005347 | Ga0070668_102149887 | Ga0070668_1021498871 | 121 |
| 98 | 3300005353 | Ga0070669_100235249 | Ga0070669_1002352492 | 121 |
| 99 | 3300005354 | Ga0070675_100256096 | Ga0070675_1002560961 | 121 |
| 100 | 3300005355 | Ga0070671_100674123 | Ga0070671_1006741232 | 121 |
| 101 | 3300005355 | Ga0070671_101096899 | Ga0070671_1010968991 | 121 |
| 102 | 3300005356 | Ga0070674_100888105 | Ga0070674_1008881052 | 121 |
| 103 | 3300005365 | Ga0070688_100137146 | Ga0070688_1001371462 | 121 |
| 104 | 3300005366 | Ga0070659_101001387 | Ga0070659_1010013871 | 121 |
| 105 | 3300005367 | Ga0070667_100089815 | Ga0070667_1000898153 | 121 |
| 106 | 3300005367 | Ga0070667_100495448 | Ga0070667_1004954481 | 121 |
| 107 | 3300005367 | Ga0070667_101540081 | Ga0070667_1015400811 | 121 |
| 108 | 3300005406 | Ga0070703_10241851 | Ga0070703_102418512 | 121 |
| 109 | 3300005434 | Ga0070709_10236761 | Ga0070709_102367612 | 121 |
| 110 | 3300005434 | Ga0070709_11203803 | Ga0070709_112038031 | 121 |
| 111 | 3300005435 | Ga0070714_100290700 | Ga0070714_1002907003 | 121 |
| 112 | 3300005435 | Ga0070714_101118137 | Ga0070714_1011181372 | 121 |
| 113 | 3300005436 | Ga0070713_100005990 | Ga0070713_1000059902 | 121 |
| 114 | 3300005436 | Ga0070713_100291741 | Ga0070713_1002917412 | 121 |
| 115 | 3300005436 | Ga0070713_100330419 | Ga0070713_1003304193 | 121 |
| 116 | 3300005437 | Ga0070710_11148947 | Ga0070710_111489471 | 121 |
| 117 | 3300005439 | Ga0070711_100004982 | Ga0070711_1000049823 | 121 |
| 118 | 3300005439 | Ga0070711_101062359 | Ga0070711_1010623591 | 121 |
| 119 | 3300005440 | Ga0070705_100951340 | Ga0070705_1009513401 | 121 |
| 120 | 3300005441 | Ga0070700_101974506 | Ga0070700_1019745061 | 121 |
| 121 | 3300005455 | Ga0070663_100073751 | Ga0070663_1000737515 | 121 |
| 122 | 3300005455 | Ga0070663_100239235 | Ga0070663_1002392351 | 121 |
| 123 | 3300005455 | Ga0070663_100320808 | Ga0070663_1003208082 | 121 |
| 124 | 3300005455 | Ga0070663_100505009 | Ga0070663_1005050093 | 121 |
| 125 | 3300005455 | Ga0070663_101653058 | Ga0070663_1016530581 | 121 |
| 126 | 3300005456 | Ga0070678_100345611 | Ga0070678_1003456113 | 121 |
| 127 | 3300005456 | Ga0070678_100483667 | Ga0070678_1004836672 | 121 |
| 128 | 3300005456 | Ga0070678_100827993 | Ga0070678_1008279932 | 121 |
| 129 | 3300005457 | Ga0070662_100742709 | Ga0070662_1007427091 | 121 |
| 130 | 3300005457 | Ga0070662_101146000 | Ga0070662_1011460001 | 121 |
| 131 | 3300005458 | Ga0070681_10080702 | Ga0070681_100807022 | 121 |
| 132 | 3300005458 | Ga0070681_10258569 | Ga0070681_102585692 | 121 |
| 133 | 3300005467 | Ga0070706_100415779 | Ga0070706_1004157792 | 121 |
| 134 | 3300005471 | Ga0070698_100028998 | Ga0070698_1000289983 | 121 |
| 135 | 3300005471 | Ga0070698_100911268 | Ga0070698_1009112682 | 121 |
| 136 | 3300005530 | Ga0070679_100009248 | Ga0070679_1000092482 | 121 |
| 137 | 3300005544 | Ga0070686_100487026 | Ga0070686_1004870262 | 121 |
| 138 | 3300005545 | Ga0070695_100359125 | Ga0070695_1003591252 | 121 |
| 139 | 3300005547 | Ga0070693_100228290 | Ga0070693_1002282901 | 121 |
| 140 | 3300005548 | Ga0070665_100013100 | Ga0070665_1000131004 | 121 |
| 141 | 3300005548 | Ga0070665_100080609 | Ga0070665_1000806091 | 121 |
| 142 | 3300005548 | Ga0070665_101571943 | Ga0070665_1015719432 | 121 |
| 143 | 3300005549 | Ga0070704_101604942 | Ga0070704_1016049422 | 121 |
| 144 | 3300005563 | Ga0068855_101188578 | Ga0068855_1011885782 | 121 |
| 145 | 3300005563 | Ga0068855_101243336 | Ga0068855_1012433361 | 121 |
| 146 | 3300005614 | Ga0068856_101039525 | Ga0068856_1010395252 | 121 |
| 147 | 3300005615 | Ga0070702_100256668 | Ga0070702_1002566682 | 121 |
| 148 | 3300005617 | Ga0068859_100040226 | Ga0068859_1000402262 | 121 |
| 149 | 3300005618 | Ga0068864_100235961 | Ga0068864_1002359612 | 121 |
| 150 | 3300005618 | Ga0068864_100486535 | Ga0068864_1004865352 | 121 |
| 151 | 3300005718 | Ga0068866_10302007 | Ga0068866_103020072 | 121 |
| 152 | 3300005719 | Ga0068861_100748718 | Ga0068861_1007487182 | 121 |
| 153 | 3300005719 | Ga0068861_102715415 | Ga0068861_1027154152 | 121 |
| 154 | 3300005840 | Ga0068870_11039597 | Ga0068870_110395971 | 121 |
| 155 | 3300005841 | Ga0068863_100206790 | Ga0068863_1002067902 | 121 |
| 156 | 3300005843 | Ga0068860_100027726 | Ga0068860_1000277262 | 121 |
| 157 | 3300005843 | Ga0068860_100292732 | Ga0068860_1002927322 | 121 |
| 158 | 3300005843 | Ga0068860_101015534 | Ga0068860_1010155342 | 121 |
| 159 | 3300005843 | Ga0068860_101759025 | Ga0068860_1017590251 | 121 |
| 160 | 3300005844 | Ga0068862_100228976 | Ga0068862_1002289763 | 121 |
| 161 | 3300005844 | Ga0068862_100638985 | Ga0068862_1006389852 | 121 |
| 162 | 3300005983 | Ga0081540_1007193 | Ga0081540_10071939 | 121 |
| 163 | 3300005983 | Ga0081540_1076704 | Ga0081540_10767042 | 121 |
| 164 | 3300006028 | Ga0070717_10000460 | Ga0070717_100004609 | 121 |
| 165 | 3300006028 | Ga0070717_10110309 | Ga0070717_101103094 | 121 |
| 166 | 3300006038 | Ga0075365_10016437 | Ga0075365_100164376 | 121 |
| 167 | 3300006038 | Ga0075365_10075675 | Ga0075365_100756755 | 121 |
| 168 | 3300006038 | Ga0075365_11209712 | Ga0075365_112097121 | 121 |
| 169 | 3300006042 | Ga0075368_10070444 | Ga0075368_100704442 | 121 |
| 170 | 3300006048 | Ga0075363_100014770 | Ga0075363_1000147708 | 121 |
| 171 | 3300006163 | Ga0070715_10107371 | Ga0070715_101073712 | 121 |
| 172 | 3300006173 | Ga0070716_100034174 | Ga0070716_1000341742 | 121 |
| 173 | 3300006173 | Ga0070716_100154821 | Ga0070716_1001548212 | 121 |
| 174 | 3300006173 | Ga0070716_100970695 | Ga0070716_1009706952 | 121 |
| 175 | 3300006175 | Ga0070712_100073635 | Ga0070712_1000736353 | 121 |
| 176 | 3300006175 | Ga0070712_101622439 | Ga0070712_1016224392 | 121 |
| 177 | 3300006177 | Ga0075362_10130809 | Ga0075362_101308092 | 121 |
| 178 | 3300006178 | Ga0075367_10040157 | Ga0075367_100401573 | 121 |
| 179 | 3300006178 | Ga0075367_10136379 | Ga0075367_101363792 | 121 |
| 180 | 3300006186 | Ga0075369_10117031 | Ga0075369_101170312 | 121 |
| 181 | 3300006186 | Ga0075369_10142974 | Ga0075369_101429742 | 121 |
| 182 | 3300006186 | Ga0075369_10191822 | Ga0075369_101918222 | 121 |
| 183 | 3300006195 | Ga0075366_10032034 | Ga0075366_100320342 | 121 |
| 184 | 3300006195 | Ga0075366_10107607 | Ga0075366_101076073 | 121 |
| 185 | 3300006195 | Ga0075366_10874182 | Ga0075366_108741821 | 121 |
| 186 | 3300006237 | Ga0097621_100774264 | Ga0097621_1007742642 | 121 |
| 187 | 3300006353 | Ga0075370_10020322 | Ga0075370_100203227 | 121 |
| 188 | 3300006353 | Ga0075370_10138407 | Ga0075370_101384072 | 121 |
| 189 | 3300006358 | Ga0068871_100154020 | Ga0068871_1001540201 | 121 |
| 190 | 3300006844 | Ga0075428_101303858 | Ga0075428_1013038581 | 121 |
| 191 | 3300006881 | Ga0068865_100041421 | Ga0068865_1000414212 | 121 |
| 192 | 3300006881 | Ga0068865_100109505 | Ga0068865_1001095053 | 121 |
| 193 | 3300006881 | Ga0068865_100559409 | Ga0068865_1005594092 | 121 |
| 194 | 3300006881 | Ga0068865_101931941 | Ga0068865_1019319411 | 121 |
| 195 | 3300006914 | Ga0075436_100059273 | Ga0075436_1000592735 | 121 |
| 196 | 3300006931 | Ga0097620_100040226 | Ga0097620_1000402263 | 121 |
| 197 | 3300007076 | Ga0075435_100704487 | Ga0075435_1007044872 | 121 |
| 198 | 3300007788 | Ga0099795_10366344 | Ga0099795_103663442 | 121 |
| 199 | 3300009093 | Ga0105240_10087516 | Ga0105240_100875166 | 121 |
| 200 | 3300009093 | Ga0105240_10888648 | Ga0105240_108886482 | 121 |
| 201 | 3300009094 | Ga0111539_10124402 | Ga0111539_101244022 | 121 |
| 202 | 3300009094 | Ga0111539_11133052 | Ga0111539_111330522 | 121 |
| 203 | 3300009094 | Ga0111539_13203975 | Ga0111539_132039751 | 121 |
| 204 | 3300009098 | Ga0105245_10014079 | Ga0105245_100140796 | 121 |
| 205 | 3300009098 | Ga0105245_10464643 | Ga0105245_104646432 | 121 |
| 206 | 3300009101 | Ga0105247_10080734 | Ga0105247_100807343 | 121 |
| 207 | 3300009101 | Ga0105247_10177383 | Ga0105247_101773832 | 121 |
| 208 | 3300009101 | Ga0105247_10207519 | Ga0105247_102075191 | 121 |
| 209 | 3300009101 | Ga0105247_10244064 | Ga0105247_102440643 | 121 |
| 210 | 3300009101 | Ga0105247_10394507 | Ga0105247_103945072 | 121 |
| 211 | 3300009101 | Ga0105247_10583282 | Ga0105247_105832822 | 121 |
| 212 | 3300009101 | Ga0105247_10913872 | Ga0105247_109138722 | 121 |
| 213 | 3300009147 | Ga0114129_10144511 | Ga0114129_101445114 | 121 |
| 214 | 3300009148 | Ga0105243_10501348 | Ga0105243_105013481 | 121 |
| 215 | 3300009148 | Ga0105243_10562906 | Ga0105243_105629062 | 121 |
| 216 | 3300009148 | Ga0105243_11385250 | Ga0105243_113852502 | 121 |
| 217 | 3300009148 | Ga0105243_12123316 | Ga0105243_121233162 | 121 |
| 218 | 3300009174 | Ga0105241_10225918 | Ga0105241_102259182 | 121 |
| 219 | 3300009176 | Ga0105242_10015747 | Ga0105242_100157475 | 121 |
| 220 | 3300009177 | Ga0105248_10330687 | Ga0105248_103306872 | 121 |
| 221 | 3300009177 | Ga0105248_10410344 | Ga0105248_104103442 | 121 |
| 222 | 3300009545 | Ga0105237_10106632 | Ga0105237_101066325 | 121 |
| 223 | 3300009545 | Ga0105237_10276157 | Ga0105237_102761572 | 121 |
| 224 | 3300009545 | Ga0105237_11336302 | Ga0105237_113363021 | 121 |
| 225 | 3300009551 | Ga0105238_10305586 | Ga0105238_103055863 | 121 |
| 226 | 3300009551 | Ga0105238_11735058 | Ga0105238_117350581 | 121 |
| 227 | 3300009553 | Ga0105249_10513667 | Ga0105249_105136671 | 121 |
| 228 | 3300009553 | Ga0105249_10681283 | Ga0105249_106812832 | 121 |
| 229 | 3300009553 | Ga0105249_11022958 | Ga0105249_110229582 | 121 |
| 230 | 3300009553 | Ga0105249_11065330 | Ga0105249_110653302 | 121 |
| 231 | 3300009553 | Ga0105249_11122386 | Ga0105249_111223862 | 121 |
| 232 | 3300010159 | Ga0099796_10099297 | Ga0099796_100992972 | 121 |
| 233 | 3300010375 | Ga0105239_10658645 | Ga0105239_106586452 | 121 |
| 234 | 3300010375 | Ga0105239_11224090 | Ga0105239_112240902 | 121 |
| 235 | 3300011119 | Ga0105246_10206627 | Ga0105246_102066272 | 121 |
| 236 | 3300013105 | Ga0157369_10307557 | Ga0157369_103075572 | 121 |
| 237 | 3300013105 | Ga0157369_10488407 | Ga0157369_104884073 | 121 |
| 238 | 3300013296 | Ga0157374_10035603 | Ga0157374_100356031 | 121 |
| 239 | 3300013297 | Ga0157378_10677672 | Ga0157378_106776722 | 121 |
| 240 | 3300013306 | Ga0163162_10159796 | Ga0163162_101597961 | 121 |
| 241 | 3300013306 | Ga0163162_10351084 | Ga0163162_103510841 | 121 |
| 242 | 3300013306 | Ga0163162_10980066 | Ga0163162_109800662 | 121 |
| 243 | 3300013306 | Ga0163162_11499894 | Ga0163162_114998942 | 121 |
| 244 | 3300013306 | Ga0163162_11624024 | Ga0163162_116240242 | 121 |
| 245 | 3300013306 | Ga0163162_12163275 | Ga0163162_121632752 | 121 |
| 246 | 3300013308 | Ga0157375_10406560 | Ga0157375_104065601 | 121 |
| 247 | 3300013308 | Ga0157375_11029961 | Ga0157375_110299612 | 121 |
| 248 | 3300013308 | Ga0157375_12416927 | Ga0157375_124169271 | 121 |
| 249 | 3300013308 | Ga0157375_13293055 | Ga0157375_132930551 | 121 |
| 250 | 3300014325 | Ga0163163_10012089 | Ga0163163_100120896 | 121 |
| 251 | 3300014325 | Ga0163163_10073225 | Ga0163163_100732253 | 121 |
| 252 | 3300014325 | Ga0163163_10203034 | Ga0163163_102030342 | 121 |
| 253 | 3300014326 | Ga0157380_10109465 | Ga0157380_101094653 | 121 |
| 254 | 3300014326 | Ga0157380_10428354 | Ga0157380_104283541 | 121 |
| 255 | 3300014326 | Ga0157380_11317117 | Ga0157380_113171172 | 121 |
| 256 | 3300014968 | Ga0157379_10023444 | Ga0157379_100234442 | 121 |
| 257 | 3300014968 | Ga0157379_10148040 | Ga0157379_101480403 | 121 |
| 258 | 3300014969 | Ga0157376_10014415 | Ga0157376_100144151 | 121 |
| 259 | 3300014969 | Ga0157376_10095961 | Ga0157376_100959612 | 121 |
| 260 | 3300014969 | Ga0157376_11195247 | Ga0157376_111952472 | 121 |
| 261 | 3300014969 | Ga0157376_11385431 | Ga0157376_113854312 | 121 |
| 262 | 3300014969 | Ga0157376_12989432 | Ga0157376_129894322 | 121 |
| 263 | 3300017792 | Ga0163161_10149977 | Ga0163161_101499772 | 121 |
| 264 | 3300017792 | Ga0163161_10410046 | Ga0163161_104100462 | 121 |
| 265 | 3300017792 | Ga0163161_10790755 | Ga0163161_107907551 | 121 |
| 266 | 3300017792 | Ga0163161_11129742 | Ga0163161_111297422 | 121 |
| 267 | 3300024227 | Ga0228598_1013692 | Ga0228598_10136921 | 121 |
| 268 | 3300025254 | Ga0209148_1016579 | Ga0209148_10165792 | 121 |
| 269 | 3300025261 | Ga0209233_1000694 | Ga0209233_10006941 | 121 |
| 270 | 3300025272 | Ga0209455_1001710 | Ga0209455_10017105 | 121 |
| 271 | 3300025898 | Ga0207692_10474809 | Ga0207692_104748092 | 121 |
| 272 | 3300025900 | Ga0207710_10201434 | Ga0207710_102014342 | 121 |
| 273 | 3300025901 | Ga0207688_10088637 | Ga0207688_100886374 | 121 |
| 274 | 3300025901 | Ga0207688_10094246 | Ga0207688_100942462 | 121 |
| 275 | 3300025903 | Ga0207680_10625090 | Ga0207680_106250901 | 121 |
| 276 | 3300025903 | Ga0207680_10697480 | Ga0207680_106974801 | 121 |
| 277 | 3300025905 | Ga0207685_10117700 | Ga0207685_101177002 | 121 |
| 278 | 3300025906 | Ga0207699_10230614 | Ga0207699_102306143 | 121 |
| 279 | 3300025906 | Ga0207699_10646900 | Ga0207699_106469002 | 121 |
| 280 | 3300025906 | Ga0207699_10801374 | Ga0207699_108013741 | 121 |
| 281 | 3300025907 | Ga0207645_10267439 | Ga0207645_102674392 | 121 |
| 282 | 3300025908 | Ga0207643_10642631 | Ga0207643_106426312 | 121 |
| 283 | 3300025910 | Ga0207684_10596827 | Ga0207684_105968272 | 121 |
| 284 | 3300025912 | Ga0207707_10089803 | Ga0207707_100898035 | 121 |
| 285 | 3300025913 | Ga0207695_10112712 | Ga0207695_101127124 | 121 |
| 286 | 3300025913 | Ga0207695_10981668 | Ga0207695_109816681 | 121 |
| 287 | 3300025914 | Ga0207671_10232053 | Ga0207671_102320533 | 121 |
| 288 | 3300025914 | Ga0207671_10307417 | Ga0207671_103074173 | 121 |
| 289 | 3300025915 | Ga0207693_10009325 | Ga0207693_1000932511 | 121 |
| 290 | 3300025915 | Ga0207693_10244528 | Ga0207693_102445282 | 121 |
| 291 | 3300025915 | Ga0207693_11156517 | Ga0207693_111565172 | 121 |
| 292 | 3300025916 | Ga0207663_10025502 | Ga0207663_100255025 | 121 |
| 293 | 3300025916 | Ga0207663_10852348 | Ga0207663_108523481 | 121 |
| 294 | 3300025918 | Ga0207662_10173318 | Ga0207662_101733182 | 121 |
| 295 | 3300025921 | Ga0207652_10010710 | Ga0207652_100107101 | 121 |
| 296 | 3300025923 | Ga0207681_10620603 | Ga0207681_106206032 | 121 |
| 297 | 3300025925 | Ga0207650_10074994 | Ga0207650_100749942 | 121 |
| 298 | 3300025927 | Ga0207687_10441628 | Ga0207687_104416281 | 121 |
| 299 | 3300025927 | Ga0207687_10618365 | Ga0207687_106183651 | 121 |
| 300 | 3300025928 | Ga0207700_10010911 | Ga0207700_100109116 | 121 |
| 301 | 3300025928 | Ga0207700_11183912 | Ga0207700_111839122 | 121 |
| 302 | 3300025928 | Ga0207700_11922123 | Ga0207700_119221231 | 121 |
| 303 | 3300025929 | Ga0207664_10059318 | Ga0207664_100593182 | 121 |
| 304 | 3300025929 | Ga0207664_10440064 | Ga0207664_104400642 | 121 |
| 305 | 3300025931 | Ga0207644_10871198 | Ga0207644_108711982 | 121 |
| 306 | 3300025931 | Ga0207644_11143662 | Ga0207644_111436622 | 121 |
| 307 | 3300025933 | Ga0207706_10231959 | Ga0207706_102319592 | 121 |
| 308 | 3300025933 | Ga0207706_11455376 | Ga0207706_114553761 | 121 |
| 309 | 3300025934 | Ga0207686_10063429 | Ga0207686_100634292 | 121 |
| 310 | 3300025935 | Ga0207709_10613756 | Ga0207709_106137562 | 121 |
| 311 | 3300025936 | Ga0207670_10388045 | Ga0207670_103880451 | 121 |
| 312 | 3300025937 | Ga0207669_10345806 | Ga0207669_103458062 | 121 |
| 313 | 3300025938 | Ga0207704_10568657 | Ga0207704_105686572 | 121 |
| 314 | 3300025938 | Ga0207704_11232176 | Ga0207704_112321761 | 121 |
| 315 | 3300025939 | Ga0207665_10023296 | Ga0207665_100232967 | 121 |
| 316 | 3300025939 | Ga0207665_10091265 | Ga0207665_100912652 | 121 |
| 317 | 3300025939 | Ga0207665_10412065 | Ga0207665_104120652 | 121 |
| 318 | 3300025939 | Ga0207665_10456128 | Ga0207665_104561282 | 121 |
| 319 | 3300025941 | Ga0207711_10125296 | Ga0207711_101252962 | 121 |
| 320 | 3300025941 | Ga0207711_10333584 | Ga0207711_103335842 | 121 |
| 321 | 3300025941 | Ga0207711_10630299 | Ga0207711_106302992 | 121 |
| 322 | 3300025942 | Ga0207689_10184753 | Ga0207689_101847533 | 121 |
| 323 | 3300025949 | Ga0207667_10786977 | Ga0207667_107869772 | 121 |
| 324 | 3300025949 | Ga0207667_10974270 | Ga0207667_109742702 | 121 |
| 325 | 3300025960 | Ga0207651_10612600 | Ga0207651_106126002 | 121 |
| 326 | 3300025961 | Ga0207712_10867750 | Ga0207712_108677502 | 121 |
| 327 | 3300025972 | Ga0207668_10173030 | Ga0207668_101730302 | 121 |
| 328 | 3300025972 | Ga0207668_10624358 | Ga0207668_106243582 | 121 |
| 329 | 3300025972 | Ga0207668_10951351 | Ga0207668_109513512 | 121 |
| 330 | 3300025972 | Ga0207668_10979695 | Ga0207668_109796952 | 121 |
| 331 | 3300025986 | Ga0207658_10262033 | Ga0207658_102620332 | 121 |
| 332 | 3300025986 | Ga0207658_10312079 | Ga0207658_103120791 | 121 |
| 333 | 3300025986 | Ga0207658_10681309 | Ga0207658_106813091 | 121 |
| 334 | 3300025986 | Ga0207658_11647929 | Ga0207658_116479291 | 121 |
| 335 | 3300026023 | Ga0207677_10063069 | Ga0207677_100630692 | 121 |
| 336 | 3300026023 | Ga0207677_10535789 | Ga0207677_105357891 | 121 |
| 337 | 3300026035 | Ga0207703_10103043 | Ga0207703_101030432 | 121 |
| 338 | 3300026041 | Ga0207639_10564999 | Ga0207639_105649991 | 121 |
| 339 | 3300026067 | Ga0207678_10268443 | Ga0207678_102684432 | 121 |
| 340 | 3300026067 | Ga0207678_10402078 | Ga0207678_104020782 | 121 |
| 341 | 3300026067 | Ga0207678_11546810 | Ga0207678_115468101 | 121 |
| 342 | 3300026075 | Ga0207708_10353523 | Ga0207708_103535232 | 121 |
| 343 | 3300026088 | Ga0207641_10805947 | Ga0207641_108059471 | 121 |
| 344 | 3300026088 | Ga0207641_11314141 | Ga0207641_113141411 | 121 |
| 345 | 3300026088 | Ga0207641_11543134 | Ga0207641_115431341 | 121 |
| 346 | 3300026095 | Ga0207676_11853785 | Ga0207676_118537851 | 121 |
| 347 | 3300026118 | Ga0207675_100251674 | Ga0207675_1002516742 | 121 |
| 348 | 3300026118 | Ga0207675_101133473 | Ga0207675_1011334731 | 121 |
| 349 | 3300026121 | Ga0207683_10051305 | Ga0207683_100513056 | 121 |
| 350 | 3300026121 | Ga0207683_10323726 | Ga0207683_103237261 | 121 |
| 351 | 3300027907 | Ga0207428_10306685 | Ga0207428_103066852 | 121 |
| 352 | 3300027907 | Ga0207428_10368040 | Ga0207428_103680401 | 121 |
| 353 | 3300028379 | Ga0268266_10001136 | Ga0268266_1000113621 | 121 |
| 354 | 3300028379 | Ga0268266_10124447 | Ga0268266_101244473 | 121 |
| 355 | 3300028379 | Ga0268266_11104722 | Ga0268266_111047222 | 121 |
| 356 | 3300028380 | Ga0268265_10192550 | Ga0268265_101925502 | 121 |
| 357 | 3300028380 | Ga0268265_10198444 | Ga0268265_101984443 | 121 |
| 358 | 3300028381 | Ga0268264_10062809 | Ga0268264_100628091 | 121 |
| 359 | 3300028381 | Ga0268264_10865538 | Ga0268264_108655382 | 121 |
| 360 | 3300028786 | Ga0307517_10000098 | Ga0307517_10000098108 | 121 |
| 361 | 3300028794 | Ga0307515_10104075 | Ga0307515_101040752 | 121 |
| 362 | 3300031090 | Ga0265760_10333543 | Ga0265760_103335431 | 121 |
| 363 | 3300031238 | Ga0265332_10113667 | Ga0265332_101136671 | 121 |
| 364 | 3300031241 | Ga0265325_10030068 | Ga0265325_100300682 | 121 |
| 365 | 3300031249 | Ga0265339_10102808 | Ga0265339_101028082 | 121 |
| 366 | 3300031249 | Ga0265339_10220362 | Ga0265339_102203622 | 121 |
| 367 | 3300031250 | Ga0265331_10161814 | Ga0265331_101618142 | 121 |
| 368 | 3300031344 | Ga0265316_11123974 | Ga0265316_111239741 | 121 |
| 369 | 3300031456 | Ga0307513_10418783 | Ga0307513_104187832 | 121 |
| 370 | 3300031616 | Ga0307508_10127944 | Ga0307508_101279443 | 121 |
| 371 | 3300031711 | Ga0265314_10156693 | Ga0265314_101566932 | 121 |
| 372 | 3300031712 | Ga0265342_10115041 | Ga0265342_101150412 | 121 |
| 373 | 3300031730 | Ga0307516_10171105 | Ga0307516_101711052 | 121 |
| 374 | 3300031911 | Ga0307412_10627228 | Ga0307412_106272282 | 121 |
| 375 | 3300032002 | Ga0307416_100665573 | Ga0307416_1006655732 | 121 |
| 376 | 3300033180 | Ga0307510_10327889 | Ga0307510_103278891 | 121 |
| 377 | 3300033180 | Ga0307510_10453756 | Ga0307510_104537562 | 121 |
| 378 | 3300033180 | Ga0307510_10587261 | Ga0307510_105872611 | 121 |
| 379 | 3300034957 | Ga0373938_0012168 | Ga0373938_0012168_30_395 | 121 |
| 380 | 3300034957 | Ga0373938_0082383 | Ga0373938_0082383_323_703 | 121 |
| 381 | 3300035085 | Ga0373929_0073539 | Ga0373929_0073539_139_504 | 121 |
| 382 | 3300035088 | Ga0373940_0012825 | Ga0373940_0012825_709_1074 | 121 |
| 383 | 3300035090 | Ga0373949_0023335 | Ga0373949_0023335_804_1184 | 121 |
| 384 | 3300035090 | Ga0373949_0278187 | Ga0373949_0278187_56_421 | 121 |
| 385 | 3300035111 | Ga0373923_0460800 | Ga0373923_0460800_28_393 | 121 |
| 386 | 3300035114 | Ga0373939_0059957 | Ga0373939_0059957_566_931 | 121 |
| 387 | 3300035115 | Ga0373941_0041926 | Ga0373941_0041926_1020_1400 | 121 |
| 388 | 3300035115 | Ga0373941_0391181 | Ga0373941_0391181_169_534 | 121 |
| 389 | 3300035116 | Ga0373945_0075784 | Ga0373945_0075784_42_407 | 121 |
| 390 | 3300035116 | Ga0373945_0467734 | Ga0373945_0467734_40_405 | 121 |
| 391 | 3300035120 | Ga0373957_0342591 | Ga0373957_0342591_76_441 | 121 |
| 392 | 3300035241 | Ga0373961_0075393 | Ga0373961_0075393_347_712 | 121 |
| 393 | 3300035242 | Ga0373962_0030285 | Ga0373962_0030285_254_634 | 121 |
| 394 | 3300035242 | Ga0373962_0056827 | Ga0373962_0056827_548_913 | 121 |
| 395 | 3300035691 | Ga0373931_0003428 | Ga0373931_0003428_1256_1636 | 121 |
| 396 | 3300035691 | Ga0373931_0004512 | Ga0373931_0004512_976_1341 | 121 |
| 397 | 3300035691 | Ga0373931_0020927 | Ga0373931_0020927_461_826 | 121 |
| 398 | 3300035692 | Ga0373935_0344725 | Ga0373935_0344725_260_625 | 121 |
| 399 | 3300035695 | Ga0373927_0039246 | Ga0373927_0039246_1722_2087 | 121 |
| 400 | 3300035695 | Ga0373927_0470479 | Ga0373927_0470479_43_408 | 121 |
| 401 | 3300035724 | Ga0373933_0000026 | Ga0373933_0000026_70113_70478 | 121 |
| 402 | 3300035725 | Ga0373947_0331050 | Ga0373947_0331050_422_787 | 121 |
| 403 | 3300036401 | Ga0373937_0613407 | Ga0373937_0613407_28_393 | 121 |
| 404 | 3300037068 | Ga0373925_0013452 | Ga0373925_0013452_3992_4357 | 121 |
| 405 | 3300037466 | Ga0395898_0035872 | Ga0395898_0035872_3085_3450 | 121 |
| 406 | 3300037466 | Ga0395898_0620566 | Ga0395898_0620566_87_467 | 121 |
| 407 | 3300037466 | Ga0395898_0991435 | Ga0395898_0991435_177_578 | 121 |
| 408 | 3300037471 | Ga0395905_0462821 | Ga0395905_0462821_367_732 | 121 |
| 409 | 3300038443 | Ga0395901_0181283 | Ga0395901_0181283_688_1089 | 121 |
| 410 | 3300039450 | Ga0436363_0400675 | Ga0436363_0400675_45_413 | 121 |
| 411 | 3300041443 | Ga0451789_0967346 | Ga0451789_0967346_147_512 | 121 |
| 412 | 3300041451 | Ga0451791_0402788 | Ga0451791_0402788_239_604 | 121 |
| 413 | 3300041451 | Ga0451791_1176742 | Ga0451791_1176742_58_423 | 121 |
| 414 | 3300041452 | Ga0451793_0828375 | Ga0451793_0828375_75_440 | 121 |
| 415 | 3300041458 | Ga0451798_0016358 | Ga0451798_0016358_396_761 | 121 |
| 416 | 3300041460 | Ga0451802_1435137 | Ga0451802_1435137_634_999 | 121 |
| 417 | 3300041486 | Ga0451807_1414763 | Ga0451807_1414763_350_715 | 121 |
| 418 | 3300041494 | Ga0451837_0986133 | Ga0451837_0986133_74_439 | 121 |
| 419 | 3300041498 | Ga0451841_1414058 | Ga0451841_1414058_89_454 | 121 |
| 420 | 3300044684 | Ga0466966_0038431 | Ga0466966_0038431_1471_1836 | 121 |
| 421 | 3300044693 | Ga0466961_0572202 | Ga0466961_0572202_96_461 | 121 |
| 422 | 3300044706 | Ga0466964_0663256 | Ga0466964_0663256_184_549 | 121 |
| 423 | 3300045049 | Ga0466959_0053125 | Ga0466959_0053125_297_662 | 121 |
| 424 | 3300045049 | Ga0466959_0394516 | Ga0466959_0394516_399_764 | 121 |
| 425 | 3300045836 | Ga0466958_0752862 | Ga0466958_0752862_175_540 | 121 |
| 426 | 3300045836 | Ga0466958_1080037 | Ga0466958_1080037_34_399 | 121 |
| 427 | 3300045976 | Ga0466967_0563761 | Ga0466967_0563761_427_825 | 121 |
| 428 | 3300046452 | Ga0495617_015095 | Ga0495617_015095_823_1188 | 121 |
| 429 | 3300046453 | Ga0495627_124392 | Ga0495627_124392_279_644 | 121 |
| 430 | 3300046455 | Ga0495603_0043229 | Ga0495603_0043229_1344_1709 | 121 |
| 431 | 3300046455 | Ga0495603_0074854 | Ga0495603_0074854_1106_1528 | 121 |
| 432 | 3300046455 | Ga0495603_0689354 | Ga0495603_0689354_189_554 | 121 |
| 433 | 3300046457 | Ga0495590_0220458 | Ga0495590_0220458_324_689 | 121 |
| 434 | 3300046460 | Ga0495638_0576889 | Ga0495638_0576889_120_542 | 121 |
| 435 | 3300046461 | Ga0495641_0092177 | Ga0495641_0092177_15_380 | 121 |
| 436 | 3300046462 | Ga0495651_0259012 | Ga0495651_0259012_39_404 | 121 |
| 437 | 3300046471 | Ga0495650_0063664 | Ga0495650_0063664_790_1212 | 121 |
| 438 | 3300046471 | Ga0495650_0113151 | Ga0495650_0113151_447_812 | 121 |
| 439 | 3300046473 | Ga0495582_0357182 | Ga0495582_0357182_399_764 | 121 |
| 440 | 3300046475 | Ga0495639_0050090 | Ga0495639_0050090_1006_1371 | 121 |
| 441 | 3300046492 | Ga0495585_0311796 | Ga0495585_0311796_59_424 | 121 |
| 442 | 3300046500 | Ga0495596_0141335 | Ga0495596_0141335_506_871 | 121 |
| 443 | 3300046500 | Ga0495596_0163228 | Ga0495596_0163228_165_530 | 121 |
| 444 | 3300046501 | Ga0495607_0429765 | Ga0495607_0429765_194_559 | 121 |
| 445 | 3300046501 | Ga0495607_0510177 | Ga0495607_0510177_119_484 | 121 |
| 446 | 3300046522 | Ga0495643_0074090 | Ga0495643_0074090_452_817 | 121 |
| 447 | 3300046523 | Ga0495644_0052273 | Ga0495644_0052273_223_588 | 121 |
| 448 | 3300046523 | Ga0495644_0088630 | Ga0495644_0088630_700_1122 | 121 |
| 449 | 3300046525 | Ga0495663_0120853 | Ga0495663_0120853_358_723 | 121 |
| 450 | 3300046537 | Ga0495598_0046091 | Ga0495598_0046091_129_494 | 121 |
| 451 | 3300046539 | Ga0495621_0018971 | Ga0495621_0018971_893_1258 | 121 |
| 452 | 3300046539 | Ga0495621_0441835 | Ga0495621_0441835_10_375 | 121 |
| 453 | 3300046557 | Ga0495622_0269882 | Ga0495622_0269882_329_694 | 121 |
| 454 | 3300046558 | Ga0495633_0053651 | Ga0495633_0053651_52_417 | 121 |
| 455 | 3300046615 | Ga0495656_0084365 | Ga0495656_0084365_211_576 | 121 |
| 456 | 3300046615 | Ga0495656_0214078 | Ga0495656_0214078_506_928 | 121 |
| 457 | 3300046615 | Ga0495656_0788141 | Ga0495656_0788141_23_388 | 121 |
| 458 | 3300046616 | Ga0495668_0029504 | Ga0495668_0029504_2267_2632 | 121 |
| 459 | 3300046616 | Ga0495668_0052320 | Ga0495668_0052320_1698_2120 | 121 |
| 460 | 3300046616 | Ga0495668_0082172 | Ga0495668_0082172_406_771 | 121 |
| 461 | 3300046616 | Ga0495668_0332061 | Ga0495668_0332061_284_649 | 121 |
| 462 | 3300046648 | Ga0495611_0442893 | Ga0495611_0442893_142_564 | 121 |
| 463 | 3300046660 | Ga0495625_0376015 | Ga0495625_0376015_220_585 | 121 |
| 464 | 3300046663 | Ga0495635_0145633 | Ga0495635_0145633_615_1007 | 121 |
| 465 | 3300046674 | Ga0495588_0007336 | Ga0495588_0007336_2113_2478 | 121 |
| 466 | 3300046674 | Ga0495588_0110523 | Ga0495588_0110523_953_1375 | 121 |
| 467 | 3300046681 | Ga0495647_0538129 | Ga0495647_0538129_43_408 | 121 |
| 468 | 3300046684 | Ga0495669_0269583 | Ga0495669_0269583_330_695 | 121 |
| 469 | 3300046691 | Ga0495670_0039207 | Ga0495670_0039207_195_560 | 121 |
| 470 | 3300046691 | Ga0495670_0112447 | Ga0495670_0112447_143_508 | 121 |
| 471 | 3300046691 | Ga0495670_0163148 | Ga0495670_0163148_130_552 | 121 |
| 472 | 3300046692 | Ga0495671_0089738 | Ga0495671_0089738_370_792 | 121 |
| 473 | 3300046794 | Ga0495589_0103033 | Ga0495589_0103033_454_876 | 121 |
| 474 | 3300046794 | Ga0495589_0111160 | Ga0495589_0111160_122_487 | 121 |
| 475 | 3300047318 | Ga0495636_0077561 | Ga0495636_0077561_349_714 | 121 |
| 476 | 3300047323 | Ga0495683_0474998 | Ga0495683_0474998_63_428 | 121 |
| 477 | 3300047444 | Ga0495675_0606690 | Ga0495675_0606690_24_389 | 121 |
| 478 | 3300047445 | Ga0495677_0067538 | Ga0495677_0067538_93_458 | 121 |
| 479 | 3300047445 | Ga0495677_0191472 | Ga0495677_0191472_198_563 | 121 |
| 480 | 3300047446 | Ga0495679_160933 | Ga0495679_160933_77_499 | 121 |
| 481 | 3300047469 | Ga0495673_0083456 | Ga0495673_0083456_232_597 | 121 |
| 482 | 3300047469 | Ga0495673_0186672 | Ga0495673_0186672_364_729 | 121 |
| 483 | 3300048090 | Ga0495615_0052012 | Ga0495615_0052012_220_642 | 121 |
| 484 | 3300048091 | Ga0495626_0127656 | Ga0495626_0127656_242_607 | 121 |
| 485 | 3300048903 | Ga0496100_0394592 | Ga0496100_0394592_341_706 | 121 |
| 486 | 3300048903 | Ga0496100_0641603 | Ga0496100_0641603_45_410 | 121 |
| 487 | 3300048904 | Ga0496101_0075055 | Ga0496101_0075055_362_742 | 121 |
| 488 | 3300048904 | Ga0496101_0105094 | Ga0496101_0105094_1561_1926 | 121 |
| 489 | 3300048904 | Ga0496101_0453350 | Ga0496101_0453350_113_478 | 121 |
| 490 | 3300048904 | Ga0496101_0514497 | Ga0496101_0514497_322_687 | 121 |
| 491 | 3300048905 | Ga0496102_0380154 | Ga0496102_0380154_122_487 | 121 |
| 492 | 3300048905 | Ga0496102_0962906 | Ga0496102_0962906_177_542 | 121 |
| 493 | 3300048905 | Ga0496102_1057104 | Ga0496102_1057104_221_586 | 121 |
| 494 | 3300048906 | Ga0496103_0296231 | Ga0496103_0296231_328_693 | 121 |
| 495 | 3300048906 | Ga0496103_0332347 | Ga0496103_0332347_572_952 | 121 |
| 496 | 3300048906 | Ga0496103_0789321 | Ga0496103_0789321_46_411 | 121 |
| 497 | 3300048907 | Ga0496104_0003553 | Ga0496104_0003553_12534_12899 | 121 |
| 498 | 3300048907 | Ga0496104_0026734 | Ga0496104_0026734_936_1301 | 121 |
| 499 | 3300048907 | Ga0496104_0208151 | Ga0496104_0208151_964_1329 | 121 |
| 500 | 3300048907 | Ga0496104_0273637 | Ga0496104_0273637_69_434 | 121 |
| 501 | 3300048907 | Ga0496104_0436381 | Ga0496104_0436381_807_1187 | 121 |
| 502 | 3300048907 | Ga0496104_0558364 | Ga0496104_0558364_473_853 | 121 |
| 503 | 3300048908 | Ga0496105_0005843 | Ga0496105_0005843_3092_3457 | 121 |
| 504 | 3300048908 | Ga0496105_0066489 | Ga0496105_0066489_82_462 | 121 |
| 505 | 3300048908 | Ga0496105_0258568 | Ga0496105_0258568_351_716 | 121 |
| 506 | 3300048908 | Ga0496105_0345596 | Ga0496105_0345596_544_909 | 121 |
| 507 | 3300048909 | Ga0496106_0355229 | Ga0496106_0355229_48_413 | 121 |
| 508 | 3300048909 | Ga0496106_0806805 | Ga0496106_0806805_53_418 | 121 |
| 509 | 3300048910 | Ga0496107_0537257 | Ga0496107_0537257_249_629 | 121 |
| 510 | 3300048910 | Ga0496107_1132600 | Ga0496107_1132600_64_429 | 121 |
| 511 | 3300048911 | Ga0496108_0020730 | Ga0496108_0020730_1119_1484 | 121 |
| 512 | 3300048911 | Ga0496108_0262230 | Ga0496108_0262230_698_1078 | 121 |
| 513 | 3300048912 | Ga0496109_0188347 | Ga0496109_0188347_936_1301 | 121 |
| 514 | 3300048912 | Ga0496109_1789872 | Ga0496109_1789872_87_467 | 121 |
| 515 | 3300048913 | Ga0496110_0107424 | Ga0496110_0107424_398_763 | 121 |
| 516 | 3300048913 | Ga0496110_0371924 | Ga0496110_0371924_886_1251 | 121 |
| 517 | 3300048913 | Ga0496110_0595230 | Ga0496110_0595230_386_766 | 121 |
| 518 | 3300048913 | Ga0496110_0615947 | Ga0496110_0615947_407_772 | 121 |
| 519 | 3300048914 | Ga0496111_0040302 | Ga0496111_0040302_981_1346 | 121 |
| 520 | 3300048914 | Ga0496111_0147239 | Ga0496111_0147239_10_375 | 121 |
| 521 | 3300048914 | Ga0496111_0209481 | Ga0496111_0209481_640_1020 | 121 |
| 522 | 3300048914 | Ga0496111_0469200 | Ga0496111_0469200_528_893 | 121 |
| 523 | 3300048915 | Ga0496112_0012229 | Ga0496112_0012229_2036_2416 | 121 |
| 524 | 3300048915 | Ga0496112_0025634 | Ga0496112_0025634_4432_4797 | 121 |
| 525 | 3300048916 | Ga0496113_0662113 | Ga0496113_0662113_32_412 | 121 |
| 526 | 3300048917 | Ga0496114_0004423 | Ga0496114_0004423_4588_4953 | 121 |
| 527 | 3300048917 | Ga0496114_0913209 | Ga0496114_0913209_180_560 | 121 |
| 528 | 3300048918 | Ga0496115_0014949 | Ga0496115_0014949_550_915 | 121 |
| 529 | 3300048918 | Ga0496115_0019746 | Ga0496115_0019746_246_626 | 121 |
| 530 | 3300048918 | Ga0496115_0128737 | Ga0496115_0128737_1682_2047 | 121 |
| 531 | 3300048918 | Ga0496115_0159969 | Ga0496115_0159969_1442_1807 | 121 |
| 532 | 3300048920 | Ga0496117_0125246 | Ga0496117_0125246_358_723 | 121 |
| 533 | 3300048921 | Ga0496118_0497839 | Ga0496118_0497839_25_390 | 121 |
| 534 | 3300048924 | Ga0496121_0120593 | Ga0496121_0120593_1440_1805 | 121 |
| 535 | 3300048924 | Ga0496121_0270060 | Ga0496121_0270060_489_854 | 121 |
| 536 | 3300048924 | Ga0496121_0609782 | Ga0496121_0609782_278_643 | 121 |
| 537 | 3300048927 | Ga0496124_0213718 | Ga0496124_0213718_1007_1372 | 121 |
| 538 | 3300048929 | Ga0496126_0005831 | Ga0496126_0005831_10556_10921 | 121 |
| 539 | 3300048929 | Ga0496126_0032606 | Ga0496126_0032606_2928_3293 | 121 |
| 540 | 3300048929 | Ga0496126_0389043 | Ga0496126_0389043_318_683 | 121 |
| 541 | 3300048929 | Ga0496126_0399776 | Ga0496126_0399776_332_697 | 121 |
| 542 | 3300050489 | nmdc:mga03683_491508_c1 | nmdc:mga03683_491508_c1_78_443 | 121 |
| 543 | 3300050489 | nmdc:mga03683_637886_c1 | nmdc:mga03683_637886_c1_67_432 | 121 |
| 544 | 3300050491 | nmdc:mga00v17_834495_c1 | nmdc:mga00v17_834495_c1_52_417 | 121 |
| 545 | 3300050492 | nmdc:mga0yw44_125590_c1 | nmdc:mga0yw44_125590_c1_933_1298 | 121 |
| 546 | 3300050492 | nmdc:mga0yw44_31797_c1 | nmdc:mga0yw44_31797_c1_2417_2782 | 121 |
| 547 | 3300050492 | nmdc:mga0yw44_503758_c1 | nmdc:mga0yw44_503758_c1_29_394 | 121 |
| 548 | 3300050493 | nmdc:mga0k408_148173_c1 | nmdc:mga0k408_148173_c1_1008_1373 | 121 |
| 549 | 3300050493 | nmdc:mga0k408_205461_c2 | nmdc:mga0k408_205461_c2_149_514 | 121 |
| 550 | 3300050493 | nmdc:mga0k408_459337_c1 | nmdc:mga0k408_459337_c1_373_738 | 121 |
| 551 | 3300050494 | nmdc:mga06z11_262640_c1 | nmdc:mga06z11_262640_c1_154_519 | 121 |
| 552 | 3300050494 | nmdc:mga06z11_452217_c1 | nmdc:mga06z11_452217_c1_392_757 | 121 |
| 553 | 3300050494 | nmdc:mga06z11_8466_c1 | nmdc:mga06z11_8466_c1_1810_2175 | 121 |
| 554 | 3300050495 | nmdc:mga04h51_55291_c1 | nmdc:mga04h51_55291_c1_22_387 | 121 |
| 555 | 3300050496 | nmdc:mga07m45_6750_c1 | nmdc:mga07m45_6750_c1_117_482 | 121 |
| 556 | 3300050507 | nmdc:mga05p37_196622_c1 | nmdc:mga05p37_196622_c1_424_789 | 121 |
| 557 | 3300050511 | nmdc:mga08y16_805746_c1 | nmdc:mga08y16_805746_c1_270_635 | 121 |
| 558 | 3300050513 | nmdc:mga0rr50_741232_c1 | nmdc:mga0rr50_741232_c1_76_441 | 121 |
| 559 | 3300050514 | nmdc:mga08x19_61530_c1 | nmdc:mga08x19_61530_c1_753_1118 | 121 |
| 560 | 3300050514 | nmdc:mga08x19_619177_c1 | nmdc:mga08x19_619177_c1_32_397 | 121 |
| 561 | 3300050516 | nmdc:mga0sz30_145405_c1 | nmdc:mga0sz30_145405_c1_135_500 | 121 |
| 562 | 3300050516 | nmdc:mga0sz30_360742_c1 | nmdc:mga0sz30_360742_c1_255_620 | 121 |
| 563 | 3300050516 | nmdc:mga0sz30_397579_c1 | nmdc:mga0sz30_397579_c1_28_393 | 121 |
| 564 | 3300053084 | Ga0495595_0183165 | Ga0495595_0183165_619_1011 | 121 |
| 565 | 3300053092 | Ga0500583_0108192 | Ga0500583_0108192_96_461 | 121 |
| 566 | 3300053150 | Ga0500603_051358 | Ga0500603_051358_308_676 | 121 |
| 567 | 3300053177 | Ga0500636_0049352 | Ga0500636_0049352_710_1078 | 121 |
| 568 | 3300053730 | Ga0500645_029720 | Ga0500645_029720_961_1326 | 121 |
| 569 | 3300053737 | Ga0500601_003418 | Ga0500601_003418_600_968 | 121 |
| 570 | 3300001989 | JGI24739J22299_10030504 | JGI24739J22299_100305043 | 122 |
| 571 | 3300001990 | JGI24737J22298_10002347 | JGI24737J22298_100023474 | 122 |
| 572 | 3300002067 | JGI24735J21928_10101567 | JGI24735J21928_101015672 | 122 |
| 573 | 3300005455 | Ga0070663_100319448 | Ga0070663_1003194482 | 122 |
| 574 | 3300005539 | Ga0068853_100210598 | Ga0068853_1002105981 | 122 |
| 575 | 3300005543 | Ga0070672_101091826 | Ga0070672_1010918262 | 122 |
| 576 | 3300005563 | Ga0068855_100051001 | Ga0068855_1000510014 | 122 |
| 577 | 3300005577 | Ga0068857_100028661 | Ga0068857_1000286614 | 122 |
| 578 | 3300005578 | Ga0068854_100014717 | Ga0068854_1000147174 | 122 |
| 579 | 3300005614 | Ga0068856_100035106 | Ga0068856_1000351064 | 122 |
| 580 | 3300007788 | Ga0099795_10000005 | Ga0099795_1000000583 | 122 |
| 581 | 3300009093 | Ga0105240_10016877 | Ga0105240_1001687712 | 122 |
| 582 | 3300009545 | Ga0105237_10273970 | Ga0105237_102739702 | 122 |
| 583 | 3300009545 | Ga0105237_10342514 | Ga0105237_103425142 | 122 |
| 584 | 3300009551 | Ga0105238_10524792 | Ga0105238_105247922 | 122 |
| 585 | 3300010159 | Ga0099796_10000023 | Ga0099796_1000002317 | 122 |
| 586 | 3300010375 | Ga0105239_10015287 | Ga0105239_100152879 | 122 |
| 587 | 3300025904 | Ga0207647_10001253 | Ga0207647_100012533 | 122 |
| 588 | 3300025913 | Ga0207695_10109077 | Ga0207695_101090773 | 122 |
| 589 | 3300025914 | Ga0207671_10413225 | Ga0207671_104132252 | 122 |
| 590 | 3300025949 | Ga0207667_10039623 | Ga0207667_100396235 | 122 |
| 591 | 3300025981 | Ga0207640_10021128 | Ga0207640_100211283 | 122 |
| 592 | 3300026067 | Ga0207678_10025952 | Ga0207678_100259526 | 122 |
| 593 | 3300026078 | Ga0207702_10013602 | Ga0207702_100136027 | 122 |
| 594 | 3300026116 | Ga0207674_10016173 | Ga0207674_100161733 | 122 |
| 595 | 3300027512 | Ga0209179_1000175 | Ga0209179_10001755 | 122 |
| 596 | 3300039453 | Ga0436362_0741099 | Ga0436362_0741099_3885_4253 | 122 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lbp-assembly1.cif.gz_A | 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone | 0.6569 | 6 | 113 |
| 3nn3-assembly1.cif.gz_C | structure of chlorite dismutase from candidatus nitrospira defluvii r173a mutant | 0.6161 | 2 | 118 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.6108 | 4 | 115 |
| 2nzc-assembly1.cif.gz_C | the structure of uncharacterized protein tm1266 from thermotoga maritima. | 0.5978 | 4 | 116 |
| 4lbp-assembly1.cif.gz_A | 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone | 0.5942 | 6 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07243_108_202_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6496 | 5 | 121 | 3.30.70.1060 |
| 4lbiC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6467 | 7 | 113 | 3.30.70.1060 |
| af_O07243_108_202_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6281 | 5 | 121 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6108 | 4 | 115 | 3.30.70.1060 |
| 2nzcC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.6062 | 4 | 116 | 3.30.70.1150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6STJ8-F1-model_v4 | YCII-related domain-containing protein | 0.9433 | 5 | 121 |
|
| AF-A0A0Q7EPN5-F1-model_v4 | YCII-related domain-containing protein | 0.9407 | 4 | 118 |
|
| AF-A0A3N8DQT5-F1-model_v4 | deleted | 0.9401 | 1 | 121 |
|
| AF-A0A1E4FS47-F1-model_v4 | YCII-related domain-containing protein | 0.9399 | 2 | 121 |
|
| AF-A0A2U0T9G8-F1-model_v4 | deleted | 0.9397 | 5 | 121 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar