F467582
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 596 | 327 | 563 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_0554458|Ga0395898_0554458_213_824 |
| Length | 203 |
| Sequence | MKRRPPDEILVDLSPPRRRRVLSEDERALWESVAKQAKPLRKRTRVAKAEIVLTAEPAPLAAHASAKRLRSEAVVPLIQPVNVKHPPSPPPLAPLGRRERTHLSRGKIEIDARLDLHGMTQARAHRVLLHFLQRASGDGLRFVLVVTGKGNTKGPDSERGVLRRQVPEWLSLPEFRALVVGFEQAHIGHGGAGALYVRVRRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 4 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 5 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 6 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 7 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 8 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 9 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 10 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 11 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 12 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 13 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 14 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 15 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 16 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 17 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 18 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 19 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 20 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 21 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 22 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 23 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 24 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 25 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 26 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 27 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 160 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 161 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 166 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 167 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 193 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 194 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 271 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 272 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 312 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 315 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 318 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 322 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 323 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 324 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 325 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 326 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 327 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.44 |
| Metatranscriptomes | 0.34 |
| Isolates | 5.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.52 |
| Nodule | 3.36 |
| Rhizoplane | 6.04 |
| Rhizosphere | 78.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002755 | 3300001976 | Bacteria | 2335 |
| 2 | JGI24746J21847_1000148 | 3300001977 | Bacteria | 8829 |
| 3 | rootH2_10225439 | 3300003320 | Bacteria | 1202 |
| 4 | rootL2_10340743 | 3300003322 | Bacteria | 1483 |
| 5 | Ga0070658_10053528 | 3300005327 | Bacteria | 3276 |
| 6 | Ga0070658_10303827 | 3300005327 | Bacteria | 1361 |
| 7 | Ga0070683_100008779 | 3300005329 | Bacteria | 8593 |
| 8 | Ga0070683_100140016 | 3300005329 | Bacteria | 2292 |
| 9 | Ga0070683_100588867 | 3300005329 | Bacteria | 1064 |
| 10 | Ga0070670_100293900 | 3300005331 | Bacteria | 1420 |
| 11 | Ga0070680_100021698 | 3300005336 | Bacteria | 5107 |
| 12 | Ga0070680_100159670 | 3300005336 | Bacteria | 1894 |
| 13 | Ga0070682_100009413 | 3300005337 | Bacteria | 5528 |
| 14 | Ga0068868_100019259 | 3300005338 | Bacteria | 5112 |
| 15 | Ga0070660_100002843 | 3300005339 | Bacteria | 11922 |
| 16 | Ga0070660_100466759 | 3300005339 | Bacteria | 1048 |
| 17 | Ga0070691_10086145 | 3300005341 | Bacteria | 1544 |
| 18 | Ga0070671_100520918 | 3300005355 | Bacteria | 1024 |
| 19 | Ga0070673_100326205 | 3300005364 | Bacteria | 1357 |
| 20 | Ga0070673_100381686 | 3300005364 | Bacteria | 1256 |
| 21 | Ga0070659_100018629 | 3300005366 | Bacteria | 5240 |
| 22 | Ga0070709_10077124 | 3300005434 | Bacteria | 2166 |
| 23 | Ga0070714_100017816 | 3300005435 | Bacteria | 5760 |
| 24 | Ga0070714_100289313 | 3300005435 | Bacteria | 1524 |
| 25 | Ga0070713_100002424 | 3300005436 | Bacteria | 12160 |
| 26 | Ga0070713_100062589 | 3300005436 | Bacteria | 3117 |
| 27 | Ga0070713_100130990 | 3300005436 | Bacteria | 2212 |
| 28 | Ga0070713_100342146 | 3300005436 | Bacteria | 1386 |
| 29 | Ga0070713_100786622 | 3300005436 | Bacteria | 912 |
| 30 | Ga0070710_10007182 | 3300005437 | Bacteria | 5384 |
| 31 | Ga0070711_100096489 | 3300005439 | Bacteria | 2142 |
| 32 | Ga0070711_100369322 | 3300005439 | Bacteria | 1157 |
| 33 | Ga0070663_100001666 | 3300005455 | Bacteria | 12295 |
| 34 | Ga0070663_100722612 | 3300005455 | Bacteria | 848 |
| 35 | Ga0070678_100040432 | 3300005456 | Bacteria | 3300 |
| 36 | Ga0070678_100055673 | 3300005456 | Bacteria | 2889 |
| 37 | Ga0070681_10040811 | 3300005458 | Bacteria | 4649 |
| 38 | Ga0070681_10048927 | 3300005458 | Bacteria | 4223 |
| 39 | Ga0070681_10114542 | 3300005458 | Bacteria | 2635 |
| 40 | Ga0070685_10403969 | 3300005466 | Bacteria | 947 |
| 41 | Ga0070698_100159902 | 3300005471 | Bacteria | 2197 |
| 42 | Ga0070679_100008944 | 3300005530 | Bacteria | 9450 |
| 43 | Ga0070679_100041621 | 3300005530 | Bacteria | 4572 |
| 44 | Ga0070679_100768417 | 3300005530 | Bacteria | 906 |
| 45 | Ga0070684_100006680 | 3300005535 | Bacteria | 8942 |
| 46 | Ga0070684_100258767 | 3300005535 | Bacteria | 1592 |
| 47 | Ga0070684_100606735 | 3300005535 | Bacteria | 1018 |
| 48 | Ga0070697_100029029 | 3300005536 | Bacteria | 4432 |
| 49 | Ga0068853_100002454 | 3300005539 | Bacteria | 13873 |
| 50 | Ga0068853_100002614 | 3300005539 | Bacteria | 13545 |
| 51 | Ga0068853_100081722 | 3300005539 | Bacteria | 2830 |
| 52 | Ga0068853_100120254 | 3300005539 | Bacteria | 2342 |
| 53 | Ga0068853_100147859 | 3300005539 | Bacteria | 2113 |
| 54 | Ga0070695_100503778 | 3300005545 | Bacteria | 937 |
| 55 | Ga0070693_100008395 | 3300005547 | Bacteria | 5090 |
| 56 | Ga0068855_100006336 | 3300005563 | Bacteria | 14418 |
| 57 | Ga0068855_100388660 | 3300005563 | Bacteria | 1531 |
| 58 | Ga0070664_100052242 | 3300005564 | Bacteria | 3461 |
| 59 | Ga0068857_100017087 | 3300005577 | Bacteria | 6355 |
| 60 | Ga0068857_101121740 | 3300005577 | Bacteria | 760 |
| 61 | Ga0068852_100040747 | 3300005616 | Bacteria | 3921 |
| 62 | Ga0068852_100080223 | 3300005616 | Bacteria | 2893 |
| 63 | Ga0068859_100231042 | 3300005617 | Bacteria | 1938 |
| 64 | Ga0068851_10222223 | 3300005834 | Bacteria | 1062 |
| 65 | Ga0068870_10221503 | 3300005840 | Bacteria | 1158 |
| 66 | Ga0068870_10496638 | 3300005840 | Bacteria | 813 |
| 67 | Ga0081455_10003646 | 3300005937 | Bacteria | 17638 |
| 68 | Ga0081455_10019063 | 3300005937 | Bacteria | 6506 |
| 69 | Ga0081455_10074562 | 3300005937 | Bacteria | 2802 |
| 70 | Ga0081455_10268756 | 3300005937 | Bacteria | 1238 |
| 71 | Ga0081540_1027038 | 3300005983 | Bacteria | 3260 |
| 72 | Ga0081540_1042824 | 3300005983 | Bacteria | 2330 |
| 73 | Ga0070717_10000598 | 3300006028 | Bacteria | 23163 |
| 74 | Ga0070717_10500171 | 3300006028 | Bacteria | 1098 |
| 75 | Ga0075365_10178424 | 3300006038 | Bacteria | 1484 |
| 76 | Ga0070712_100175883 | 3300006175 | Bacteria | 1664 |
| 77 | Ga0070712_100667749 | 3300006175 | Bacteria | 884 |
| 78 | Ga0075367_10144805 | 3300006178 | Bacteria | 1473 |
| 79 | Ga0097621_100147183 | 3300006237 | Bacteria | 2017 |
| 80 | Ga0068871_100074487 | 3300006358 | Bacteria | 2801 |
| 81 | Ga0068871_100518607 | 3300006358 | Bacteria | 1076 |
| 82 | Ga0075428_100028368 | 3300006844 | Bacteria | 6191 |
| 83 | Ga0068865_100043307 | 3300006881 | Bacteria | 3075 |
| 84 | Ga0068865_100499235 | 3300006881 | Bacteria | 1014 |
| 85 | Ga0097620_100231042 | 3300006931 | Bacteria | 1938 |
| 86 | Ga0099824_1011583 | 3300006942 | Bacteria | 9925 |
| 87 | Ga0105240_10059068 | 3300009093 | Bacteria | 4787 |
| 88 | Ga0105240_10381810 | 3300009093 | Bacteria | 1591 |
| 89 | Ga0111539_11754008 | 3300009094 | Unclassified | 720 |
| 90 | Ga0105245_10027626 | 3300009098 | Bacteria | 5000 |
| 91 | Ga0105247_10969056 | 3300009101 | Bacteria | 662 |
| 92 | Ga0114129_10030378 | 3300009147 | Bacteria | 7645 |
| 93 | Ga0105243_10469394 | 3300009148 | Bacteria | 1185 |
| 94 | Ga0105243_10581901 | 3300009148 | Bacteria | 1075 |
| 95 | Ga0105241_10003924 | 3300009174 | Bacteria | 11014 |
| 96 | Ga0105241_10060890 | 3300009174 | Bacteria | 2905 |
| 97 | Ga0105248_10026101 | 3300009177 | Bacteria | 6500 |
| 98 | Ga0105248_11591516 | 3300009177 | Bacteria | 740 |
| 99 | Ga0105237_10008146 | 3300009545 | Bacteria | 11379 |
| 100 | Ga0105237_10088220 | 3300009545 | Bacteria | 3091 |
| 101 | Ga0105237_10155815 | 3300009545 | Bacteria | 2281 |
| 102 | Ga0105237_10535283 | 3300009545 | Bacteria | 1178 |
| 103 | Ga0105238_10044535 | 3300009551 | Bacteria | 4486 |
| 104 | Ga0105238_10587821 | 3300009551 | Unclassified | 1120 |
| 105 | Ga0105249_10112128 | 3300009553 | Bacteria | 2579 |
| 106 | Ga0105239_10023840 | 3300010375 | Bacteria | 6739 |
| 107 | Ga0105239_10025568 | 3300010375 | Bacteria | 6499 |
| 108 | Ga0105239_10028016 | 3300010375 | Bacteria | 6199 |
| 109 | Ga0105239_11838006 | 3300010375 | Bacteria | 702 |
| 110 | Ga0105246_10000052 | 3300011119 | Bacteria | 46290 |
| 111 | Ga0105246_10005044 | 3300011119 | Bacteria | 8027 |
| 112 | Ga0105246_10405568 | 3300011119 | Bacteria | 1133 |
| 113 | Ga0157373_10013772 | 3300013100 | Bacteria | 5928 |
| 114 | Ga0157370_10031834 | 3300013104 | Bacteria | 5156 |
| 115 | Ga0157370_10192063 | 3300013104 | Bacteria | 1895 |
| 116 | Ga0157369_10001511 | 3300013105 | Bacteria | 28540 |
| 117 | Ga0157369_10003829 | 3300013105 | Bacteria | 17867 |
| 118 | Ga0157374_10032796 | 3300013296 | Bacteria | 4733 |
| 119 | Ga0157378_10002713 | 3300013297 | Bacteria | 15762 |
| 120 | Ga0163162_10073409 | 3300013306 | Bacteria | 3477 |
| 121 | Ga0163162_10132028 | 3300013306 | Bacteria | 2606 |
| 122 | Ga0157375_10533019 | 3300013308 | Bacteria | 1337 |
| 123 | Ga0163163_10097005 | 3300014325 | Bacteria | 2968 |
| 124 | Ga0163163_11445652 | 3300014325 | Bacteria | 749 |
| 125 | Ga0157379_10078625 | 3300014968 | Bacteria | 2954 |
| 126 | Ga0157379_10573455 | 3300014968 | Bacteria | 1051 |
| 127 | Ga0157376_10017080 | 3300014969 | Bacteria | 5527 |
| 128 | Ga0157376_10173362 | 3300014969 | Bacteria | 1966 |
| 129 | Ga0157376_11270606 | 3300014969 | Bacteria | 766 |
| 130 | Ga0163161_10799517 | 3300017792 | Bacteria | 792 |
| 131 | Ga0213872_10033863 | 3300021361 | Bacteria | 2340 |
| 132 | Ga0213874_10079472 | 3300021377 | Bacteria | 1060 |
| 133 | Ga0213874_10100383 | 3300021377 | Bacteria | 961 |
| 134 | Ga0213876_10063105 | 3300021384 | Bacteria | 1956 |
| 135 | Ga0213875_10156079 | 3300021388 | Bacteria | 1070 |
| 136 | Ga0209677_102510 | 3300025253 | Bacteria | 6840 |
| 137 | Ga0209148_1007942 | 3300025254 | Bacteria | 2165 |
| 138 | Ga0209233_1003764 | 3300025261 | Bacteria | 5301 |
| 139 | Ga0209455_1001040 | 3300025272 | Bacteria | 13815 |
| 140 | Ga0209455_1002070 | 3300025272 | Bacteria | 8101 |
| 141 | Ga0209564_1000321 | 3300025295 | Bacteria | 93331 |
| 142 | Ga0209564_1021625 | 3300025295 | Bacteria | 2304 |
| 143 | Ga0207710_10077570 | 3300025900 | Bacteria | 1535 |
| 144 | Ga0207688_10156875 | 3300025901 | Bacteria | 1347 |
| 145 | Ga0207680_10182612 | 3300025903 | Bacteria | 1419 |
| 146 | Ga0207647_10262530 | 3300025904 | Bacteria | 989 |
| 147 | Ga0207699_10017128 | 3300025906 | Bacteria | 3805 |
| 148 | Ga0207643_10634306 | 3300025908 | Bacteria | 689 |
| 149 | Ga0207705_10147708 | 3300025909 | Bacteria | 1760 |
| 150 | Ga0207707_10004287 | 3300025912 | Bacteria | 12624 |
| 151 | Ga0207707_10017763 | 3300025912 | Bacteria | 6203 |
| 152 | Ga0207707_10032444 | 3300025912 | Bacteria | 4571 |
| 153 | Ga0207707_10192350 | 3300025912 | Bacteria | 1780 |
| 154 | Ga0207695_10015308 | 3300025913 | Bacteria | 9037 |
| 155 | Ga0207695_10150514 | 3300025913 | Bacteria | 2266 |
| 156 | Ga0207671_10009240 | 3300025914 | Bacteria | 8259 |
| 157 | Ga0207671_10055238 | 3300025914 | Bacteria | 2942 |
| 158 | Ga0207671_10196493 | 3300025914 | Bacteria | 1574 |
| 159 | Ga0207693_10006870 | 3300025915 | Bacteria | 9396 |
| 160 | Ga0207693_10010186 | 3300025915 | Bacteria | 7635 |
| 161 | Ga0207693_10033379 | 3300025915 | Bacteria | 4061 |
| 162 | Ga0207693_10288046 | 3300025915 | Bacteria | 1287 |
| 163 | Ga0207663_10159321 | 3300025916 | Bacteria | 1591 |
| 164 | Ga0207663_10329526 | 3300025916 | Bacteria | 1150 |
| 165 | Ga0207663_10533530 | 3300025916 | Bacteria | 915 |
| 166 | Ga0207660_10001366 | 3300025917 | Bacteria | 16351 |
| 167 | Ga0207660_10074055 | 3300025917 | Bacteria | 2484 |
| 168 | Ga0207657_10001686 | 3300025919 | Bacteria | 23826 |
| 169 | Ga0207657_10417169 | 3300025919 | Bacteria | 1055 |
| 170 | Ga0207649_10030607 | 3300025920 | Bacteria | 3190 |
| 171 | Ga0207649_10154429 | 3300025920 | Bacteria | 1584 |
| 172 | Ga0207652_10001889 | 3300025921 | Bacteria | 18142 |
| 173 | Ga0207652_11096162 | 3300025921 | Unclassified | 697 |
| 174 | Ga0207694_10190375 | 3300025924 | Bacteria | 1666 |
| 175 | Ga0207650_10308617 | 3300025925 | Bacteria | 1294 |
| 176 | Ga0207700_10001725 | 3300025928 | Bacteria | 12413 |
| 177 | Ga0207700_10209738 | 3300025928 | Bacteria | 1646 |
| 178 | Ga0207700_10263485 | 3300025928 | Unclassified | 1477 |
| 179 | Ga0207664_10179492 | 3300025929 | Bacteria | 1817 |
| 180 | Ga0207664_11033118 | 3300025929 | Bacteria | 736 |
| 181 | Ga0207644_10493923 | 3300025931 | Bacteria | 1009 |
| 182 | Ga0207690_10029000 | 3300025932 | Bacteria | 3514 |
| 183 | Ga0207709_10435986 | 3300025935 | Bacteria | 1009 |
| 184 | Ga0207669_10923180 | 3300025937 | Bacteria | 730 |
| 185 | Ga0207704_10204239 | 3300025938 | Bacteria | 1449 |
| 186 | Ga0207665_10027297 | 3300025939 | Bacteria | 3772 |
| 187 | Ga0207691_10434778 | 3300025940 | Bacteria | 1118 |
| 188 | Ga0207661_10007064 | 3300025944 | Bacteria | 7970 |
| 189 | Ga0207661_10079544 | 3300025944 | Bacteria | 2702 |
| 190 | Ga0207661_10523075 | 3300025944 | Bacteria | 1085 |
| 191 | Ga0207667_10002324 | 3300025949 | Bacteria | 23814 |
| 192 | Ga0207667_10041162 | 3300025949 | Bacteria | 4916 |
| 193 | Ga0207667_10449228 | 3300025949 | Bacteria | 1310 |
| 194 | Ga0207651_10286449 | 3300025960 | Bacteria | 1364 |
| 195 | Ga0207712_10187728 | 3300025961 | Bacteria | 1629 |
| 196 | Ga0207640_10007128 | 3300025981 | Bacteria | 6160 |
| 197 | Ga0207677_10186551 | 3300026023 | Bacteria | 1636 |
| 198 | Ga0207703_10798758 | 3300026035 | Bacteria | 901 |
| 199 | Ga0207639_10001161 | 3300026041 | Bacteria | 17869 |
| 200 | Ga0207639_10018895 | 3300026041 | Bacteria | 4906 |
| 201 | Ga0207639_10091736 | 3300026041 | Bacteria | 2433 |
| 202 | Ga0207678_10004832 | 3300026067 | Bacteria | 12098 |
| 203 | Ga0207678_10057356 | 3300026067 | Bacteria | 3351 |
| 204 | Ga0207678_10636021 | 3300026067 | Bacteria | 937 |
| 205 | Ga0207641_10031099 | 3300026088 | Bacteria | 4426 |
| 206 | Ga0207648_10491817 | 3300026089 | Bacteria | 1122 |
| 207 | Ga0207674_10042259 | 3300026116 | Bacteria | 4710 |
| 208 | Ga0207683_10065230 | 3300026121 | Bacteria | 3210 |
| 209 | Ga0207683_10080956 | 3300026121 | Bacteria | 2881 |
| 210 | Ga0207683_10121753 | 3300026121 | Bacteria | 2343 |
| 211 | Ga0207698_10119810 | 3300026142 | Bacteria | 2225 |
| 212 | Ga0207698_10225416 | 3300026142 | Bacteria | 1697 |
| 213 | Ga0209588_1014784 | 3300027671 | Bacteria | 2395 |
| 214 | Ga0268266_10379924 | 3300028379 | Bacteria | 1332 |
| 215 | Ga0307515_10102060 | 3300028794 | Bacteria | 3455 |
| 216 | Ga0265760_10132173 | 3300031090 | Bacteria | 808 |
| 217 | Ga0265332_10055621 | 3300031238 | Bacteria | 1696 |
| 218 | Ga0265332_10067376 | 3300031238 | Bacteria | 1526 |
| 219 | Ga0265328_10230355 | 3300031239 | Unclassified | 707 |
| 220 | Ga0265325_10007580 | 3300031241 | Bacteria | 6488 |
| 221 | Ga0265339_10001062 | 3300031249 | Bacteria | 20880 |
| 222 | Ga0265339_10104524 | 3300031249 | Bacteria | 1471 |
| 223 | Ga0265339_10147882 | 3300031249 | Bacteria | 1190 |
| 224 | Ga0265339_10283210 | 3300031249 | Bacteria | 794 |
| 225 | Ga0265331_10092647 | 3300031250 | Bacteria | 1396 |
| 226 | Ga0307513_10484819 | 3300031456 | Bacteria | 955 |
| 227 | Ga0307509_10349367 | 3300031507 | Bacteria | 1203 |
| 228 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 229 | Ga0307508_10253584 | 3300031616 | Bacteria | 1355 |
| 230 | Ga0265314_10051931 | 3300031711 | Bacteria | 2853 |
| 231 | Ga0265314_10075262 | 3300031711 | Bacteria | 2247 |
| 232 | Ga0265314_10123022 | 3300031711 | Bacteria | 1630 |
| 233 | Ga0265314_10128993 | 3300031711 | Bacteria | 1580 |
| 234 | Ga0265342_10003978 | 3300031712 | Bacteria | 11831 |
| 235 | Ga0265342_10087584 | 3300031712 | Bacteria | 1789 |
| 236 | Ga0265342_10089155 | 3300031712 | Bacteria | 1770 |
| 237 | Ga0307412_10028363 | 3300031911 | Bacteria | 3501 |
| 238 | Ga0307510_10082383 | 3300033180 | Bacteria | 3113 |
| 239 | Ga0373926_0088473 | 3300035083 | Bacteria | 1150 |
| 240 | Ga0373926_0222739 | 3300035083 | Bacteria | 728 |
| 241 | Ga0373934_0012084 | 3300035086 | Bacteria | 3257 |
| 242 | Ga0373944_0074090 | 3300035089 | Bacteria | 1114 |
| 243 | Ga0373944_0094719 | 3300035089 | Bacteria | 1002 |
| 244 | Ga0373936_0030834 | 3300035113 | Bacteria | 2115 |
| 245 | Ga0373941_0007472 | 3300035115 | Bacteria | 2674 |
| 246 | Ga0373945_0049250 | 3300035116 | Bacteria | 1545 |
| 247 | Ga0373953_0001445 | 3300035117 | Bacteria | 6889 |
| 248 | Ga0373953_0057059 | 3300035117 | Bacteria | 1589 |
| 249 | Ga0373953_0132815 | 3300035117 | Bacteria | 1062 |
| 250 | Ga0373954_0030161 | 3300035118 | Bacteria | 2500 |
| 251 | Ga0373954_0058169 | 3300035118 | Bacteria | 1821 |
| 252 | Ga0373957_0027513 | 3300035120 | Bacteria | 2066 |
| 253 | Ga0373957_0052708 | 3300035120 | Bacteria | 1559 |
| 254 | Ga0373957_0141557 | 3300035120 | Bacteria | 983 |
| 255 | Ga0373943_0005777 | 3300035170 | Bacteria | 5557 |
| 256 | Ga0373943_0058182 | 3300035170 | Bacteria | 1923 |
| 257 | Ga0373943_0125811 | 3300035170 | Bacteria | 1367 |
| 258 | Ga0373946_0003273 | 3300035171 | Bacteria | 5752 |
| 259 | Ga0373955_0003039 | 3300035172 | Bacteria | 7349 |
| 260 | Ga0373955_0060620 | 3300035172 | Bacteria | 2087 |
| 261 | Ga0373955_0087088 | 3300035172 | Bacteria | 1774 |
| 262 | Ga0373924_0012052 | 3300035410 | Bacteria | 3223 |
| 263 | Ga0373924_0068403 | 3300035410 | Bacteria | 1495 |
| 264 | Ga0373924_0074022 | 3300035410 | Bacteria | 1440 |
| 265 | Ga0373931_0144472 | 3300035691 | Bacteria | 1381 |
| 266 | Ga0373931_0667910 | 3300035691 | Bacteria | 684 |
| 267 | Ga0373935_0000953 | 3300035692 | Bacteria | 15634 |
| 268 | Ga0373935_0014847 | 3300035692 | Bacteria | 4703 |
| 269 | Ga0373935_0117809 | 3300035692 | Bacteria | 1770 |
| 270 | Ga0373927_0001486 | 3300035695 | Bacteria | 17658 |
| 271 | Ga0373927_0044780 | 3300035695 | Bacteria | 2862 |
| 272 | Ga0373927_0048807 | 3300035695 | Bacteria | 2738 |
| 273 | Ga0373933_0021586 | 3300035724 | Bacteria | 3659 |
| 274 | Ga0373933_0035577 | 3300035724 | Bacteria | 2909 |
| 275 | Ga0373933_0071544 | 3300035724 | Bacteria | 2112 |
| 276 | Ga0373947_0077646 | 3300035725 | Bacteria | 2048 |
| 277 | Ga0373947_0127417 | 3300035725 | Bacteria | 1622 |
| 278 | Ga0373937_0103533 | 3300036401 | Bacteria | 2644 |
| 279 | Ga0373937_0135717 | 3300036401 | Bacteria | 2300 |
| 280 | Ga0373937_0207495 | 3300036401 | Bacteria | 1843 |
| 281 | Ga0373937_0396503 | 3300036401 | Bacteria | 1309 |
| 282 | Ga0310109_032717 | 3300036534 | Bacteria | 686 |
| 283 | Ga0373925_0016468 | 3300037068 | Bacteria | 5356 |
| 284 | Ga0373925_0024914 | 3300037068 | Bacteria | 4370 |
| 285 | Ga0373925_0030846 | 3300037068 | Bacteria | 3936 |
| 286 | Ga0373925_0248894 | 3300037068 | Bacteria | 1425 |
| 287 | Ga0373925_0756652 | 3300037068 | Bacteria | 801 |
| 288 | Ga0395899_0676245 | 3300037312 | Bacteria | 650 |
| 289 | Ga0395898_0554458 | 3300037466 | Bacteria | 1091 |
| 290 | Ga0395898_1094820 | 3300037466 | Bacteria | 730 |
| 291 | Ga0395905_0022009 | 3300037471 | Bacteria | 6031 |
| 292 | Ga0436364_0804363 | 3300037853 | Bacteria | 1529 |
| 293 | Ga0436364_1184315 | 3300037853 | Bacteria | 632 |
| 294 | Ga0436364_1330873 | 3300037853 | Bacteria | 1059 |
| 295 | Ga0436365_1262081 | 3300039437 | Bacteria | 4465 |
| 296 | Ga0436361_0348492 | 3300039447 | Bacteria | 2705 |
| 297 | Ga0436361_0960028 | 3300039447 | Bacteria | 1914 |
| 298 | Ga0436363_0585583 | 3300039450 | Bacteria | 2419 |
| 299 | Ga0451843_0100938 | 3300041509 | Bacteria | 1012 |
| 300 | Ga0451853_0145000 | 3300041512 | Bacteria | 767 |
| 301 | Ga0466959_0294512 | 3300045049 | Bacteria | 1112 |
| 302 | Ga0466967_0080769 | 3300045976 | Bacteria | 2935 |
| 303 | Ga0466967_0295084 | 3300045976 | Bacteria | 1558 |
| 304 | Ga0495592_0015319 | 3300046454 | Bacteria | 5819 |
| 305 | Ga0495592_0023331 | 3300046454 | Bacteria | 4705 |
| 306 | Ga0495592_0074932 | 3300046454 | Bacteria | 2458 |
| 307 | Ga0495603_0000047 | 3300046455 | Bacteria | 53081 |
| 308 | Ga0495603_0053181 | 3300046455 | Bacteria | 2403 |
| 309 | Ga0495603_0124825 | 3300046455 | Bacteria | 1500 |
| 310 | Ga0495629_0000320 | 3300046459 | Bacteria | 41151 |
| 311 | Ga0495629_0027213 | 3300046459 | Bacteria | 4062 |
| 312 | Ga0495641_0003618 | 3300046461 | Bacteria | 11446 |
| 313 | Ga0495641_0094827 | 3300046461 | Bacteria | 1333 |
| 314 | Ga0495651_0021262 | 3300046462 | Bacteria | 5042 |
| 315 | Ga0495651_0066225 | 3300046462 | Bacteria | 2758 |
| 316 | Ga0495651_0074316 | 3300046462 | Bacteria | 2579 |
| 317 | Ga0495651_0490154 | 3300046462 | Bacteria | 788 |
| 318 | Ga0495653_0025800 | 3300046463 | Bacteria | 4715 |
| 319 | Ga0495580_0003812 | 3300046472 | Bacteria | 12769 |
| 320 | Ga0495580_0029615 | 3300046472 | Bacteria | 3972 |
| 321 | Ga0495580_0121568 | 3300046472 | Bacteria | 1813 |
| 322 | Ga0495580_0324810 | 3300046472 | Bacteria | 1046 |
| 323 | Ga0495582_0000043 | 3300046473 | Bacteria | 63647 |
| 324 | Ga0495582_0046916 | 3300046473 | Bacteria | 2379 |
| 325 | Ga0495582_0332741 | 3300046473 | Bacteria | 874 |
| 326 | Ga0495639_0000091 | 3300046475 | Bacteria | 44027 |
| 327 | Ga0495639_0028279 | 3300046475 | Bacteria | 2483 |
| 328 | Ga0495662_0073977 | 3300046476 | Bacteria | 1653 |
| 329 | Ga0495664_0027964 | 3300046477 | Bacteria | 3290 |
| 330 | Ga0495664_0061528 | 3300046477 | Bacteria | 2235 |
| 331 | Ga0495664_0085857 | 3300046477 | Bacteria | 1890 |
| 332 | Ga0495584_0029790 | 3300046491 | Bacteria | 2766 |
| 333 | Ga0495594_0000453 | 3300046499 | Bacteria | 20836 |
| 334 | Ga0495594_0109855 | 3300046499 | Bacteria | 1555 |
| 335 | Ga0495606_0283901 | 3300046507 | Bacteria | 904 |
| 336 | Ga0495608_0290544 | 3300046511 | Bacteria | 1013 |
| 337 | Ga0495618_0051506 | 3300046514 | Bacteria | 2601 |
| 338 | Ga0495618_0058501 | 3300046514 | Bacteria | 2441 |
| 339 | Ga0495628_0035958 | 3300046516 | Bacteria | 3978 |
| 340 | Ga0495628_0041630 | 3300046516 | Bacteria | 3667 |
| 341 | Ga0495628_0087783 | 3300046516 | Bacteria | 2411 |
| 342 | Ga0495630_0008996 | 3300046517 | Bacteria | 7172 |
| 343 | Ga0495630_0178895 | 3300046517 | Bacteria | 1617 |
| 344 | Ga0495630_0288859 | 3300046517 | Bacteria | 1253 |
| 345 | Ga0495630_0446192 | 3300046517 | Bacteria | 991 |
| 346 | Ga0495644_0144809 | 3300046523 | Bacteria | 908 |
| 347 | Ga0495648_0000286 | 3300046524 | Bacteria | 57430 |
| 348 | Ga0495666_0010714 | 3300046526 | Bacteria | 4573 |
| 349 | Ga0495652_0023709 | 3300046529 | Bacteria | 5439 |
| 350 | Ga0495652_0035518 | 3300046529 | Bacteria | 4338 |
| 351 | Ga0495665_0001635 | 3300046531 | Bacteria | 11999 |
| 352 | Ga0495665_0078134 | 3300046531 | Bacteria | 1741 |
| 353 | Ga0495665_0226831 | 3300046531 | Bacteria | 965 |
| 354 | Ga0495640_0007704 | 3300046533 | Bacteria | 8471 |
| 355 | Ga0495640_0014392 | 3300046533 | Bacteria | 5989 |
| 356 | Ga0495640_0027351 | 3300046533 | Bacteria | 4113 |
| 357 | Ga0495586_0083487 | 3300046535 | Bacteria | 1758 |
| 358 | Ga0495586_0225174 | 3300046535 | Bacteria | 1066 |
| 359 | Ga0495587_0031015 | 3300046536 | Bacteria | 3239 |
| 360 | Ga0495587_0268912 | 3300046536 | Bacteria | 957 |
| 361 | Ga0495598_0051282 | 3300046537 | Bacteria | 1243 |
| 362 | Ga0495645_0052917 | 3300046543 | Bacteria | 2952 |
| 363 | Ga0495645_0079371 | 3300046543 | Bacteria | 2357 |
| 364 | Ga0495622_0002785 | 3300046557 | Bacteria | 8344 |
| 365 | Ga0495622_0026296 | 3300046557 | Bacteria | 2718 |
| 366 | Ga0495667_0033079 | 3300046559 | Bacteria | 3460 |
| 367 | Ga0495667_0046486 | 3300046559 | Bacteria | 2870 |
| 368 | Ga0495634_0007159 | 3300046642 | Bacteria | 8412 |
| 369 | Ga0495634_0018995 | 3300046642 | Bacteria | 4887 |
| 370 | Ga0495634_0113709 | 3300046642 | Bacteria | 1738 |
| 371 | Ga0495625_0117372 | 3300046660 | Bacteria | 1814 |
| 372 | Ga0495625_0199172 | 3300046660 | Bacteria | 1323 |
| 373 | Ga0495625_0509150 | 3300046660 | Bacteria | 735 |
| 374 | Ga0495635_0001788 | 3300046663 | Bacteria | 14525 |
| 375 | Ga0495635_0053495 | 3300046663 | Bacteria | 2781 |
| 376 | Ga0495635_0073028 | 3300046663 | Bacteria | 2350 |
| 377 | Ga0495588_0026270 | 3300046674 | Bacteria | 2906 |
| 378 | Ga0495588_0090752 | 3300046674 | Bacteria | 1600 |
| 379 | Ga0495657_0036727 | 3300046675 | Bacteria | 3383 |
| 380 | Ga0495657_0188178 | 3300046675 | Bacteria | 1263 |
| 381 | Ga0495599_0346792 | 3300046678 | Bacteria | 890 |
| 382 | Ga0495623_0061076 | 3300046679 | Bacteria | 2364 |
| 383 | Ga0495623_0062183 | 3300046679 | Bacteria | 2340 |
| 384 | Ga0495646_0023490 | 3300046680 | Bacteria | 3880 |
| 385 | Ga0495646_0219014 | 3300046680 | Bacteria | 1030 |
| 386 | Ga0495647_0001913 | 3300046681 | Bacteria | 6484 |
| 387 | Ga0495658_0003457 | 3300046683 | Bacteria | 7807 |
| 388 | Ga0495658_0492310 | 3300046683 | Bacteria | 784 |
| 389 | Ga0495669_0066375 | 3300046684 | Bacteria | 1639 |
| 390 | Ga0495613_0001794 | 3300046689 | Bacteria | 16314 |
| 391 | Ga0495613_0141922 | 3300046689 | Bacteria | 1716 |
| 392 | Ga0495613_0311264 | 3300046689 | Bacteria | 1088 |
| 393 | Ga0495624_0000694 | 3300046690 | Bacteria | 26424 |
| 394 | Ga0495624_0199394 | 3300046690 | Bacteria | 1216 |
| 395 | Ga0495671_0155510 | 3300046692 | Bacteria | 1113 |
| 396 | Ga0495600_0019133 | 3300046809 | Bacteria | 4368 |
| 397 | Ga0495581_0000486 | 3300047315 | Bacteria | 20240 |
| 398 | Ga0495581_0013345 | 3300047315 | Bacteria | 4764 |
| 399 | Ga0495581_0057777 | 3300047315 | Bacteria | 2239 |
| 400 | Ga0495604_0023259 | 3300047317 | Bacteria | 4943 |
| 401 | Ga0495604_0104206 | 3300047317 | Bacteria | 2079 |
| 402 | Ga0495604_0135425 | 3300047317 | Bacteria | 1766 |
| 403 | Ga0495674_0003925 | 3300047319 | Bacteria | 14430 |
| 404 | Ga0495674_0004075 | 3300047319 | Bacteria | 14133 |
| 405 | Ga0495674_0010066 | 3300047319 | Bacteria | 8964 |
| 406 | Ga0495676_0017241 | 3300047321 | Bacteria | 6391 |
| 407 | Ga0495680_0025482 | 3300047322 | Bacteria | 4893 |
| 408 | Ga0495675_0494131 | 3300047444 | Bacteria | 703 |
| 409 | Ga0495684_0011974 | 3300047471 | Bacteria | 6689 |
| 410 | Ga0495684_0014889 | 3300047471 | Bacteria | 5989 |
| 411 | Ga0495593_0000005 | 3300047673 | Bacteria | 93984 |
| 412 | Ga0495593_0042818 | 3300047673 | Bacteria | 2429 |
| 413 | Ga0495602_0182596 | 3300048088 | Bacteria | 1616 |
| 414 | Ga0495614_0067842 | 3300048089 | Bacteria | 1535 |
| 415 | Ga0495626_0011452 | 3300048091 | Bacteria | 4691 |
| 416 | Ga0496100_0009441 | 3300048903 | Bacteria | 5484 |
| 417 | Ga0496101_0276283 | 3300048904 | Bacteria | 1312 |
| 418 | Ga0496102_0138248 | 3300048905 | Bacteria | 2283 |
| 419 | Ga0496102_0359795 | 3300048905 | Bacteria | 1370 |
| 420 | Ga0496103_0013725 | 3300048906 | Bacteria | 4807 |
| 421 | Ga0496103_0026151 | 3300048906 | Bacteria | 3533 |
| 422 | Ga0496104_0070776 | 3300048907 | Bacteria | 3317 |
| 423 | Ga0496104_0959185 | 3300048907 | Bacteria | 759 |
| 424 | Ga0496105_0014585 | 3300048908 | Bacteria | 6257 |
| 425 | Ga0496105_0173428 | 3300048908 | Bacteria | 1767 |
| 426 | Ga0496106_0001014 | 3300048909 | Bacteria | 20581 |
| 427 | Ga0496106_0194116 | 3300048909 | Bacteria | 1615 |
| 428 | Ga0496107_0017012 | 3300048910 | Bacteria | 5112 |
| 429 | Ga0496107_0042406 | 3300048910 | Bacteria | 3268 |
| 430 | Ga0496108_0409640 | 3300048911 | Bacteria | 1184 |
| 431 | Ga0496108_0900667 | 3300048911 | Bacteria | 759 |
| 432 | Ga0496109_0423681 | 3300048912 | Bacteria | 1257 |
| 433 | Ga0496109_0570050 | 3300048912 | Unclassified | 1067 |
| 434 | Ga0496110_0042757 | 3300048913 | Bacteria | 3955 |
| 435 | Ga0496110_0143414 | 3300048913 | Bacteria | 2159 |
| 436 | Ga0496110_0351812 | 3300048913 | Bacteria | 1342 |
| 437 | Ga0496111_0006861 | 3300048914 | Bacteria | 7431 |
| 438 | Ga0496112_0000020 | 3300048915 | Bacteria | 169373 |
| 439 | Ga0496112_0014598 | 3300048915 | Bacteria | 7298 |
| 440 | Ga0496112_0017956 | 3300048915 | Bacteria | 6657 |
| 441 | Ga0496113_0173056 | 3300048916 | Bacteria | 1710 |
| 442 | Ga0496114_0121382 | 3300048917 | Bacteria | 2248 |
| 443 | Ga0496114_0140197 | 3300048917 | Bacteria | 2093 |
| 444 | Ga0496114_0865747 | 3300048917 | Bacteria | 784 |
| 445 | Ga0496115_0003980 | 3300048918 | Bacteria | 10658 |
| 446 | Ga0496115_0006071 | 3300048918 | Bacteria | 8821 |
| 447 | Ga0496115_0008492 | 3300048918 | Bacteria | 7598 |
| 448 | Ga0496115_0106653 | 3300048918 | Bacteria | 2300 |
| 449 | Ga0496115_0443847 | 3300048918 | Bacteria | 1049 |
| 450 | Ga0496116_0007249 | 3300048919 | Bacteria | 9883 |
| 451 | Ga0496117_0061528 | 3300048920 | Bacteria | 2580 |
| 452 | Ga0496118_0006290 | 3300048921 | Bacteria | 13129 |
| 453 | Ga0496118_0561641 | 3300048921 | Bacteria | 554 |
| 454 | Ga0496121_0001251 | 3300048924 | Bacteria | 44033 |
| 455 | Ga0496121_0011522 | 3300048924 | Bacteria | 9798 |
| 456 | Ga0496121_0038959 | 3300048924 | Bacteria | 4198 |
| 457 | Ga0496121_0043240 | 3300048924 | Bacteria | 3905 |
| 458 | Ga0496121_0205422 | 3300048924 | Bacteria | 1400 |
| 459 | Ga0496121_0235297 | 3300048924 | Bacteria | 1280 |
| 460 | Ga0496124_0120621 | 3300048927 | Bacteria | 2096 |
| 461 | Ga0496124_0534521 | 3300048927 | Bacteria | 778 |
| 462 | Ga0496126_0009189 | 3300048929 | Bacteria | 10544 |
| 463 | Ga0496126_0009570 | 3300048929 | Bacteria | 10278 |
| 464 | Ga0496126_0012762 | 3300048929 | Bacteria | 8587 |
| 465 | Ga0496126_0028457 | 3300048929 | Bacteria | 5325 |
| 466 | Ga0496126_0039133 | 3300048929 | Bacteria | 4403 |
| 467 | Ga0496126_0114722 | 3300048929 | Bacteria | 2343 |
| 468 | Ga0496126_0131444 | 3300048929 | Bacteria | 2163 |
| 469 | Ga0496126_0146376 | 3300048929 | Bacteria | 2028 |
| 470 | Ga0496126_0383587 | 3300048929 | Bacteria | 1143 |
| 471 | Ga0496126_0703885 | 3300048929 | Bacteria | 785 |
| 472 | Ga0501031_0068936 | 3300049568 | Bacteria | 2304 |
| 473 | Ga0501031_0653368 | 3300049568 | Bacteria | 676 |
| 474 | Ga0501032_0029896 | 3300049569 | Bacteria | 3737 |
| 475 | Ga0501033_0029329 | 3300049570 | Bacteria | 4135 |
| 476 | Ga0501033_0103632 | 3300049570 | Bacteria | 2074 |
| 477 | Ga0501033_0235396 | 3300049570 | Bacteria | 1300 |
| 478 | Ga0501034_0068618 | 3300049571 | Bacteria | 3555 |
| 479 | Ga0501034_0112843 | 3300049571 | Bacteria | 2708 |
| 480 | Ga0501034_0141135 | 3300049571 | Bacteria | 2388 |
| 481 | Ga0501034_0259298 | 3300049571 | Bacteria | 1681 |
| 482 | Ga0501034_0507789 | 3300049571 | Bacteria | 1119 |
| 483 | Ga0501034_0789700 | 3300049571 | Bacteria | 843 |
| 484 | Ga0501036_0017677 | 3300049572 | Bacteria | 5967 |
| 485 | Ga0501037_0016122 | 3300049573 | Bacteria | 5500 |
| 486 | Ga0501037_0029001 | 3300049573 | Bacteria | 4087 |
| 487 | Ga0501038_0004781 | 3300049574 | Bacteria | 12588 |
| 488 | Ga0501038_0025760 | 3300049574 | Bacteria | 5239 |
| 489 | Ga0501038_0202359 | 3300049574 | Bacteria | 1593 |
| 490 | Ga0501038_0271795 | 3300049574 | Bacteria | 1336 |
| 491 | Ga0501039_0267449 | 3300049575 | Bacteria | 1344 |
| 492 | Ga0501043_0032205 | 3300049579 | Bacteria | 4121 |
| 493 | Ga0501043_0493989 | 3300049579 | Bacteria | 915 |
| 494 | Ga0501046_0129712 | 3300049580 | Bacteria | 1913 |
| 495 | Ga0501046_0149924 | 3300049580 | Bacteria | 1760 |
| 496 | Ga0501046_0174377 | 3300049580 | Unclassified | 1612 |
| 497 | Ga0501047_0035895 | 3300049581 | Bacteria | 4789 |
| 498 | Ga0501047_0047108 | 3300049581 | Bacteria | 4165 |
| 499 | Ga0501047_0435218 | 3300049581 | Bacteria | 1142 |
| 500 | Ga0501048_0400346 | 3300049582 | Bacteria | 981 |
| 501 | Ga0501067_0030191 | 3300049583 | Bacteria | 3006 |
| 502 | Ga0501067_0141419 | 3300049583 | Bacteria | 1340 |
| 503 | Ga0501068_0748206 | 3300049584 | Bacteria | 640 |
| 504 | Ga0501069_0146412 | 3300049585 | Bacteria | 1356 |
| 505 | Ga0501070_0180710 | 3300049586 | Bacteria | 1736 |
| 506 | Ga0501070_0197486 | 3300049586 | Unclassified | 1652 |
| 507 | Ga0501070_0348200 | 3300049586 | Bacteria | 1203 |
| 508 | Ga0501070_0580235 | 3300049586 | Bacteria | 895 |
| 509 | Ga0501073_0021192 | 3300049589 | Bacteria | 4686 |
| 510 | Ga0501073_0322545 | 3300049589 | Bacteria | 1066 |
| 511 | Ga0501073_0394038 | 3300049589 | Bacteria | 957 |
| 512 | Ga0501073_0479554 | 3300049589 | Unclassified | 860 |
| 513 | Ga0501073_0720508 | 3300049589 | Bacteria | 688 |
| 514 | Ga0501074_0057212 | 3300049590 | Bacteria | 2809 |
| 515 | Ga0501074_0270702 | 3300049590 | Bacteria | 1208 |
| 516 | Ga0501075_0029424 | 3300049591 | Bacteria | 4063 |
| 517 | Ga0501076_0102012 | 3300049592 | Bacteria | 2313 |
| 518 | Ga0501076_0784943 | 3300049592 | Bacteria | 786 |
| 519 | Ga0501077_0008635 | 3300049593 | Bacteria | 6315 |
| 520 | Ga0501079_0023922 | 3300049741 | Bacteria | 4686 |
| 521 | Ga0501079_0462315 | 3300049741 | Bacteria | 997 |
| 522 | Ga0501079_0773910 | 3300049741 | Bacteria | 756 |
| 523 | Ga0501080_0302790 | 3300049742 | Bacteria | 1449 |
| 524 | Ga0501080_0350008 | 3300049742 | Bacteria | 1334 |
| 525 | Ga0501080_0659052 | 3300049742 | Bacteria | 926 |
| 526 | Ga0501081_0000547 | 3300049743 | Bacteria | 21324 |
| 527 | Ga0501081_0659569 | 3300049743 | Bacteria | 784 |
| 528 | Ga0501083_0213967 | 3300049744 | Bacteria | 1256 |
| 529 | Ga0501035_0051750 | 3300049822 | Bacteria | 3675 |
| 530 | Ga0501035_0171861 | 3300049822 | Bacteria | 1872 |
| 531 | Ga0501035_0316061 | 3300049822 | Bacteria | 1313 |
| 532 | Ga0501044_0016928 | 3300049823 | Bacteria | 7821 |
| 533 | Ga0501044_0018287 | 3300049823 | Bacteria | 7511 |
| 534 | Ga0501044_0028057 | 3300049823 | Bacteria | 5941 |
| 535 | Ga0501044_0156073 | 3300049823 | Bacteria | 2262 |
| 536 | Ga0501044_0169111 | 3300049823 | Bacteria | 2158 |
| 537 | Ga0501044_0501132 | 3300049823 | Bacteria | 1115 |
| 538 | Ga0501044_1139556 | 3300049823 | Bacteria | 649 |
| 539 | nmdc:mga06z11_483241_c1 | 3300050494 | Bacteria | 750 |
| 540 | nmdc:mga06z11_93822_c1 | 3300050494 | Bacteria | 1634 |
| 541 | nmdc:mga05p37_17593_c1 | 3300050507 | Bacteria | 8627 |
| 542 | nmdc:mga06r32_251093_c1 | 3300050510 | Bacteria | 1756 |
| 543 | Ga0495601_0104443 | 3300053077 | Bacteria | 1831 |
| 544 | Ga0495601_0245374 | 3300053077 | Bacteria | 1169 |
| 545 | Ga0495612_0016794 | 3300053078 | Bacteria | 2932 |
| 546 | Ga0495612_0025372 | 3300053078 | Bacteria | 2380 |
| 547 | Ga0495612_0135872 | 3300053078 | Bacteria | 1064 |
| 548 | Ga0495595_0117164 | 3300053084 | Bacteria | 1295 |
| 549 | Ga0495619_0107222 | 3300053085 | Bacteria | 1905 |
| 550 | Ga0495619_0192709 | 3300053085 | Bacteria | 1411 |
| 551 | Ga0500566_0044825 | 3300053094 | Bacteria | 2547 |
| 552 | Ga0500608_005972 | 3300053122 | Bacteria | 4904 |
| 553 | Ga0500559_0000426 | 3300053136 | Bacteria | 29970 |
| 554 | Ga0500577_0000470 | 3300053142 | Bacteria | 10444 |
| 555 | Ga0500586_000605 | 3300053145 | Bacteria | 7286 |
| 556 | Ga0500590_048836 | 3300053148 | Bacteria | 2156 |
| 557 | Ga0500636_0002876 | 3300053177 | Bacteria | 9627 |
| 558 | Ga0500636_0054559 | 3300053177 | Bacteria | 2343 |
| 559 | Ga0500637_0233599 | 3300053178 | Bacteria | 1034 |
| 560 | Ga0500611_016474 | 3300053727 | Bacteria | 1329 |
| 561 | Ga0501084_0079799 | 3300054114 | Bacteria | 2743 |
| 562 | Ga0501082_0007481 | 3300060353 | Bacteria | 9425 |
| 563 | Ga0466962_0302444 | 3300061719 | Bacteria | 791 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_0501132 | Ga0501044_0501132_587_1081 | 132 |
| 2 | 3300025254 | Ga0209148_1007942 | Ga0209148_10079422 | 140 |
| 3 | 3300025272 | Ga0209455_1002070 | Ga0209455_100207010 | 140 |
| 4 | 3300049570 | Ga0501033_0103632 | Ga0501033_0103632_523_1095 | 143 |
| 5 | 3300049571 | Ga0501034_0141135 | Ga0501034_0141135_1104_1676 | 143 |
| 6 | 3300049572 | Ga0501036_0017677 | Ga0501036_0017677_2750_3322 | 143 |
| 7 | 3300049573 | Ga0501037_0016122 | Ga0501037_0016122_4400_4972 | 143 |
| 8 | 3300049580 | Ga0501046_0174377 | Ga0501046_0174377_741_1313 | 143 |
| 9 | 3300049581 | Ga0501047_0047108 | Ga0501047_0047108_1750_2322 | 143 |
| 10 | 3300049586 | Ga0501070_0197486 | Ga0501070_0197486_563_1135 | 143 |
| 11 | 3300049589 | Ga0501073_0479554 | Ga0501073_0479554_237_809 | 143 |
| 12 | 3300049822 | Ga0501035_0051750 | Ga0501035_0051750_2868_3440 | 143 |
| 13 | 3300049823 | Ga0501044_0018287 | Ga0501044_0018287_1725_2297 | 143 |
| 14 | 3300046517 | Ga0495630_0178895 | Ga0495630_0178895_39_518 | 144 |
| 15 | 3300048088 | Ga0495602_0182596 | Ga0495602_0182596_1126_1605 | 144 |
| 16 | 3300005536 | Ga0070697_100029029 | Ga0070697_1000290293 | 145 |
| 17 | 3300048921 | Ga0496118_0561641 | Ga0496118_0561641_50_544 | 145 |
| 18 | 3300037853 | Ga0436364_1184315 | Ga0436364_1184315_20_607 | 147 |
| 19 | 3300048924 | Ga0496121_0001251 | Ga0496121_0001251_17810_18385 | 147 |
| 20 | 3300035086 | Ga0373934_0012084 | Ga0373934_0012084_2652_3242 | 148 |
| 21 | 3300035117 | Ga0373953_0132815 | Ga0373953_0132815_64_654 | 148 |
| 22 | 3300035118 | Ga0373954_0058169 | Ga0373954_0058169_365_955 | 148 |
| 23 | 3300035120 | Ga0373957_0027513 | Ga0373957_0027513_234_824 | 148 |
| 24 | 3300035170 | Ga0373943_0058182 | Ga0373943_0058182_380_970 | 148 |
| 25 | 3300035172 | Ga0373955_0060620 | Ga0373955_0060620_1335_1925 | 148 |
| 26 | 3300035410 | Ga0373924_0012052 | Ga0373924_0012052_1585_2175 | 148 |
| 27 | 3300035692 | Ga0373935_0117809 | Ga0373935_0117809_1078_1668 | 148 |
| 28 | 3300035695 | Ga0373927_0044780 | Ga0373927_0044780_1913_2503 | 148 |
| 29 | 3300035724 | Ga0373933_0035577 | Ga0373933_0035577_1428_2018 | 148 |
| 30 | 3300035725 | Ga0373947_0127417 | Ga0373947_0127417_858_1448 | 148 |
| 31 | 3300036401 | Ga0373937_0396503 | Ga0373937_0396503_652_1242 | 148 |
| 32 | 3300037068 | Ga0373925_0030846 | Ga0373925_0030846_1201_1791 | 148 |
| 33 | 3300046454 | Ga0495592_0074932 | Ga0495592_0074932_1152_1742 | 148 |
| 34 | 3300046455 | Ga0495603_0124825 | Ga0495603_0124825_31_621 | 148 |
| 35 | 3300046459 | Ga0495629_0027213 | Ga0495629_0027213_1115_1705 | 148 |
| 36 | 3300046461 | Ga0495641_0094827 | Ga0495641_0094827_292_882 | 148 |
| 37 | 3300046472 | Ga0495580_0029615 | Ga0495580_0029615_420_1010 | 148 |
| 38 | 3300046473 | Ga0495582_0046916 | Ga0495582_0046916_158_748 | 148 |
| 39 | 3300046475 | Ga0495639_0028279 | Ga0495639_0028279_1509_2099 | 148 |
| 40 | 3300046477 | Ga0495664_0027964 | Ga0495664_0027964_2322_2912 | 148 |
| 41 | 3300046499 | Ga0495594_0109855 | Ga0495594_0109855_22_612 | 148 |
| 42 | 3300046516 | Ga0495628_0087783 | Ga0495628_0087783_797_1387 | 148 |
| 43 | 3300046517 | Ga0495630_0446192 | Ga0495630_0446192_153_743 | 148 |
| 44 | 3300046531 | Ga0495665_0078134 | Ga0495665_0078134_866_1456 | 148 |
| 45 | 3300046533 | Ga0495640_0007704 | Ga0495640_0007704_2141_2731 | 148 |
| 46 | 3300046642 | Ga0495634_0113709 | Ga0495634_0113709_1032_1622 | 148 |
| 47 | 3300046663 | Ga0495635_0073028 | Ga0495635_0073028_801_1391 | 148 |
| 48 | 3300046689 | Ga0495613_0141922 | Ga0495613_0141922_49_639 | 148 |
| 49 | 3300047315 | Ga0495581_0057777 | Ga0495581_0057777_1028_1618 | 148 |
| 50 | 3300047317 | Ga0495604_0104206 | Ga0495604_0104206_895_1485 | 148 |
| 51 | 3300047319 | Ga0495674_0004075 | Ga0495674_0004075_898_1488 | 148 |
| 52 | 3300047471 | Ga0495684_0014889 | Ga0495684_0014889_2543_3133 | 148 |
| 53 | 3300047673 | Ga0495593_0042818 | Ga0495593_0042818_49_639 | 148 |
| 54 | 3300049575 | Ga0501039_0267449 | Ga0501039_0267449_123_656 | 148 |
| 55 | 3300049591 | Ga0501075_0029424 | Ga0501075_0029424_1387_1920 | 148 |
| 56 | 3300049592 | Ga0501076_0102012 | Ga0501076_0102012_539_1072 | 148 |
| 57 | 3300049593 | Ga0501077_0008635 | Ga0501077_0008635_4354_4887 | 148 |
| 58 | 3300049741 | Ga0501079_0023922 | Ga0501079_0023922_1673_2206 | 148 |
| 59 | 3300049742 | Ga0501080_0350008 | Ga0501080_0350008_751_1284 | 148 |
| 60 | 3300053077 | Ga0495601_0245374 | Ga0495601_0245374_216_806 | 148 |
| 61 | 3300053078 | Ga0495612_0016794 | Ga0495612_0016794_279_869 | 148 |
| 62 | 3300054114 | Ga0501084_0079799 | Ga0501084_0079799_1258_1791 | 148 |
| 63 | 3300060353 | Ga0501082_0007481 | Ga0501082_0007481_743_1276 | 148 |
| 64 | 3300005471 | Ga0070698_100159902 | Ga0070698_1001599022 | 149 |
| 65 | 3300025903 | Ga0207680_10182612 | Ga0207680_101826121 | 149 |
| 66 | 3300026088 | Ga0207641_10031099 | Ga0207641_100310994 | 149 |
| 67 | iso_pu_bacteria | 2643221651 | 2644290930 | 149 |
| 68 | 3300046477 | Ga0495664_0061528 | Ga0495664_0061528_1402_1989 | 150 |
| 69 | 3300046543 | Ga0495645_0079371 | Ga0495645_0079371_552_1139 | 150 |
| 70 | 3300048091 | Ga0495626_0011452 | Ga0495626_0011452_1764_2357 | 150 |
| 71 | 3300049823 | Ga0501044_0028057 | Ga0501044_0028057_1780_2391 | 150 |
| 72 | 3300053142 | Ga0500577_0000470 | Ga0500577_0000470_1480_2079 | 150 |
| 73 | 3300021388 | Ga0213875_10156079 | Ga0213875_101560792 | 151 |
| 74 | 3300026067 | Ga0207678_10057356 | Ga0207678_100573564 | 151 |
| 75 | 3300035695 | Ga0373927_0048807 | Ga0373927_0048807_1784_2371 | 151 |
| 76 | 3300037853 | Ga0436364_0804363 | Ga0436364_0804363_344_928 | 151 |
| 77 | 3300046557 | Ga0495622_0026296 | Ga0495622_0026296_307_903 | 151 |
| 78 | 3300053078 | Ga0495612_0025372 | Ga0495612_0025372_586_1173 | 151 |
| 79 | 3300053094 | Ga0500566_0044825 | Ga0500566_0044825_1887_2483 | 151 |
| 80 | 3300053122 | Ga0500608_005972 | Ga0500608_005972_2865_3461 | 151 |
| 81 | 3300053136 | Ga0500559_0000426 | Ga0500559_0000426_26404_27000 | 151 |
| 82 | iso_pu_bacteria | 2893066018 | 2893067363 | 151 |
| 83 | iso_pu_bacteria | 2903748898 | 2903748969 | 151 |
| 84 | 3300025261 | Ga0209233_1003764 | Ga0209233_10037643 | 152 |
| 85 | 3300025272 | Ga0209455_1001040 | Ga0209455_100104012 | 152 |
| 86 | 3300028379 | Ga0268266_10379924 | Ga0268266_103799242 | 152 |
| 87 | 3300031911 | Ga0307412_10028363 | Ga0307412_100283632 | 152 |
| 88 | 3300048917 | Ga0496114_0865747 | Ga0496114_0865747_16_516 | 152 |
| 89 | 3300048929 | Ga0496126_0009189 | Ga0496126_0009189_2462_3037 | 152 |
| 90 | 3300005436 | Ga0070713_100786622 | Ga0070713_1007866222 | 153 |
| 91 | 3300005458 | Ga0070681_10040811 | Ga0070681_100408116 | 153 |
| 92 | 3300005545 | Ga0070695_100503778 | Ga0070695_1005037781 | 153 |
| 93 | 3300006881 | Ga0068865_100499235 | Ga0068865_1004992352 | 153 |
| 94 | 3300009093 | Ga0105240_10381810 | Ga0105240_103818102 | 153 |
| 95 | 3300009174 | Ga0105241_10060890 | Ga0105241_100608903 | 153 |
| 96 | 3300010375 | Ga0105239_11838006 | Ga0105239_118380062 | 153 |
| 97 | 3300013104 | Ga0157370_10031834 | Ga0157370_100318342 | 153 |
| 98 | 3300014968 | Ga0157379_10078625 | Ga0157379_100786252 | 153 |
| 99 | 3300025912 | Ga0207707_10032444 | Ga0207707_100324442 | 153 |
| 100 | 3300046523 | Ga0495644_0144809 | Ga0495644_0144809_100_687 | 153 |
| 101 | 3300048910 | Ga0496107_0042406 | Ga0496107_0042406_2469_3065 | 153 |
| 102 | 3300048911 | Ga0496108_0409640 | Ga0496108_0409640_181_777 | 153 |
| 103 | 3300048912 | Ga0496109_0423681 | Ga0496109_0423681_233_829 | 153 |
| 104 | 3300049823 | Ga0501044_1139556 | Ga0501044_1139556_20_592 | 153 |
| 105 | 3300025915 | Ga0207693_10010186 | Ga0207693_100101863 | 154 |
| 106 | 3300048927 | Ga0496124_0534521 | Ga0496124_0534521_52_654 | 154 |
| 107 | 3300048929 | Ga0496126_0009570 | Ga0496126_0009570_5181_5756 | 154 |
| 108 | 3300048929 | Ga0496126_0039133 | Ga0496126_0039133_552_1133 | 154 |
| 109 | 3300049574 | Ga0501038_0202359 | Ga0501038_0202359_128_700 | 154 |
| 110 | 3300049584 | Ga0501068_0748206 | Ga0501068_0748206_15_548 | 154 |
| 111 | 3300049590 | Ga0501074_0057212 | Ga0501074_0057212_2199_2780 | 154 |
| 112 | 3300049743 | Ga0501081_0000547 | Ga0501081_0000547_10250_10783 | 154 |
| 113 | 3300053177 | Ga0500636_0054559 | Ga0500636_0054559_975_1586 | 154 |
| 114 | iso_pu_bacteria | 2643221623 | 2644133960 | 154 |
| 115 | iso_pu_bacteria | 2738543024 | 2739310282 | 154 |
| 116 | iso_pu_bacteria | 8002285264 | 8002286362 | 154 |
| 117 | 3300005336 | Ga0070680_100159670 | Ga0070680_1001596702 | 155 |
| 118 | 3300005337 | Ga0070682_100009413 | Ga0070682_1000094136 | 155 |
| 119 | 3300005455 | Ga0070663_100722612 | Ga0070663_1007226122 | 155 |
| 120 | 3300005530 | Ga0070679_100008944 | Ga0070679_10000894411 | 155 |
| 121 | 3300005539 | Ga0068853_100002614 | Ga0068853_1000026145 | 155 |
| 122 | 3300005547 | Ga0070693_100008395 | Ga0070693_1000083955 | 155 |
| 123 | 3300005937 | Ga0081455_10019063 | Ga0081455_100190638 | 155 |
| 124 | 3300006358 | Ga0068871_100074487 | Ga0068871_1000744872 | 155 |
| 125 | 3300009545 | Ga0105237_10088220 | Ga0105237_100882203 | 155 |
| 126 | 3300013100 | Ga0157373_10013772 | Ga0157373_100137724 | 155 |
| 127 | 3300017792 | Ga0163161_10799517 | Ga0163161_107995172 | 155 |
| 128 | 3300021384 | Ga0213876_10063105 | Ga0213876_100631052 | 155 |
| 129 | 3300025900 | Ga0207710_10077570 | Ga0207710_100775702 | 155 |
| 130 | 3300025914 | Ga0207671_10055238 | Ga0207671_100552383 | 155 |
| 131 | 3300025917 | Ga0207660_10074055 | Ga0207660_100740552 | 155 |
| 132 | 3300025949 | Ga0207667_10449228 | Ga0207667_104492282 | 155 |
| 133 | 3300026041 | Ga0207639_10001161 | Ga0207639_1000116113 | 155 |
| 134 | 3300035691 | Ga0373931_0667910 | Ga0373931_0667910_49_645 | 155 |
| 135 | 3300039437 | Ga0436365_1262081 | Ga0436365_1262081_70_645 | 155 |
| 136 | 3300048908 | Ga0496105_0014585 | Ga0496105_0014585_202_798 | 155 |
| 137 | 3300048927 | Ga0496124_0120621 | Ga0496124_0120621_314_904 | 155 |
| 138 | 3300003322 | rootL2_10340743 | rootL2_103407432 | 156 |
| 139 | 3300005530 | Ga0070679_100768417 | Ga0070679_1007684171 | 156 |
| 140 | 3300005539 | Ga0068853_100147859 | Ga0068853_1001478592 | 156 |
| 141 | 3300005617 | Ga0068859_100231042 | Ga0068859_1002310421 | 156 |
| 142 | 3300006931 | Ga0097620_100231042 | Ga0097620_1002310421 | 156 |
| 143 | 3300009177 | Ga0105248_10026101 | Ga0105248_100261012 | 156 |
| 144 | 3300009553 | Ga0105249_10112128 | Ga0105249_101121282 | 156 |
| 145 | 3300021361 | Ga0213872_10033863 | Ga0213872_100338632 | 156 |
| 146 | 3300025961 | Ga0207712_10187728 | Ga0207712_101877282 | 156 |
| 147 | 3300026035 | Ga0207703_10798758 | Ga0207703_107987581 | 156 |
| 148 | 3300035691 | Ga0373931_0144472 | Ga0373931_0144472_23_619 | 156 |
| 149 | 3300039447 | Ga0436361_0348492 | Ga0436361_0348492_943_1542 | 156 |
| 150 | 3300048906 | Ga0496103_0026151 | Ga0496103_0026151_1797_2393 | 156 |
| 151 | 3300048929 | Ga0496126_0012762 | Ga0496126_0012762_5774_6367 | 156 |
| 152 | 3300049570 | Ga0501033_0235396 | Ga0501033_0235396_41_652 | 156 |
| 153 | 3300049571 | Ga0501034_0789700 | Ga0501034_0789700_140_751 | 156 |
| 154 | 3300049582 | Ga0501048_0400346 | Ga0501048_0400346_350_961 | 156 |
| 155 | 3300049743 | Ga0501081_0659569 | Ga0501081_0659569_187_729 | 156 |
| 156 | 3300005339 | Ga0070660_100466759 | Ga0070660_1004667592 | 157 |
| 157 | 3300005366 | Ga0070659_100018629 | Ga0070659_1000186297 | 157 |
| 158 | 3300005434 | Ga0070709_10077124 | Ga0070709_100771242 | 157 |
| 159 | 3300005437 | Ga0070710_10007182 | Ga0070710_100071822 | 157 |
| 160 | 3300025253 | Ga0209677_102510 | Ga0209677_1025103 | 157 |
| 161 | 3300025295 | Ga0209564_1000321 | Ga0209564_100032138 | 157 |
| 162 | 3300025915 | Ga0207693_10006870 | Ga0207693_100068705 | 157 |
| 163 | 3300025919 | Ga0207657_10417169 | Ga0207657_104171692 | 157 |
| 164 | 3300025932 | Ga0207690_10029000 | Ga0207690_100290004 | 157 |
| 165 | 3300025949 | Ga0207667_10041162 | Ga0207667_100411625 | 157 |
| 166 | 3300031238 | Ga0265332_10067376 | Ga0265332_100673762 | 157 |
| 167 | 3300031241 | Ga0265325_10007580 | Ga0265325_100075802 | 157 |
| 168 | 3300031250 | Ga0265331_10092647 | Ga0265331_100926472 | 157 |
| 169 | 3300031711 | Ga0265314_10075262 | Ga0265314_100752621 | 157 |
| 170 | 3300031712 | Ga0265342_10089155 | Ga0265342_100891552 | 157 |
| 171 | 3300045976 | Ga0466967_0080769 | Ga0466967_0080769_1059_1637 | 157 |
| 172 | 3300046473 | Ga0495582_0332741 | Ga0495582_0332741_74_667 | 157 |
| 173 | 3300046683 | Ga0495658_0492310 | Ga0495658_0492310_87_680 | 157 |
| 174 | 3300048929 | Ga0496126_0114722 | Ga0496126_0114722_470_1054 | 157 |
| 175 | 3300048929 | Ga0496126_0383587 | Ga0496126_0383587_406_1005 | 157 |
| 176 | 3300049574 | Ga0501038_0271795 | Ga0501038_0271795_263_874 | 157 |
| 177 | 3300053145 | Ga0500586_000605 | Ga0500586_000605_901_1494 | 157 |
| 178 | 3300005439 | Ga0070711_100096489 | Ga0070711_1000964892 | 158 |
| 179 | 3300005983 | Ga0081540_1042824 | Ga0081540_10428242 | 158 |
| 180 | 3300006844 | Ga0075428_100028368 | Ga0075428_1000283686 | 158 |
| 181 | 3300009094 | Ga0111539_11754008 | Ga0111539_117540081 | 158 |
| 182 | 3300009147 | Ga0114129_10030378 | Ga0114129_100303789 | 158 |
| 183 | 3300021377 | Ga0213874_10100383 | Ga0213874_101003832 | 158 |
| 184 | 3300025916 | Ga0207663_10159321 | Ga0207663_101593212 | 158 |
| 185 | 3300027671 | Ga0209588_1014784 | Ga0209588_10147841 | 158 |
| 186 | 3300031711 | Ga0265314_10051931 | Ga0265314_100519312 | 158 |
| 187 | 3300031712 | Ga0265342_10087584 | Ga0265342_100875841 | 158 |
| 188 | 3300033180 | Ga0307510_10082383 | Ga0307510_100823833 | 158 |
| 189 | 3300036401 | Ga0373937_0207495 | Ga0373937_0207495_329_922 | 158 |
| 190 | 3300037466 | Ga0395898_1094820 | Ga0395898_1094820_119_679 | 158 |
| 191 | 3300037853 | Ga0436364_1330873 | Ga0436364_1330873_366_950 | 158 |
| 192 | 3300039450 | Ga0436363_0585583 | Ga0436363_0585583_275_874 | 158 |
| 193 | 3300049583 | Ga0501067_0030191 | Ga0501067_0030191_758_1342 | 158 |
| 194 | 3300049589 | Ga0501073_0394038 | Ga0501073_0394038_225_809 | 158 |
| 195 | 3300050507 | nmdc:mga05p37_17593_c1 | nmdc:mga05p37_17593_c1_1677_2234 | 158 |
| 196 | 3300050510 | nmdc:mga06r32_251093_c1 | nmdc:mga06r32_251093_c1_671_1228 | 158 |
| 197 | 3300005983 | Ga0081540_1027038 | Ga0081540_10270383 | 159 |
| 198 | 3300006028 | Ga0070717_10500171 | Ga0070717_105001711 | 159 |
| 199 | 3300006178 | Ga0075367_10144805 | Ga0075367_101448052 | 159 |
| 200 | 3300025295 | Ga0209564_1021625 | Ga0209564_10216252 | 159 |
| 201 | 3300046660 | Ga0495625_0117372 | Ga0495625_0117372_621_1220 | 159 |
| 202 | 3300048915 | Ga0496112_0014598 | Ga0496112_0014598_1319_1906 | 159 |
| 203 | 3300048915 | Ga0496112_0017956 | Ga0496112_0017956_403_981 | 159 |
| 204 | 3300048919 | Ga0496116_0007249 | Ga0496116_0007249_5259_5855 | 159 |
| 205 | 3300048920 | Ga0496117_0061528 | Ga0496117_0061528_1750_2337 | 159 |
| 206 | 3300048921 | Ga0496118_0006290 | Ga0496118_0006290_2911_3498 | 159 |
| 207 | 3300048924 | Ga0496121_0011522 | Ga0496121_0011522_8925_9512 | 159 |
| 208 | 3300048924 | Ga0496121_0205422 | Ga0496121_0205422_52_642 | 159 |
| 209 | 3300050494 | nmdc:mga06z11_93822_c1 | nmdc:mga06z11_93822_c1_717_1313 | 159 |
| 210 | 3300053727 | Ga0500611_016474 | Ga0500611_016474_436_1035 | 159 |
| 211 | 3300003320 | rootH2_10225439 | rootH2_102254392 | 160 |
| 212 | 3300005327 | Ga0070658_10053528 | Ga0070658_100535283 | 160 |
| 213 | 3300005329 | Ga0070683_100008779 | Ga0070683_10000877910 | 160 |
| 214 | 3300005336 | Ga0070680_100021698 | Ga0070680_1000216984 | 160 |
| 215 | 3300005339 | Ga0070660_100002843 | Ga0070660_1000028438 | 160 |
| 216 | 3300005341 | Ga0070691_10086145 | Ga0070691_100861452 | 160 |
| 217 | 3300005458 | Ga0070681_10048927 | Ga0070681_100489274 | 160 |
| 218 | 3300005530 | Ga0070679_100041621 | Ga0070679_1000416212 | 160 |
| 219 | 3300005535 | Ga0070684_100006680 | Ga0070684_10000668010 | 160 |
| 220 | 3300005539 | Ga0068853_100002454 | Ga0068853_10000245415 | 160 |
| 221 | 3300005563 | Ga0068855_100006336 | Ga0068855_10000633612 | 160 |
| 222 | 3300005577 | Ga0068857_100017087 | Ga0068857_1000170872 | 160 |
| 223 | 3300005577 | Ga0068857_101121740 | Ga0068857_1011217402 | 160 |
| 224 | 3300005616 | Ga0068852_100040747 | Ga0068852_1000407473 | 160 |
| 225 | 3300009093 | Ga0105240_10059068 | Ga0105240_100590683 | 160 |
| 226 | 3300009545 | Ga0105237_10008146 | Ga0105237_100081464 | 160 |
| 227 | 3300010375 | Ga0105239_10023840 | Ga0105239_100238408 | 160 |
| 228 | 3300013105 | Ga0157369_10001511 | Ga0157369_1000151122 | 160 |
| 229 | 3300021377 | Ga0213874_10079472 | Ga0213874_100794722 | 160 |
| 230 | 3300025909 | Ga0207705_10147708 | Ga0207705_101477082 | 160 |
| 231 | 3300025912 | Ga0207707_10004287 | Ga0207707_1000428711 | 160 |
| 232 | 3300025913 | Ga0207695_10015308 | Ga0207695_100153085 | 160 |
| 233 | 3300025914 | Ga0207671_10009240 | Ga0207671_100092402 | 160 |
| 234 | 3300025917 | Ga0207660_10001366 | Ga0207660_100013666 | 160 |
| 235 | 3300025919 | Ga0207657_10001686 | Ga0207657_1000168610 | 160 |
| 236 | 3300025920 | Ga0207649_10030607 | Ga0207649_100306072 | 160 |
| 237 | 3300025921 | Ga0207652_10001889 | Ga0207652_100018892 | 160 |
| 238 | 3300025944 | Ga0207661_10007064 | Ga0207661_100070642 | 160 |
| 239 | 3300025949 | Ga0207667_10002324 | Ga0207667_1000232417 | 160 |
| 240 | 3300026041 | Ga0207639_10018895 | Ga0207639_100188952 | 160 |
| 241 | 3300026116 | Ga0207674_10042259 | Ga0207674_100422593 | 160 |
| 242 | 3300026142 | Ga0207698_10119810 | Ga0207698_101198102 | 160 |
| 243 | 3300031456 | Ga0307513_10484819 | Ga0307513_104848191 | 160 |
| 244 | 3300035118 | Ga0373954_0030161 | Ga0373954_0030161_1357_1959 | 160 |
| 245 | 3300049574 | Ga0501038_0025760 | Ga0501038_0025760_4405_4986 | 160 |
| 246 | 3300049583 | Ga0501067_0141419 | Ga0501067_0141419_507_1070 | 160 |
| 247 | 3300049589 | Ga0501073_0322545 | Ga0501073_0322545_267_848 | 160 |
| 248 | 3300053148 | Ga0500590_048836 | Ga0500590_048836_1093_1689 | 160 |
| 249 | 3300053177 | Ga0500636_0002876 | Ga0500636_0002876_7334_7930 | 160 |
| 250 | 3300061719 | Ga0466962_0302444 | Ga0466962_0302444_80_667 | 160 |
| 251 | 3300031249 | Ga0265339_10283210 | Ga0265339_102832102 | 161 |
| 252 | 3300041509 | Ga0451843_0100938 | Ga0451843_0100938_225_821 | 161 |
| 253 | 3300046462 | Ga0495651_0066225 | Ga0495651_0066225_1899_2498 | 161 |
| 254 | 3300046472 | Ga0495580_0121568 | Ga0495580_0121568_30_560 | 161 |
| 255 | 3300046517 | Ga0495630_0288859 | Ga0495630_0288859_660_1223 | 161 |
| 256 | 3300046536 | Ga0495587_0268912 | Ga0495587_0268912_276_842 | 161 |
| 257 | 3300046679 | Ga0495623_0061076 | Ga0495623_0061076_1596_2195 | 161 |
| 258 | 3300048904 | Ga0496101_0276283 | Ga0496101_0276283_522_1112 | 161 |
| 259 | 3300048924 | Ga0496121_0235297 | Ga0496121_0235297_228_818 | 161 |
| 260 | 3300048929 | Ga0496126_0131444 | Ga0496126_0131444_1092_1682 | 161 |
| 261 | 3300005539 | Ga0068853_100120254 | Ga0068853_1001202542 | 162 |
| 262 | 3300013104 | Ga0157370_10192063 | Ga0157370_101920632 | 162 |
| 263 | 3300013105 | Ga0157369_10003829 | Ga0157369_100038295 | 162 |
| 264 | 3300025904 | Ga0207647_10262530 | Ga0207647_102625302 | 162 |
| 265 | 3300025906 | Ga0207699_10017128 | Ga0207699_100171282 | 162 |
| 266 | 3300025913 | Ga0207695_10150514 | Ga0207695_101505142 | 162 |
| 267 | 3300025939 | Ga0207665_10027297 | Ga0207665_100272972 | 162 |
| 268 | 3300026041 | Ga0207639_10091736 | Ga0207639_100917362 | 162 |
| 269 | 3300036401 | Ga0373937_0103533 | Ga0373937_0103533_1704_2231 | 162 |
| 270 | 3300037068 | Ga0373925_0016468 | Ga0373925_0016468_1398_1991 | 162 |
| 271 | 3300037068 | Ga0373925_0756652 | Ga0373925_0756652_29_628 | 162 |
| 272 | 3300046462 | Ga0495651_0074316 | Ga0495651_0074316_1757_2284 | 162 |
| 273 | 3300046675 | Ga0495657_0188178 | Ga0495657_0188178_682_1209 | 162 |
| 274 | 3300048918 | Ga0496115_0443847 | Ga0496115_0443847_23_616 | 162 |
| 275 | 3300049571 | Ga0501034_0068618 | Ga0501034_0068618_2275_2856 | 162 |
| 276 | 3300005937 | Ga0081455_10003646 | Ga0081455_1000364613 | 163 |
| 277 | 3300005937 | Ga0081455_10268756 | Ga0081455_102687562 | 163 |
| 278 | 3300014325 | Ga0163163_11445652 | Ga0163163_114456521 | 163 |
| 279 | 3300014969 | Ga0157376_11270606 | Ga0157376_112706062 | 163 |
| 280 | 3300025916 | Ga0207663_10533530 | Ga0207663_105335301 | 163 |
| 281 | 3300045976 | Ga0466967_0295084 | Ga0466967_0295084_354_932 | 163 |
| 282 | 3300046690 | Ga0495624_0199394 | Ga0495624_0199394_314_904 | 163 |
| 283 | 3300048924 | Ga0496121_0038959 | Ga0496121_0038959_3343_3951 | 163 |
| 284 | 3300005327 | Ga0070658_10303827 | Ga0070658_103038272 | 164 |
| 285 | 3300005329 | Ga0070683_100140016 | Ga0070683_1001400162 | 164 |
| 286 | 3300005331 | Ga0070670_100293900 | Ga0070670_1002939002 | 164 |
| 287 | 3300005338 | Ga0068868_100019259 | Ga0068868_1000192592 | 164 |
| 288 | 3300005355 | Ga0070671_100520918 | Ga0070671_1005209182 | 164 |
| 289 | 3300005364 | Ga0070673_100326205 | Ga0070673_1003262052 | 164 |
| 290 | 3300005364 | Ga0070673_100381686 | Ga0070673_1003816862 | 164 |
| 291 | 3300005436 | Ga0070713_100062589 | Ga0070713_1000625893 | 164 |
| 292 | 3300005436 | Ga0070713_100342146 | Ga0070713_1003421462 | 164 |
| 293 | 3300005455 | Ga0070663_100001666 | Ga0070663_1000016667 | 164 |
| 294 | 3300005456 | Ga0070678_100055673 | Ga0070678_1000556733 | 164 |
| 295 | 3300005466 | Ga0070685_10403969 | Ga0070685_104039692 | 164 |
| 296 | 3300005535 | Ga0070684_100606735 | Ga0070684_1006067351 | 164 |
| 297 | 3300005539 | Ga0068853_100081722 | Ga0068853_1000817222 | 164 |
| 298 | 3300005564 | Ga0070664_100052242 | Ga0070664_1000522422 | 164 |
| 299 | 3300005616 | Ga0068852_100080223 | Ga0068852_1000802232 | 164 |
| 300 | 3300005834 | Ga0068851_10222223 | Ga0068851_102222232 | 164 |
| 301 | 3300005840 | Ga0068870_10496638 | Ga0068870_104966381 | 164 |
| 302 | 3300006175 | Ga0070712_100175883 | Ga0070712_1001758831 | 164 |
| 303 | 3300006237 | Ga0097621_100147183 | Ga0097621_1001471832 | 164 |
| 304 | 3300006881 | Ga0068865_100043307 | Ga0068865_1000433073 | 164 |
| 305 | 3300009098 | Ga0105245_10027626 | Ga0105245_100276261 | 164 |
| 306 | 3300009148 | Ga0105243_10581901 | Ga0105243_105819012 | 164 |
| 307 | 3300009177 | Ga0105248_11591516 | Ga0105248_115915161 | 164 |
| 308 | 3300009545 | Ga0105237_10155815 | Ga0105237_101558152 | 164 |
| 309 | 3300010375 | Ga0105239_10025568 | Ga0105239_100255686 | 164 |
| 310 | 3300011119 | Ga0105246_10005044 | Ga0105246_100050448 | 164 |
| 311 | 3300013296 | Ga0157374_10032796 | Ga0157374_100327962 | 164 |
| 312 | 3300013306 | Ga0163162_10073409 | Ga0163162_100734093 | 164 |
| 313 | 3300014325 | Ga0163163_10097005 | Ga0163163_100970052 | 164 |
| 314 | 3300014968 | Ga0157379_10573455 | Ga0157379_105734552 | 164 |
| 315 | 3300014969 | Ga0157376_10017080 | Ga0157376_100170803 | 164 |
| 316 | 3300025901 | Ga0207688_10156875 | Ga0207688_101568752 | 164 |
| 317 | 3300025908 | Ga0207643_10634306 | Ga0207643_106343061 | 164 |
| 318 | 3300025914 | Ga0207671_10196493 | Ga0207671_101964932 | 164 |
| 319 | 3300025915 | Ga0207693_10033379 | Ga0207693_100333793 | 164 |
| 320 | 3300025920 | Ga0207649_10154429 | Ga0207649_101544292 | 164 |
| 321 | 3300025925 | Ga0207650_10308617 | Ga0207650_103086172 | 164 |
| 322 | 3300025928 | Ga0207700_10209738 | Ga0207700_102097382 | 164 |
| 323 | 3300025931 | Ga0207644_10493923 | Ga0207644_104939232 | 164 |
| 324 | 3300025935 | Ga0207709_10435986 | Ga0207709_104359862 | 164 |
| 325 | 3300025937 | Ga0207669_10923180 | Ga0207669_109231802 | 164 |
| 326 | 3300025938 | Ga0207704_10204239 | Ga0207704_102042392 | 164 |
| 327 | 3300025940 | Ga0207691_10434778 | Ga0207691_104347782 | 164 |
| 328 | 3300025944 | Ga0207661_10079544 | Ga0207661_100795442 | 164 |
| 329 | 3300025960 | Ga0207651_10286449 | Ga0207651_102864492 | 164 |
| 330 | 3300026023 | Ga0207677_10186551 | Ga0207677_101865512 | 164 |
| 331 | 3300026067 | Ga0207678_10004832 | Ga0207678_1000483211 | 164 |
| 332 | 3300026121 | Ga0207683_10065230 | Ga0207683_100652302 | 164 |
| 333 | 3300026121 | Ga0207683_10121753 | Ga0207683_101217532 | 164 |
| 334 | 3300026142 | Ga0207698_10225416 | Ga0207698_102254162 | 164 |
| 335 | 3300036534 | Ga0310109_032717 | Ga0310109_032717_35_616 | 164 |
| 336 | 3300041512 | Ga0451853_0145000 | Ga0451853_0145000_20_619 | 164 |
| 337 | 3300046455 | Ga0495603_0053181 | Ga0495603_0053181_866_1459 | 164 |
| 338 | 3300046477 | Ga0495664_0085857 | Ga0495664_0085857_619_1215 | 164 |
| 339 | 3300046507 | Ga0495606_0283901 | Ga0495606_0283901_190_789 | 164 |
| 340 | 3300046531 | Ga0495665_0226831 | Ga0495665_0226831_249_842 | 164 |
| 341 | 3300046674 | Ga0495588_0026270 | Ga0495588_0026270_1899_2492 | 164 |
| 342 | 3300046680 | Ga0495646_0219014 | Ga0495646_0219014_57_656 | 164 |
| 343 | 3300047315 | Ga0495581_0013345 | Ga0495581_0013345_1839_2432 | 164 |
| 344 | 3300048903 | Ga0496100_0009441 | Ga0496100_0009441_407_1006 | 164 |
| 345 | 3300048906 | Ga0496103_0013725 | Ga0496103_0013725_562_1161 | 164 |
| 346 | 3300048907 | Ga0496104_0959185 | Ga0496104_0959185_92_691 | 164 |
| 347 | 3300048908 | Ga0496105_0173428 | Ga0496105_0173428_1080_1679 | 164 |
| 348 | 3300048909 | Ga0496106_0001014 | Ga0496106_0001014_12747_13346 | 164 |
| 349 | 3300048910 | Ga0496107_0017012 | Ga0496107_0017012_4055_4654 | 164 |
| 350 | 3300048913 | Ga0496110_0042757 | Ga0496110_0042757_1143_1742 | 164 |
| 351 | 3300048914 | Ga0496111_0006861 | Ga0496111_0006861_3938_4537 | 164 |
| 352 | 3300048915 | Ga0496112_0000020 | Ga0496112_0000020_70428_71009 | 164 |
| 353 | 3300048916 | Ga0496113_0173056 | Ga0496113_0173056_184_783 | 164 |
| 354 | 3300048918 | Ga0496115_0006071 | Ga0496115_0006071_6777_7376 | 164 |
| 355 | 3300049568 | Ga0501031_0068936 | Ga0501031_0068936_17_571 | 164 |
| 356 | 3300049569 | Ga0501032_0029896 | Ga0501032_0029896_2129_2683 | 164 |
| 357 | 3300049571 | Ga0501034_0259298 | Ga0501034_0259298_527_1081 | 164 |
| 358 | 3300049573 | Ga0501037_0029001 | Ga0501037_0029001_2397_2951 | 164 |
| 359 | 3300049574 | Ga0501038_0004781 | Ga0501038_0004781_7448_8002 | 164 |
| 360 | 3300049579 | Ga0501043_0032205 | Ga0501043_0032205_111_665 | 164 |
| 361 | 3300049580 | Ga0501046_0129712 | Ga0501046_0129712_353_907 | 164 |
| 362 | 3300049581 | Ga0501047_0035895 | Ga0501047_0035895_756_1310 | 164 |
| 363 | 3300049581 | Ga0501047_0435218 | Ga0501047_0435218_233_814 | 164 |
| 364 | 3300049589 | Ga0501073_0021192 | Ga0501073_0021192_959_1513 | 164 |
| 365 | 3300049742 | Ga0501080_0302790 | Ga0501080_0302790_601_1155 | 164 |
| 366 | 3300049744 | Ga0501083_0213967 | Ga0501083_0213967_318_872 | 164 |
| 367 | 3300049823 | Ga0501044_0016928 | Ga0501044_0016928_3577_4131 | 164 |
| 368 | 3300006942 | Ga0099824_1011583 | Ga0099824_10115835 | 165 |
| 369 | 3300025981 | Ga0207640_10007128 | Ga0207640_100071287 | 165 |
| 370 | 3300031616 | Ga0307508_10000002 | Ga0307508_1000000258 | 165 |
| 371 | 3300039447 | Ga0436361_0960028 | Ga0436361_0960028_743_1327 | 165 |
| 372 | 3300046524 | Ga0495648_0000286 | Ga0495648_0000286_19037_19633 | 165 |
| 373 | 3300046660 | Ga0495625_0509150 | Ga0495625_0509150_189_725 | 165 |
| 374 | 3300005456 | Ga0070678_100040432 | Ga0070678_1000404322 | 166 |
| 375 | 3300006358 | Ga0068871_100518607 | Ga0068871_1005186072 | 166 |
| 376 | 3300026121 | Ga0207683_10080956 | Ga0207683_100809562 | 166 |
| 377 | 3300035170 | Ga0373943_0125811 | Ga0373943_0125811_411_1007 | 166 |
| 378 | 3300048913 | Ga0496110_0143414 | Ga0496110_0143414_1495_2091 | 166 |
| 379 | 3300049570 | Ga0501033_0029329 | Ga0501033_0029329_1127_1738 | 166 |
| 380 | 3300049585 | Ga0501069_0146412 | Ga0501069_0146412_259_840 | 166 |
| 381 | 3300049822 | Ga0501035_0171861 | Ga0501035_0171861_172_753 | 166 |
| 382 | 3300049822 | Ga0501035_0316061 | Ga0501035_0316061_232_843 | 166 |
| 383 | iso_pu_bacteria | 2842694124 | 2842695522 | 166 |
| 384 | 3300005840 | Ga0068870_10221503 | Ga0068870_102215032 | 167 |
| 385 | 3300006038 | Ga0075365_10178424 | Ga0075365_101784242 | 167 |
| 386 | 3300035089 | Ga0373944_0094719 | Ga0373944_0094719_258_857 | 167 |
| 387 | 3300049580 | Ga0501046_0149924 | Ga0501046_0149924_429_1019 | 167 |
| 388 | iso_pu_bacteria | 8056681323 | 8056687408 | 167 |
| 389 | 3300031507 | Ga0307509_10349367 | Ga0307509_103493672 | 168 |
| 390 | 3300035083 | Ga0373926_0088473 | Ga0373926_0088473_173_775 | 168 |
| 391 | 3300035089 | Ga0373944_0074090 | Ga0373944_0074090_257_859 | 168 |
| 392 | 3300035113 | Ga0373936_0030834 | Ga0373936_0030834_388_990 | 168 |
| 393 | 3300035116 | Ga0373945_0049250 | Ga0373945_0049250_644_1246 | 168 |
| 394 | 3300035117 | Ga0373953_0057059 | Ga0373953_0057059_269_871 | 168 |
| 395 | 3300035120 | Ga0373957_0052708 | Ga0373957_0052708_647_1249 | 168 |
| 396 | 3300035170 | Ga0373943_0005777 | Ga0373943_0005777_2971_3573 | 168 |
| 397 | 3300035171 | Ga0373946_0003273 | Ga0373946_0003273_2552_3154 | 168 |
| 398 | 3300035172 | Ga0373955_0003039 | Ga0373955_0003039_4360_4962 | 168 |
| 399 | 3300035410 | Ga0373924_0068403 | Ga0373924_0068403_404_1006 | 168 |
| 400 | 3300035692 | Ga0373935_0000953 | Ga0373935_0000953_4852_5454 | 168 |
| 401 | 3300035695 | Ga0373927_0001486 | Ga0373927_0001486_9373_9975 | 168 |
| 402 | 3300035724 | Ga0373933_0071544 | Ga0373933_0071544_467_1069 | 168 |
| 403 | 3300035725 | Ga0373947_0077646 | Ga0373947_0077646_690_1292 | 168 |
| 404 | 3300037068 | Ga0373925_0024914 | Ga0373925_0024914_2752_3354 | 168 |
| 405 | 3300046454 | Ga0495592_0023331 | Ga0495592_0023331_2107_2709 | 168 |
| 406 | 3300046455 | Ga0495603_0000047 | Ga0495603_0000047_21930_22532 | 168 |
| 407 | 3300046459 | Ga0495629_0000320 | Ga0495629_0000320_21905_22507 | 168 |
| 408 | 3300046461 | Ga0495641_0003618 | Ga0495641_0003618_9336_9938 | 168 |
| 409 | 3300046462 | Ga0495651_0490154 | Ga0495651_0490154_91_693 | 168 |
| 410 | 3300046472 | Ga0495580_0003812 | Ga0495580_0003812_9280_9882 | 168 |
| 411 | 3300046473 | Ga0495582_0000043 | Ga0495582_0000043_53877_54479 | 168 |
| 412 | 3300046475 | Ga0495639_0000091 | Ga0495639_0000091_29469_30071 | 168 |
| 413 | 3300046499 | Ga0495594_0000453 | Ga0495594_0000453_11763_12365 | 168 |
| 414 | 3300046511 | Ga0495608_0290544 | Ga0495608_0290544_378_980 | 168 |
| 415 | 3300046514 | Ga0495618_0051506 | Ga0495618_0051506_1005_1607 | 168 |
| 416 | 3300046516 | Ga0495628_0035958 | Ga0495628_0035958_2822_3424 | 168 |
| 417 | 3300046517 | Ga0495630_0008996 | Ga0495630_0008996_839_1441 | 168 |
| 418 | 3300046526 | Ga0495666_0010714 | Ga0495666_0010714_2489_3091 | 168 |
| 419 | 3300046529 | Ga0495652_0023709 | Ga0495652_0023709_84_686 | 168 |
| 420 | 3300046531 | Ga0495665_0001635 | Ga0495665_0001635_7037_7639 | 168 |
| 421 | 3300046533 | Ga0495640_0014392 | Ga0495640_0014392_5099_5701 | 168 |
| 422 | 3300046535 | Ga0495586_0083487 | Ga0495586_0083487_494_1096 | 168 |
| 423 | 3300046557 | Ga0495622_0002785 | Ga0495622_0002785_2929_3531 | 168 |
| 424 | 3300046559 | Ga0495667_0033079 | Ga0495667_0033079_1614_2216 | 168 |
| 425 | 3300046642 | Ga0495634_0007159 | Ga0495634_0007159_4233_4835 | 168 |
| 426 | 3300046663 | Ga0495635_0001788 | Ga0495635_0001788_7604_8206 | 168 |
| 427 | 3300046674 | Ga0495588_0090752 | Ga0495588_0090752_211_813 | 168 |
| 428 | 3300046681 | Ga0495647_0001913 | Ga0495647_0001913_2649_3251 | 168 |
| 429 | 3300046683 | Ga0495658_0003457 | Ga0495658_0003457_182_784 | 168 |
| 430 | 3300046689 | Ga0495613_0001794 | Ga0495613_0001794_7111_7713 | 168 |
| 431 | 3300046690 | Ga0495624_0000694 | Ga0495624_0000694_17483_18085 | 168 |
| 432 | 3300047315 | Ga0495581_0000486 | Ga0495581_0000486_15406_16008 | 168 |
| 433 | 3300047317 | Ga0495604_0135425 | Ga0495604_0135425_1048_1650 | 168 |
| 434 | 3300047319 | Ga0495674_0003925 | Ga0495674_0003925_9596_10198 | 168 |
| 435 | 3300047321 | Ga0495676_0017241 | Ga0495676_0017241_1578_2180 | 168 |
| 436 | 3300047673 | Ga0495593_0000005 | Ga0495593_0000005_17421_18023 | 168 |
| 437 | 3300048089 | Ga0495614_0067842 | Ga0495614_0067842_519_1121 | 168 |
| 438 | 3300048917 | Ga0496114_0121382 | Ga0496114_0121382_945_1523 | 168 |
| 439 | 3300048918 | Ga0496115_0008492 | Ga0496115_0008492_567_1160 | 168 |
| 440 | 3300048918 | Ga0496115_0106653 | Ga0496115_0106653_1522_2100 | 168 |
| 441 | 3300048929 | Ga0496126_0146376 | Ga0496126_0146376_575_1153 | 168 |
| 442 | 3300048929 | Ga0496126_0703885 | Ga0496126_0703885_66_659 | 168 |
| 443 | 3300049568 | Ga0501031_0653368 | Ga0501031_0653368_19_612 | 168 |
| 444 | 3300049571 | Ga0501034_0112843 | Ga0501034_0112843_38_631 | 168 |
| 445 | 3300049579 | Ga0501043_0493989 | Ga0501043_0493989_73_666 | 168 |
| 446 | 3300049586 | Ga0501070_0180710 | Ga0501070_0180710_337_930 | 168 |
| 447 | 3300049823 | Ga0501044_0169111 | Ga0501044_0169111_508_1101 | 168 |
| 448 | 3300050494 | nmdc:mga06z11_483241_c1 | nmdc:mga06z11_483241_c1_38_592 | 168 |
| 449 | 3300053085 | Ga0495619_0107222 | Ga0495619_0107222_172_774 | 168 |
| 450 | iso_pu_bacteria | 2667528175 | 2671119958 | 168 |
| 451 | iso_pu_bacteria | 2908756301 | 2908756601 | 168 |
| 452 | 3300005937 | Ga0081455_10074562 | Ga0081455_100745623 | 169 |
| 453 | 3300028794 | Ga0307515_10102060 | Ga0307515_101020602 | 169 |
| 454 | 3300045049 | Ga0466959_0294512 | Ga0466959_0294512_139_723 | 169 |
| 455 | 3300047444 | Ga0495675_0494131 | Ga0495675_0494131_11_607 | 169 |
| 456 | iso_pu_bacteria | 2513237096 | 2513658799 | 169 |
| 457 | iso_pu_bacteria | 2513237137 | 2513860806 | 169 |
| 458 | iso_pu_bacteria | 2513237145 | 2513921063 | 169 |
| 459 | iso_pu_bacteria | 2517572143 | 2517888828 | 169 |
| 460 | iso_pu_bacteria | 2791355197 | 2793072916 | 169 |
| 461 | iso_pu_bacteria | 2885374607 | 2885376154 | 169 |
| 462 | iso_pu_bacteria | 2904690495 | 2904691205 | 169 |
| 463 | iso_pu_bacteria | 2906610324 | 2906613859 | 169 |
| 464 | iso_pu_bacteria | 2908739725 | 2908747429 | 169 |
| 465 | iso_pu_bacteria | 2935630451 | 2935635527 | 169 |
| 466 | iso_pu_bacteria | 2941507105 | 2941512176 | 169 |
| 467 | iso_pu_bacteria | 2941515067 | 2941519878 | 169 |
| 468 | iso_pu_bacteria | 2941523033 | 2941528181 | 169 |
| 469 | iso_pu_bacteria | 8006933436 | 8006936249 | 169 |
| 470 | iso_pu_bacteria | 8006973647 | 8006976194 | 169 |
| 471 | iso_pu_bacteria | 8056689827 | 8056693388 | 169 |
| 472 | 3300005563 | Ga0068855_100388660 | Ga0068855_1003886602 | 170 |
| 473 | 3300013306 | Ga0163162_10132028 | Ga0163162_101320281 | 170 |
| 474 | 3300013308 | Ga0157375_10533019 | Ga0157375_105330192 | 170 |
| 475 | 3300014969 | Ga0157376_10173362 | Ga0157376_101733622 | 170 |
| 476 | 3300031238 | Ga0265332_10055621 | Ga0265332_100556211 | 170 |
| 477 | 3300031249 | Ga0265339_10147882 | Ga0265339_101478822 | 170 |
| 478 | 3300031616 | Ga0307508_10253584 | Ga0307508_102535842 | 170 |
| 479 | 3300031711 | Ga0265314_10128993 | Ga0265314_101289932 | 170 |
| 480 | 3300031712 | Ga0265342_10003978 | Ga0265342_100039785 | 170 |
| 481 | 3300046472 | Ga0495580_0324810 | Ga0495580_0324810_27_620 | 170 |
| 482 | 3300046537 | Ga0495598_0051282 | Ga0495598_0051282_533_1090 | 170 |
| 483 | 3300046684 | Ga0495669_0066375 | Ga0495669_0066375_804_1361 | 170 |
| 484 | 3300046692 | Ga0495671_0155510 | Ga0495671_0155510_408_965 | 170 |
| 485 | 3300048924 | Ga0496121_0043240 | Ga0496121_0043240_1016_1603 | 170 |
| 486 | 3300049586 | Ga0501070_0348200 | Ga0501070_0348200_85_657 | 170 |
| 487 | 3300049589 | Ga0501073_0720508 | Ga0501073_0720508_72_644 | 170 |
| 488 | 3300049590 | Ga0501074_0270702 | Ga0501074_0270702_38_610 | 170 |
| 489 | 3300049592 | Ga0501076_0784943 | Ga0501076_0784943_29_601 | 170 |
| 490 | 3300049741 | Ga0501079_0773910 | Ga0501079_0773910_56_628 | 170 |
| 491 | 3300049742 | Ga0501080_0659052 | Ga0501080_0659052_223_792 | 170 |
| 492 | iso_pu_bacteria | 2903768456 | 2903770776 | 170 |
| 493 | iso_pu_bacteria | 2906660503 | 2906667375 | 170 |
| 494 | iso_pu_bacteria | 2922425934 | 2922434240 | 170 |
| 495 | iso_pu_bacteria | 3005474847 | 3005475047 | 170 |
| 496 | iso_pu_bacteria | 8019565922 | 8019572465 | 170 |
| 497 | 3300005435 | Ga0070714_100017816 | Ga0070714_1000178166 | 171 |
| 498 | 3300005436 | Ga0070713_100002424 | Ga0070713_10000242413 | 171 |
| 499 | 3300006028 | Ga0070717_10000598 | Ga0070717_1000059811 | 171 |
| 500 | 3300025928 | Ga0207700_10001725 | Ga0207700_100017252 | 171 |
| 501 | 3300025929 | Ga0207664_10179492 | Ga0207664_101794922 | 171 |
| 502 | 3300037466 | Ga0395898_0554458 | Ga0395898_0554458_213_824 | 171 |
| 503 | 3300049571 | Ga0501034_0507789 | Ga0501034_0507789_10_621 | 171 |
| 504 | 3300049823 | Ga0501044_0156073 | Ga0501044_0156073_1523_2134 | 171 |
| 505 | iso_pu_bacteria | 2602042107 | 2603858511 | 171 |
| 506 | iso_pu_bacteria | 2857524615 | 2857526367 | 171 |
| 507 | 3300009148 | Ga0105243_10469394 | Ga0105243_104693941 | 172 |
| 508 | 3300009545 | Ga0105237_10535283 | Ga0105237_105352831 | 172 |
| 509 | 3300009551 | Ga0105238_10044535 | Ga0105238_100445354 | 172 |
| 510 | 3300025924 | Ga0207694_10190375 | Ga0207694_101903752 | 172 |
| 511 | 3300026067 | Ga0207678_10636021 | Ga0207678_106360211 | 172 |
| 512 | 3300031090 | Ga0265760_10132173 | Ga0265760_101321732 | 172 |
| 513 | 3300031239 | Ga0265328_10230355 | Ga0265328_102303552 | 172 |
| 514 | 3300031249 | Ga0265339_10104524 | Ga0265339_101045242 | 172 |
| 515 | 3300031711 | Ga0265314_10123022 | Ga0265314_101230223 | 172 |
| 516 | 3300035083 | Ga0373926_0222739 | Ga0373926_0222739_32_625 | 172 |
| 517 | 3300037068 | Ga0373925_0248894 | Ga0373925_0248894_491_1084 | 172 |
| 518 | 3300037312 | Ga0395899_0676245 | Ga0395899_0676245_25_612 | 172 |
| 519 | 3300037471 | Ga0395905_0022009 | Ga0395905_0022009_2406_2993 | 172 |
| 520 | 3300005436 | Ga0070713_100130990 | Ga0070713_1001309902 | 173 |
| 521 | 3300005439 | Ga0070711_100369322 | Ga0070711_1003693222 | 173 |
| 522 | 3300006175 | Ga0070712_100667749 | Ga0070712_1006677491 | 173 |
| 523 | 3300009101 | Ga0105247_10969056 | Ga0105247_109690561 | 173 |
| 524 | 3300011119 | Ga0105246_10405568 | Ga0105246_104055681 | 173 |
| 525 | 3300025915 | Ga0207693_10288046 | Ga0207693_102880462 | 173 |
| 526 | 3300025916 | Ga0207663_10329526 | Ga0207663_103295262 | 173 |
| 527 | 3300025928 | Ga0207700_10263485 | Ga0207700_102634852 | 173 |
| 528 | 3300031249 | Ga0265339_10001062 | Ga0265339_1000106210 | 173 |
| 529 | 3300035117 | Ga0373953_0001445 | Ga0373953_0001445_5368_5958 | 173 |
| 530 | 3300035120 | Ga0373957_0141557 | Ga0373957_0141557_361_951 | 173 |
| 531 | 3300035172 | Ga0373955_0087088 | Ga0373955_0087088_1115_1705 | 173 |
| 532 | 3300035410 | Ga0373924_0074022 | Ga0373924_0074022_644_1234 | 173 |
| 533 | 3300035692 | Ga0373935_0014847 | Ga0373935_0014847_2947_3537 | 173 |
| 534 | 3300035724 | Ga0373933_0021586 | Ga0373933_0021586_643_1233 | 173 |
| 535 | 3300036401 | Ga0373937_0135717 | Ga0373937_0135717_1666_2256 | 173 |
| 536 | 3300046454 | Ga0495592_0015319 | Ga0495592_0015319_2438_3028 | 173 |
| 537 | 3300046462 | Ga0495651_0021262 | Ga0495651_0021262_974_1564 | 173 |
| 538 | 3300046463 | Ga0495653_0025800 | Ga0495653_0025800_4100_4690 | 173 |
| 539 | 3300046476 | Ga0495662_0073977 | Ga0495662_0073977_595_1185 | 173 |
| 540 | 3300046514 | Ga0495618_0058501 | Ga0495618_0058501_1800_2390 | 173 |
| 541 | 3300046516 | Ga0495628_0041630 | Ga0495628_0041630_2148_2738 | 173 |
| 542 | 3300046529 | Ga0495652_0035518 | Ga0495652_0035518_1403_1993 | 173 |
| 543 | 3300046533 | Ga0495640_0027351 | Ga0495640_0027351_1616_2206 | 173 |
| 544 | 3300046535 | Ga0495586_0225174 | Ga0495586_0225174_197_787 | 173 |
| 545 | 3300046536 | Ga0495587_0031015 | Ga0495587_0031015_758_1348 | 173 |
| 546 | 3300046543 | Ga0495645_0052917 | Ga0495645_0052917_2184_2774 | 173 |
| 547 | 3300046559 | Ga0495667_0046486 | Ga0495667_0046486_2054_2644 | 173 |
| 548 | 3300046642 | Ga0495634_0018995 | Ga0495634_0018995_179_769 | 173 |
| 549 | 3300046660 | Ga0495625_0199172 | Ga0495625_0199172_192_788 | 173 |
| 550 | 3300046663 | Ga0495635_0053495 | Ga0495635_0053495_1193_1783 | 173 |
| 551 | 3300046675 | Ga0495657_0036727 | Ga0495657_0036727_575_1165 | 173 |
| 552 | 3300046678 | Ga0495599_0346792 | Ga0495599_0346792_83_673 | 173 |
| 553 | 3300046679 | Ga0495623_0062183 | Ga0495623_0062183_43_633 | 173 |
| 554 | 3300046680 | Ga0495646_0023490 | Ga0495646_0023490_2280_2870 | 173 |
| 555 | 3300046689 | Ga0495613_0311264 | Ga0495613_0311264_464_1054 | 173 |
| 556 | 3300046809 | Ga0495600_0019133 | Ga0495600_0019133_2445_3035 | 173 |
| 557 | 3300047317 | Ga0495604_0023259 | Ga0495604_0023259_38_628 | 173 |
| 558 | 3300047319 | Ga0495674_0010066 | Ga0495674_0010066_1131_1721 | 173 |
| 559 | 3300047322 | Ga0495680_0025482 | Ga0495680_0025482_2659_3249 | 173 |
| 560 | 3300047471 | Ga0495684_0011974 | Ga0495684_0011974_4712_5302 | 173 |
| 561 | 3300048905 | Ga0496102_0138248 | Ga0496102_0138248_1171_1752 | 173 |
| 562 | 3300048907 | Ga0496104_0070776 | Ga0496104_0070776_443_1024 | 173 |
| 563 | 3300048909 | Ga0496106_0194116 | Ga0496106_0194116_582_1163 | 173 |
| 564 | 3300048911 | Ga0496108_0900667 | Ga0496108_0900667_89_676 | 173 |
| 565 | 3300048912 | Ga0496109_0570050 | Ga0496109_0570050_310_891 | 173 |
| 566 | 3300048913 | Ga0496110_0351812 | Ga0496110_0351812_543_1124 | 173 |
| 567 | 3300048917 | Ga0496114_0140197 | Ga0496114_0140197_916_1497 | 173 |
| 568 | 3300049586 | Ga0501070_0580235 | Ga0501070_0580235_57_665 | 173 |
| 569 | 3300049741 | Ga0501079_0462315 | Ga0501079_0462315_223_807 | 173 |
| 570 | 3300053077 | Ga0495601_0104443 | Ga0495601_0104443_184_774 | 173 |
| 571 | 3300053078 | Ga0495612_0135872 | Ga0495612_0135872_369_959 | 173 |
| 572 | 3300053084 | Ga0495595_0117164 | Ga0495595_0117164_320_910 | 173 |
| 573 | 3300053085 | Ga0495619_0192709 | Ga0495619_0192709_167_742 | 173 |
| 574 | 3300005435 | Ga0070714_100289313 | Ga0070714_1002893131 | 174 |
| 575 | 3300025929 | Ga0207664_11033118 | Ga0207664_110331181 | 174 |
| 576 | 3300026089 | Ga0207648_10491817 | Ga0207648_104918172 | 174 |
| 577 | 3300048905 | Ga0496102_0359795 | Ga0496102_0359795_557_1147 | 174 |
| 578 | 3300048929 | Ga0496126_0028457 | Ga0496126_0028457_4452_5057 | 174 |
| 579 | 3300053178 | Ga0500637_0233599 | Ga0500637_0233599_121_720 | 174 |
| 580 | 3300001976 | JGI24752J21851_1002755 | JGI24752J21851_10027553 | 181 |
| 581 | 3300001977 | JGI24746J21847_1000148 | JGI24746J21847_100014812 | 181 |
| 582 | 3300005329 | Ga0070683_100588867 | Ga0070683_1005888672 | 181 |
| 583 | 3300005458 | Ga0070681_10114542 | Ga0070681_101145423 | 181 |
| 584 | 3300005535 | Ga0070684_100258767 | Ga0070684_1002587672 | 181 |
| 585 | 3300009174 | Ga0105241_10003924 | Ga0105241_100039248 | 181 |
| 586 | 3300009551 | Ga0105238_10587821 | Ga0105238_105878212 | 181 |
| 587 | 3300010375 | Ga0105239_10028016 | Ga0105239_100280164 | 181 |
| 588 | 3300011119 | Ga0105246_10000052 | Ga0105246_100000529 | 181 |
| 589 | 3300013297 | Ga0157378_10002713 | Ga0157378_1000271311 | 181 |
| 590 | 3300025912 | Ga0207707_10017763 | Ga0207707_100177632 | 181 |
| 591 | 3300025912 | Ga0207707_10192350 | Ga0207707_101923502 | 181 |
| 592 | 3300025921 | Ga0207652_11096162 | Ga0207652_110961621 | 181 |
| 593 | 3300025944 | Ga0207661_10523075 | Ga0207661_105230751 | 181 |
| 594 | 3300035115 | Ga0373941_0007472 | Ga0373941_0007472_649_1194 | 181 |
| 595 | 3300046491 | Ga0495584_0029790 | Ga0495584_0029790_1902_2447 | 181 |
| 596 | 3300048918 | Ga0496115_0003980 | Ga0496115_0003980_8292_8837 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zqe-assembly1.cif.gz_A | crystal structure of the smr domain of thermus thermophilus muts2 | 0.9299 | 90 | 175 |
| 4od6-assembly1.cif.gz_A | structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked | 0.9162 | 87 | 176 |
| 4od6-assembly1.cif.gz_A | structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked | 0.9058 | 87 | 176 |
| 2zqe-assembly1.cif.gz_A | crystal structure of the smr domain of thermus thermophilus muts2 | 0.8971 | 90 | 175 |
| 3qd7-assembly1.cif.gz_X | crystal structure of ydal, a stand-alone small muts-related protein from escherichia coli | 0.8718 | 91 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2zqeA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.9299 | 90 | 175 | 3.30.1370.110 |
| 2zqeA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.8971 | 90 | 175 | 3.30.1370.110 |
| 3qd7X00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.8718 | 91 | 176 | 3.30.1370.110 |
| af_Q59Z54_97_175_3.30.1370.110 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.8606 | 91 | 173 | 3.30.1370.110 |
| af_P0A8B2_49_176_3.30.1370.110 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.8255 | 74 | 178 | 3.30.1370.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E1MV02-F1-model_v4 | Smr domain-containing protein | 0.9684 | 68 | 177 |
|
| AF-A0A529XGE5-F1-model_v4 | deleted | 0.9659 | 75 | 179 |
|
| AF-A0A527CTZ6-F1-model_v4 | DNA mismatch repair protein MutS | 0.9654 | 72 | 165 |
|
| AF-A0A529HLL7-F1-model_v4 | DNA mismatch repair protein MutS | 0.9638 | 72 | 179 |
|
| AF-A0A537N767-F1-model_v4 | DNA mismatch repair protein MutS | 0.9553 | 67 | 180 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar