F467582

General Info

Members Datasets Scaffolds Average Seq Length
596 327 563 178

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0554458|Ga0395898_0554458_213_824
Length 203
Sequence MKRRPPDEILVDLSPPRRRRVLSEDERALWESVAKQAKPLRKRTRVAKAEIVLTAEPAPLAAHASAKRLRSEAVVPLIQPVNVKHPPSPPPLAPLGRRERTHLSRGKIEIDARLDLHGMTQARAHRVLLHFLQRASGDGLRFVLVVTGKGNTKGPDSERGVLRRQVPEWLSLPEFRALVVGFEQAHIGHGGAGALYVRVRRAR

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
6 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
7 2643221651 Afipia sp. Root123D2 Isolate Unclassified
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2738543024 Aminobacter sp. AP02 Isolate Unclassified
10 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
11 2842694124 Methylopila sp. R-72369 Isolate Unclassified
12 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
13 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
14 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
15 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
16 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
17 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
18 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
19 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
20 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
21 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
22 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
23 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
24 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
25 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
26 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
27 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
311 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
312 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
313 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
314 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
318 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
323 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
324 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
325 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
326 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
327 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 0.34
Isolates 5.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 3.36
Rhizoplane 6.04
Rhizosphere 78.02
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002755 3300001976 Bacteria 2335
2 JGI24746J21847_1000148 3300001977 Bacteria 8829
3 rootH2_10225439 3300003320 Bacteria 1202
4 rootL2_10340743 3300003322 Bacteria 1483
5 Ga0070658_10053528 3300005327 Bacteria 3276
6 Ga0070658_10303827 3300005327 Bacteria 1361
7 Ga0070683_100008779 3300005329 Bacteria 8593
8 Ga0070683_100140016 3300005329 Bacteria 2292
9 Ga0070683_100588867 3300005329 Bacteria 1064
10 Ga0070670_100293900 3300005331 Bacteria 1420
11 Ga0070680_100021698 3300005336 Bacteria 5107
12 Ga0070680_100159670 3300005336 Bacteria 1894
13 Ga0070682_100009413 3300005337 Bacteria 5528
14 Ga0068868_100019259 3300005338 Bacteria 5112
15 Ga0070660_100002843 3300005339 Bacteria 11922
16 Ga0070660_100466759 3300005339 Bacteria 1048
17 Ga0070691_10086145 3300005341 Bacteria 1544
18 Ga0070671_100520918 3300005355 Bacteria 1024
19 Ga0070673_100326205 3300005364 Bacteria 1357
20 Ga0070673_100381686 3300005364 Bacteria 1256
21 Ga0070659_100018629 3300005366 Bacteria 5240
22 Ga0070709_10077124 3300005434 Bacteria 2166
23 Ga0070714_100017816 3300005435 Bacteria 5760
24 Ga0070714_100289313 3300005435 Bacteria 1524
25 Ga0070713_100002424 3300005436 Bacteria 12160
26 Ga0070713_100062589 3300005436 Bacteria 3117
27 Ga0070713_100130990 3300005436 Bacteria 2212
28 Ga0070713_100342146 3300005436 Bacteria 1386
29 Ga0070713_100786622 3300005436 Bacteria 912
30 Ga0070710_10007182 3300005437 Bacteria 5384
31 Ga0070711_100096489 3300005439 Bacteria 2142
32 Ga0070711_100369322 3300005439 Bacteria 1157
33 Ga0070663_100001666 3300005455 Bacteria 12295
34 Ga0070663_100722612 3300005455 Bacteria 848
35 Ga0070678_100040432 3300005456 Bacteria 3300
36 Ga0070678_100055673 3300005456 Bacteria 2889
37 Ga0070681_10040811 3300005458 Bacteria 4649
38 Ga0070681_10048927 3300005458 Bacteria 4223
39 Ga0070681_10114542 3300005458 Bacteria 2635
40 Ga0070685_10403969 3300005466 Bacteria 947
41 Ga0070698_100159902 3300005471 Bacteria 2197
42 Ga0070679_100008944 3300005530 Bacteria 9450
43 Ga0070679_100041621 3300005530 Bacteria 4572
44 Ga0070679_100768417 3300005530 Bacteria 906
45 Ga0070684_100006680 3300005535 Bacteria 8942
46 Ga0070684_100258767 3300005535 Bacteria 1592
47 Ga0070684_100606735 3300005535 Bacteria 1018
48 Ga0070697_100029029 3300005536 Bacteria 4432
49 Ga0068853_100002454 3300005539 Bacteria 13873
50 Ga0068853_100002614 3300005539 Bacteria 13545
51 Ga0068853_100081722 3300005539 Bacteria 2830
52 Ga0068853_100120254 3300005539 Bacteria 2342
53 Ga0068853_100147859 3300005539 Bacteria 2113
54 Ga0070695_100503778 3300005545 Bacteria 937
55 Ga0070693_100008395 3300005547 Bacteria 5090
56 Ga0068855_100006336 3300005563 Bacteria 14418
57 Ga0068855_100388660 3300005563 Bacteria 1531
58 Ga0070664_100052242 3300005564 Bacteria 3461
59 Ga0068857_100017087 3300005577 Bacteria 6355
60 Ga0068857_101121740 3300005577 Bacteria 760
61 Ga0068852_100040747 3300005616 Bacteria 3921
62 Ga0068852_100080223 3300005616 Bacteria 2893
63 Ga0068859_100231042 3300005617 Bacteria 1938
64 Ga0068851_10222223 3300005834 Bacteria 1062
65 Ga0068870_10221503 3300005840 Bacteria 1158
66 Ga0068870_10496638 3300005840 Bacteria 813
67 Ga0081455_10003646 3300005937 Bacteria 17638
68 Ga0081455_10019063 3300005937 Bacteria 6506
69 Ga0081455_10074562 3300005937 Bacteria 2802
70 Ga0081455_10268756 3300005937 Bacteria 1238
71 Ga0081540_1027038 3300005983 Bacteria 3260
72 Ga0081540_1042824 3300005983 Bacteria 2330
73 Ga0070717_10000598 3300006028 Bacteria 23163
74 Ga0070717_10500171 3300006028 Bacteria 1098
75 Ga0075365_10178424 3300006038 Bacteria 1484
76 Ga0070712_100175883 3300006175 Bacteria 1664
77 Ga0070712_100667749 3300006175 Bacteria 884
78 Ga0075367_10144805 3300006178 Bacteria 1473
79 Ga0097621_100147183 3300006237 Bacteria 2017
80 Ga0068871_100074487 3300006358 Bacteria 2801
81 Ga0068871_100518607 3300006358 Bacteria 1076
82 Ga0075428_100028368 3300006844 Bacteria 6191
83 Ga0068865_100043307 3300006881 Bacteria 3075
84 Ga0068865_100499235 3300006881 Bacteria 1014
85 Ga0097620_100231042 3300006931 Bacteria 1938
86 Ga0099824_1011583 3300006942 Bacteria 9925
87 Ga0105240_10059068 3300009093 Bacteria 4787
88 Ga0105240_10381810 3300009093 Bacteria 1591
89 Ga0111539_11754008 3300009094 Unclassified 720
90 Ga0105245_10027626 3300009098 Bacteria 5000
91 Ga0105247_10969056 3300009101 Bacteria 662
92 Ga0114129_10030378 3300009147 Bacteria 7645
93 Ga0105243_10469394 3300009148 Bacteria 1185
94 Ga0105243_10581901 3300009148 Bacteria 1075
95 Ga0105241_10003924 3300009174 Bacteria 11014
96 Ga0105241_10060890 3300009174 Bacteria 2905
97 Ga0105248_10026101 3300009177 Bacteria 6500
98 Ga0105248_11591516 3300009177 Bacteria 740
99 Ga0105237_10008146 3300009545 Bacteria 11379
100 Ga0105237_10088220 3300009545 Bacteria 3091
101 Ga0105237_10155815 3300009545 Bacteria 2281
102 Ga0105237_10535283 3300009545 Bacteria 1178
103 Ga0105238_10044535 3300009551 Bacteria 4486
104 Ga0105238_10587821 3300009551 Unclassified 1120
105 Ga0105249_10112128 3300009553 Bacteria 2579
106 Ga0105239_10023840 3300010375 Bacteria 6739
107 Ga0105239_10025568 3300010375 Bacteria 6499
108 Ga0105239_10028016 3300010375 Bacteria 6199
109 Ga0105239_11838006 3300010375 Bacteria 702
110 Ga0105246_10000052 3300011119 Bacteria 46290
111 Ga0105246_10005044 3300011119 Bacteria 8027
112 Ga0105246_10405568 3300011119 Bacteria 1133
113 Ga0157373_10013772 3300013100 Bacteria 5928
114 Ga0157370_10031834 3300013104 Bacteria 5156
115 Ga0157370_10192063 3300013104 Bacteria 1895
116 Ga0157369_10001511 3300013105 Bacteria 28540
117 Ga0157369_10003829 3300013105 Bacteria 17867
118 Ga0157374_10032796 3300013296 Bacteria 4733
119 Ga0157378_10002713 3300013297 Bacteria 15762
120 Ga0163162_10073409 3300013306 Bacteria 3477
121 Ga0163162_10132028 3300013306 Bacteria 2606
122 Ga0157375_10533019 3300013308 Bacteria 1337
123 Ga0163163_10097005 3300014325 Bacteria 2968
124 Ga0163163_11445652 3300014325 Bacteria 749
125 Ga0157379_10078625 3300014968 Bacteria 2954
126 Ga0157379_10573455 3300014968 Bacteria 1051
127 Ga0157376_10017080 3300014969 Bacteria 5527
128 Ga0157376_10173362 3300014969 Bacteria 1966
129 Ga0157376_11270606 3300014969 Bacteria 766
130 Ga0163161_10799517 3300017792 Bacteria 792
131 Ga0213872_10033863 3300021361 Bacteria 2340
132 Ga0213874_10079472 3300021377 Bacteria 1060
133 Ga0213874_10100383 3300021377 Bacteria 961
134 Ga0213876_10063105 3300021384 Bacteria 1956
135 Ga0213875_10156079 3300021388 Bacteria 1070
136 Ga0209677_102510 3300025253 Bacteria 6840
137 Ga0209148_1007942 3300025254 Bacteria 2165
138 Ga0209233_1003764 3300025261 Bacteria 5301
139 Ga0209455_1001040 3300025272 Bacteria 13815
140 Ga0209455_1002070 3300025272 Bacteria 8101
141 Ga0209564_1000321 3300025295 Bacteria 93331
142 Ga0209564_1021625 3300025295 Bacteria 2304
143 Ga0207710_10077570 3300025900 Bacteria 1535
144 Ga0207688_10156875 3300025901 Bacteria 1347
145 Ga0207680_10182612 3300025903 Bacteria 1419
146 Ga0207647_10262530 3300025904 Bacteria 989
147 Ga0207699_10017128 3300025906 Bacteria 3805
148 Ga0207643_10634306 3300025908 Bacteria 689
149 Ga0207705_10147708 3300025909 Bacteria 1760
150 Ga0207707_10004287 3300025912 Bacteria 12624
151 Ga0207707_10017763 3300025912 Bacteria 6203
152 Ga0207707_10032444 3300025912 Bacteria 4571
153 Ga0207707_10192350 3300025912 Bacteria 1780
154 Ga0207695_10015308 3300025913 Bacteria 9037
155 Ga0207695_10150514 3300025913 Bacteria 2266
156 Ga0207671_10009240 3300025914 Bacteria 8259
157 Ga0207671_10055238 3300025914 Bacteria 2942
158 Ga0207671_10196493 3300025914 Bacteria 1574
159 Ga0207693_10006870 3300025915 Bacteria 9396
160 Ga0207693_10010186 3300025915 Bacteria 7635
161 Ga0207693_10033379 3300025915 Bacteria 4061
162 Ga0207693_10288046 3300025915 Bacteria 1287
163 Ga0207663_10159321 3300025916 Bacteria 1591
164 Ga0207663_10329526 3300025916 Bacteria 1150
165 Ga0207663_10533530 3300025916 Bacteria 915
166 Ga0207660_10001366 3300025917 Bacteria 16351
167 Ga0207660_10074055 3300025917 Bacteria 2484
168 Ga0207657_10001686 3300025919 Bacteria 23826
169 Ga0207657_10417169 3300025919 Bacteria 1055
170 Ga0207649_10030607 3300025920 Bacteria 3190
171 Ga0207649_10154429 3300025920 Bacteria 1584
172 Ga0207652_10001889 3300025921 Bacteria 18142
173 Ga0207652_11096162 3300025921 Unclassified 697
174 Ga0207694_10190375 3300025924 Bacteria 1666
175 Ga0207650_10308617 3300025925 Bacteria 1294
176 Ga0207700_10001725 3300025928 Bacteria 12413
177 Ga0207700_10209738 3300025928 Bacteria 1646
178 Ga0207700_10263485 3300025928 Unclassified 1477
179 Ga0207664_10179492 3300025929 Bacteria 1817
180 Ga0207664_11033118 3300025929 Bacteria 736
181 Ga0207644_10493923 3300025931 Bacteria 1009
182 Ga0207690_10029000 3300025932 Bacteria 3514
183 Ga0207709_10435986 3300025935 Bacteria 1009
184 Ga0207669_10923180 3300025937 Bacteria 730
185 Ga0207704_10204239 3300025938 Bacteria 1449
186 Ga0207665_10027297 3300025939 Bacteria 3772
187 Ga0207691_10434778 3300025940 Bacteria 1118
188 Ga0207661_10007064 3300025944 Bacteria 7970
189 Ga0207661_10079544 3300025944 Bacteria 2702
190 Ga0207661_10523075 3300025944 Bacteria 1085
191 Ga0207667_10002324 3300025949 Bacteria 23814
192 Ga0207667_10041162 3300025949 Bacteria 4916
193 Ga0207667_10449228 3300025949 Bacteria 1310
194 Ga0207651_10286449 3300025960 Bacteria 1364
195 Ga0207712_10187728 3300025961 Bacteria 1629
196 Ga0207640_10007128 3300025981 Bacteria 6160
197 Ga0207677_10186551 3300026023 Bacteria 1636
198 Ga0207703_10798758 3300026035 Bacteria 901
199 Ga0207639_10001161 3300026041 Bacteria 17869
200 Ga0207639_10018895 3300026041 Bacteria 4906
201 Ga0207639_10091736 3300026041 Bacteria 2433
202 Ga0207678_10004832 3300026067 Bacteria 12098
203 Ga0207678_10057356 3300026067 Bacteria 3351
204 Ga0207678_10636021 3300026067 Bacteria 937
205 Ga0207641_10031099 3300026088 Bacteria 4426
206 Ga0207648_10491817 3300026089 Bacteria 1122
207 Ga0207674_10042259 3300026116 Bacteria 4710
208 Ga0207683_10065230 3300026121 Bacteria 3210
209 Ga0207683_10080956 3300026121 Bacteria 2881
210 Ga0207683_10121753 3300026121 Bacteria 2343
211 Ga0207698_10119810 3300026142 Bacteria 2225
212 Ga0207698_10225416 3300026142 Bacteria 1697
213 Ga0209588_1014784 3300027671 Bacteria 2395
214 Ga0268266_10379924 3300028379 Bacteria 1332
215 Ga0307515_10102060 3300028794 Bacteria 3455
216 Ga0265760_10132173 3300031090 Bacteria 808
217 Ga0265332_10055621 3300031238 Bacteria 1696
218 Ga0265332_10067376 3300031238 Bacteria 1526
219 Ga0265328_10230355 3300031239 Unclassified 707
220 Ga0265325_10007580 3300031241 Bacteria 6488
221 Ga0265339_10001062 3300031249 Bacteria 20880
222 Ga0265339_10104524 3300031249 Bacteria 1471
223 Ga0265339_10147882 3300031249 Bacteria 1190
224 Ga0265339_10283210 3300031249 Bacteria 794
225 Ga0265331_10092647 3300031250 Bacteria 1396
226 Ga0307513_10484819 3300031456 Bacteria 955
227 Ga0307509_10349367 3300031507 Bacteria 1203
228 Ga0307508_10000002 3300031616 Bacteria 407635
229 Ga0307508_10253584 3300031616 Bacteria 1355
230 Ga0265314_10051931 3300031711 Bacteria 2853
231 Ga0265314_10075262 3300031711 Bacteria 2247
232 Ga0265314_10123022 3300031711 Bacteria 1630
233 Ga0265314_10128993 3300031711 Bacteria 1580
234 Ga0265342_10003978 3300031712 Bacteria 11831
235 Ga0265342_10087584 3300031712 Bacteria 1789
236 Ga0265342_10089155 3300031712 Bacteria 1770
237 Ga0307412_10028363 3300031911 Bacteria 3501
238 Ga0307510_10082383 3300033180 Bacteria 3113
239 Ga0373926_0088473 3300035083 Bacteria 1150
240 Ga0373926_0222739 3300035083 Bacteria 728
241 Ga0373934_0012084 3300035086 Bacteria 3257
242 Ga0373944_0074090 3300035089 Bacteria 1114
243 Ga0373944_0094719 3300035089 Bacteria 1002
244 Ga0373936_0030834 3300035113 Bacteria 2115
245 Ga0373941_0007472 3300035115 Bacteria 2674
246 Ga0373945_0049250 3300035116 Bacteria 1545
247 Ga0373953_0001445 3300035117 Bacteria 6889
248 Ga0373953_0057059 3300035117 Bacteria 1589
249 Ga0373953_0132815 3300035117 Bacteria 1062
250 Ga0373954_0030161 3300035118 Bacteria 2500
251 Ga0373954_0058169 3300035118 Bacteria 1821
252 Ga0373957_0027513 3300035120 Bacteria 2066
253 Ga0373957_0052708 3300035120 Bacteria 1559
254 Ga0373957_0141557 3300035120 Bacteria 983
255 Ga0373943_0005777 3300035170 Bacteria 5557
256 Ga0373943_0058182 3300035170 Bacteria 1923
257 Ga0373943_0125811 3300035170 Bacteria 1367
258 Ga0373946_0003273 3300035171 Bacteria 5752
259 Ga0373955_0003039 3300035172 Bacteria 7349
260 Ga0373955_0060620 3300035172 Bacteria 2087
261 Ga0373955_0087088 3300035172 Bacteria 1774
262 Ga0373924_0012052 3300035410 Bacteria 3223
263 Ga0373924_0068403 3300035410 Bacteria 1495
264 Ga0373924_0074022 3300035410 Bacteria 1440
265 Ga0373931_0144472 3300035691 Bacteria 1381
266 Ga0373931_0667910 3300035691 Bacteria 684
267 Ga0373935_0000953 3300035692 Bacteria 15634
268 Ga0373935_0014847 3300035692 Bacteria 4703
269 Ga0373935_0117809 3300035692 Bacteria 1770
270 Ga0373927_0001486 3300035695 Bacteria 17658
271 Ga0373927_0044780 3300035695 Bacteria 2862
272 Ga0373927_0048807 3300035695 Bacteria 2738
273 Ga0373933_0021586 3300035724 Bacteria 3659
274 Ga0373933_0035577 3300035724 Bacteria 2909
275 Ga0373933_0071544 3300035724 Bacteria 2112
276 Ga0373947_0077646 3300035725 Bacteria 2048
277 Ga0373947_0127417 3300035725 Bacteria 1622
278 Ga0373937_0103533 3300036401 Bacteria 2644
279 Ga0373937_0135717 3300036401 Bacteria 2300
280 Ga0373937_0207495 3300036401 Bacteria 1843
281 Ga0373937_0396503 3300036401 Bacteria 1309
282 Ga0310109_032717 3300036534 Bacteria 686
283 Ga0373925_0016468 3300037068 Bacteria 5356
284 Ga0373925_0024914 3300037068 Bacteria 4370
285 Ga0373925_0030846 3300037068 Bacteria 3936
286 Ga0373925_0248894 3300037068 Bacteria 1425
287 Ga0373925_0756652 3300037068 Bacteria 801
288 Ga0395899_0676245 3300037312 Bacteria 650
289 Ga0395898_0554458 3300037466 Bacteria 1091
290 Ga0395898_1094820 3300037466 Bacteria 730
291 Ga0395905_0022009 3300037471 Bacteria 6031
292 Ga0436364_0804363 3300037853 Bacteria 1529
293 Ga0436364_1184315 3300037853 Bacteria 632
294 Ga0436364_1330873 3300037853 Bacteria 1059
295 Ga0436365_1262081 3300039437 Bacteria 4465
296 Ga0436361_0348492 3300039447 Bacteria 2705
297 Ga0436361_0960028 3300039447 Bacteria 1914
298 Ga0436363_0585583 3300039450 Bacteria 2419
299 Ga0451843_0100938 3300041509 Bacteria 1012
300 Ga0451853_0145000 3300041512 Bacteria 767
301 Ga0466959_0294512 3300045049 Bacteria 1112
302 Ga0466967_0080769 3300045976 Bacteria 2935
303 Ga0466967_0295084 3300045976 Bacteria 1558
304 Ga0495592_0015319 3300046454 Bacteria 5819
305 Ga0495592_0023331 3300046454 Bacteria 4705
306 Ga0495592_0074932 3300046454 Bacteria 2458
307 Ga0495603_0000047 3300046455 Bacteria 53081
308 Ga0495603_0053181 3300046455 Bacteria 2403
309 Ga0495603_0124825 3300046455 Bacteria 1500
310 Ga0495629_0000320 3300046459 Bacteria 41151
311 Ga0495629_0027213 3300046459 Bacteria 4062
312 Ga0495641_0003618 3300046461 Bacteria 11446
313 Ga0495641_0094827 3300046461 Bacteria 1333
314 Ga0495651_0021262 3300046462 Bacteria 5042
315 Ga0495651_0066225 3300046462 Bacteria 2758
316 Ga0495651_0074316 3300046462 Bacteria 2579
317 Ga0495651_0490154 3300046462 Bacteria 788
318 Ga0495653_0025800 3300046463 Bacteria 4715
319 Ga0495580_0003812 3300046472 Bacteria 12769
320 Ga0495580_0029615 3300046472 Bacteria 3972
321 Ga0495580_0121568 3300046472 Bacteria 1813
322 Ga0495580_0324810 3300046472 Bacteria 1046
323 Ga0495582_0000043 3300046473 Bacteria 63647
324 Ga0495582_0046916 3300046473 Bacteria 2379
325 Ga0495582_0332741 3300046473 Bacteria 874
326 Ga0495639_0000091 3300046475 Bacteria 44027
327 Ga0495639_0028279 3300046475 Bacteria 2483
328 Ga0495662_0073977 3300046476 Bacteria 1653
329 Ga0495664_0027964 3300046477 Bacteria 3290
330 Ga0495664_0061528 3300046477 Bacteria 2235
331 Ga0495664_0085857 3300046477 Bacteria 1890
332 Ga0495584_0029790 3300046491 Bacteria 2766
333 Ga0495594_0000453 3300046499 Bacteria 20836
334 Ga0495594_0109855 3300046499 Bacteria 1555
335 Ga0495606_0283901 3300046507 Bacteria 904
336 Ga0495608_0290544 3300046511 Bacteria 1013
337 Ga0495618_0051506 3300046514 Bacteria 2601
338 Ga0495618_0058501 3300046514 Bacteria 2441
339 Ga0495628_0035958 3300046516 Bacteria 3978
340 Ga0495628_0041630 3300046516 Bacteria 3667
341 Ga0495628_0087783 3300046516 Bacteria 2411
342 Ga0495630_0008996 3300046517 Bacteria 7172
343 Ga0495630_0178895 3300046517 Bacteria 1617
344 Ga0495630_0288859 3300046517 Bacteria 1253
345 Ga0495630_0446192 3300046517 Bacteria 991
346 Ga0495644_0144809 3300046523 Bacteria 908
347 Ga0495648_0000286 3300046524 Bacteria 57430
348 Ga0495666_0010714 3300046526 Bacteria 4573
349 Ga0495652_0023709 3300046529 Bacteria 5439
350 Ga0495652_0035518 3300046529 Bacteria 4338
351 Ga0495665_0001635 3300046531 Bacteria 11999
352 Ga0495665_0078134 3300046531 Bacteria 1741
353 Ga0495665_0226831 3300046531 Bacteria 965
354 Ga0495640_0007704 3300046533 Bacteria 8471
355 Ga0495640_0014392 3300046533 Bacteria 5989
356 Ga0495640_0027351 3300046533 Bacteria 4113
357 Ga0495586_0083487 3300046535 Bacteria 1758
358 Ga0495586_0225174 3300046535 Bacteria 1066
359 Ga0495587_0031015 3300046536 Bacteria 3239
360 Ga0495587_0268912 3300046536 Bacteria 957
361 Ga0495598_0051282 3300046537 Bacteria 1243
362 Ga0495645_0052917 3300046543 Bacteria 2952
363 Ga0495645_0079371 3300046543 Bacteria 2357
364 Ga0495622_0002785 3300046557 Bacteria 8344
365 Ga0495622_0026296 3300046557 Bacteria 2718
366 Ga0495667_0033079 3300046559 Bacteria 3460
367 Ga0495667_0046486 3300046559 Bacteria 2870
368 Ga0495634_0007159 3300046642 Bacteria 8412
369 Ga0495634_0018995 3300046642 Bacteria 4887
370 Ga0495634_0113709 3300046642 Bacteria 1738
371 Ga0495625_0117372 3300046660 Bacteria 1814
372 Ga0495625_0199172 3300046660 Bacteria 1323
373 Ga0495625_0509150 3300046660 Bacteria 735
374 Ga0495635_0001788 3300046663 Bacteria 14525
375 Ga0495635_0053495 3300046663 Bacteria 2781
376 Ga0495635_0073028 3300046663 Bacteria 2350
377 Ga0495588_0026270 3300046674 Bacteria 2906
378 Ga0495588_0090752 3300046674 Bacteria 1600
379 Ga0495657_0036727 3300046675 Bacteria 3383
380 Ga0495657_0188178 3300046675 Bacteria 1263
381 Ga0495599_0346792 3300046678 Bacteria 890
382 Ga0495623_0061076 3300046679 Bacteria 2364
383 Ga0495623_0062183 3300046679 Bacteria 2340
384 Ga0495646_0023490 3300046680 Bacteria 3880
385 Ga0495646_0219014 3300046680 Bacteria 1030
386 Ga0495647_0001913 3300046681 Bacteria 6484
387 Ga0495658_0003457 3300046683 Bacteria 7807
388 Ga0495658_0492310 3300046683 Bacteria 784
389 Ga0495669_0066375 3300046684 Bacteria 1639
390 Ga0495613_0001794 3300046689 Bacteria 16314
391 Ga0495613_0141922 3300046689 Bacteria 1716
392 Ga0495613_0311264 3300046689 Bacteria 1088
393 Ga0495624_0000694 3300046690 Bacteria 26424
394 Ga0495624_0199394 3300046690 Bacteria 1216
395 Ga0495671_0155510 3300046692 Bacteria 1113
396 Ga0495600_0019133 3300046809 Bacteria 4368
397 Ga0495581_0000486 3300047315 Bacteria 20240
398 Ga0495581_0013345 3300047315 Bacteria 4764
399 Ga0495581_0057777 3300047315 Bacteria 2239
400 Ga0495604_0023259 3300047317 Bacteria 4943
401 Ga0495604_0104206 3300047317 Bacteria 2079
402 Ga0495604_0135425 3300047317 Bacteria 1766
403 Ga0495674_0003925 3300047319 Bacteria 14430
404 Ga0495674_0004075 3300047319 Bacteria 14133
405 Ga0495674_0010066 3300047319 Bacteria 8964
406 Ga0495676_0017241 3300047321 Bacteria 6391
407 Ga0495680_0025482 3300047322 Bacteria 4893
408 Ga0495675_0494131 3300047444 Bacteria 703
409 Ga0495684_0011974 3300047471 Bacteria 6689
410 Ga0495684_0014889 3300047471 Bacteria 5989
411 Ga0495593_0000005 3300047673 Bacteria 93984
412 Ga0495593_0042818 3300047673 Bacteria 2429
413 Ga0495602_0182596 3300048088 Bacteria 1616
414 Ga0495614_0067842 3300048089 Bacteria 1535
415 Ga0495626_0011452 3300048091 Bacteria 4691
416 Ga0496100_0009441 3300048903 Bacteria 5484
417 Ga0496101_0276283 3300048904 Bacteria 1312
418 Ga0496102_0138248 3300048905 Bacteria 2283
419 Ga0496102_0359795 3300048905 Bacteria 1370
420 Ga0496103_0013725 3300048906 Bacteria 4807
421 Ga0496103_0026151 3300048906 Bacteria 3533
422 Ga0496104_0070776 3300048907 Bacteria 3317
423 Ga0496104_0959185 3300048907 Bacteria 759
424 Ga0496105_0014585 3300048908 Bacteria 6257
425 Ga0496105_0173428 3300048908 Bacteria 1767
426 Ga0496106_0001014 3300048909 Bacteria 20581
427 Ga0496106_0194116 3300048909 Bacteria 1615
428 Ga0496107_0017012 3300048910 Bacteria 5112
429 Ga0496107_0042406 3300048910 Bacteria 3268
430 Ga0496108_0409640 3300048911 Bacteria 1184
431 Ga0496108_0900667 3300048911 Bacteria 759
432 Ga0496109_0423681 3300048912 Bacteria 1257
433 Ga0496109_0570050 3300048912 Unclassified 1067
434 Ga0496110_0042757 3300048913 Bacteria 3955
435 Ga0496110_0143414 3300048913 Bacteria 2159
436 Ga0496110_0351812 3300048913 Bacteria 1342
437 Ga0496111_0006861 3300048914 Bacteria 7431
438 Ga0496112_0000020 3300048915 Bacteria 169373
439 Ga0496112_0014598 3300048915 Bacteria 7298
440 Ga0496112_0017956 3300048915 Bacteria 6657
441 Ga0496113_0173056 3300048916 Bacteria 1710
442 Ga0496114_0121382 3300048917 Bacteria 2248
443 Ga0496114_0140197 3300048917 Bacteria 2093
444 Ga0496114_0865747 3300048917 Bacteria 784
445 Ga0496115_0003980 3300048918 Bacteria 10658
446 Ga0496115_0006071 3300048918 Bacteria 8821
447 Ga0496115_0008492 3300048918 Bacteria 7598
448 Ga0496115_0106653 3300048918 Bacteria 2300
449 Ga0496115_0443847 3300048918 Bacteria 1049
450 Ga0496116_0007249 3300048919 Bacteria 9883
451 Ga0496117_0061528 3300048920 Bacteria 2580
452 Ga0496118_0006290 3300048921 Bacteria 13129
453 Ga0496118_0561641 3300048921 Bacteria 554
454 Ga0496121_0001251 3300048924 Bacteria 44033
455 Ga0496121_0011522 3300048924 Bacteria 9798
456 Ga0496121_0038959 3300048924 Bacteria 4198
457 Ga0496121_0043240 3300048924 Bacteria 3905
458 Ga0496121_0205422 3300048924 Bacteria 1400
459 Ga0496121_0235297 3300048924 Bacteria 1280
460 Ga0496124_0120621 3300048927 Bacteria 2096
461 Ga0496124_0534521 3300048927 Bacteria 778
462 Ga0496126_0009189 3300048929 Bacteria 10544
463 Ga0496126_0009570 3300048929 Bacteria 10278
464 Ga0496126_0012762 3300048929 Bacteria 8587
465 Ga0496126_0028457 3300048929 Bacteria 5325
466 Ga0496126_0039133 3300048929 Bacteria 4403
467 Ga0496126_0114722 3300048929 Bacteria 2343
468 Ga0496126_0131444 3300048929 Bacteria 2163
469 Ga0496126_0146376 3300048929 Bacteria 2028
470 Ga0496126_0383587 3300048929 Bacteria 1143
471 Ga0496126_0703885 3300048929 Bacteria 785
472 Ga0501031_0068936 3300049568 Bacteria 2304
473 Ga0501031_0653368 3300049568 Bacteria 676
474 Ga0501032_0029896 3300049569 Bacteria 3737
475 Ga0501033_0029329 3300049570 Bacteria 4135
476 Ga0501033_0103632 3300049570 Bacteria 2074
477 Ga0501033_0235396 3300049570 Bacteria 1300
478 Ga0501034_0068618 3300049571 Bacteria 3555
479 Ga0501034_0112843 3300049571 Bacteria 2708
480 Ga0501034_0141135 3300049571 Bacteria 2388
481 Ga0501034_0259298 3300049571 Bacteria 1681
482 Ga0501034_0507789 3300049571 Bacteria 1119
483 Ga0501034_0789700 3300049571 Bacteria 843
484 Ga0501036_0017677 3300049572 Bacteria 5967
485 Ga0501037_0016122 3300049573 Bacteria 5500
486 Ga0501037_0029001 3300049573 Bacteria 4087
487 Ga0501038_0004781 3300049574 Bacteria 12588
488 Ga0501038_0025760 3300049574 Bacteria 5239
489 Ga0501038_0202359 3300049574 Bacteria 1593
490 Ga0501038_0271795 3300049574 Bacteria 1336
491 Ga0501039_0267449 3300049575 Bacteria 1344
492 Ga0501043_0032205 3300049579 Bacteria 4121
493 Ga0501043_0493989 3300049579 Bacteria 915
494 Ga0501046_0129712 3300049580 Bacteria 1913
495 Ga0501046_0149924 3300049580 Bacteria 1760
496 Ga0501046_0174377 3300049580 Unclassified 1612
497 Ga0501047_0035895 3300049581 Bacteria 4789
498 Ga0501047_0047108 3300049581 Bacteria 4165
499 Ga0501047_0435218 3300049581 Bacteria 1142
500 Ga0501048_0400346 3300049582 Bacteria 981
501 Ga0501067_0030191 3300049583 Bacteria 3006
502 Ga0501067_0141419 3300049583 Bacteria 1340
503 Ga0501068_0748206 3300049584 Bacteria 640
504 Ga0501069_0146412 3300049585 Bacteria 1356
505 Ga0501070_0180710 3300049586 Bacteria 1736
506 Ga0501070_0197486 3300049586 Unclassified 1652
507 Ga0501070_0348200 3300049586 Bacteria 1203
508 Ga0501070_0580235 3300049586 Bacteria 895
509 Ga0501073_0021192 3300049589 Bacteria 4686
510 Ga0501073_0322545 3300049589 Bacteria 1066
511 Ga0501073_0394038 3300049589 Bacteria 957
512 Ga0501073_0479554 3300049589 Unclassified 860
513 Ga0501073_0720508 3300049589 Bacteria 688
514 Ga0501074_0057212 3300049590 Bacteria 2809
515 Ga0501074_0270702 3300049590 Bacteria 1208
516 Ga0501075_0029424 3300049591 Bacteria 4063
517 Ga0501076_0102012 3300049592 Bacteria 2313
518 Ga0501076_0784943 3300049592 Bacteria 786
519 Ga0501077_0008635 3300049593 Bacteria 6315
520 Ga0501079_0023922 3300049741 Bacteria 4686
521 Ga0501079_0462315 3300049741 Bacteria 997
522 Ga0501079_0773910 3300049741 Bacteria 756
523 Ga0501080_0302790 3300049742 Bacteria 1449
524 Ga0501080_0350008 3300049742 Bacteria 1334
525 Ga0501080_0659052 3300049742 Bacteria 926
526 Ga0501081_0000547 3300049743 Bacteria 21324
527 Ga0501081_0659569 3300049743 Bacteria 784
528 Ga0501083_0213967 3300049744 Bacteria 1256
529 Ga0501035_0051750 3300049822 Bacteria 3675
530 Ga0501035_0171861 3300049822 Bacteria 1872
531 Ga0501035_0316061 3300049822 Bacteria 1313
532 Ga0501044_0016928 3300049823 Bacteria 7821
533 Ga0501044_0018287 3300049823 Bacteria 7511
534 Ga0501044_0028057 3300049823 Bacteria 5941
535 Ga0501044_0156073 3300049823 Bacteria 2262
536 Ga0501044_0169111 3300049823 Bacteria 2158
537 Ga0501044_0501132 3300049823 Bacteria 1115
538 Ga0501044_1139556 3300049823 Bacteria 649
539 nmdc:mga06z11_483241_c1 3300050494 Bacteria 750
540 nmdc:mga06z11_93822_c1 3300050494 Bacteria 1634
541 nmdc:mga05p37_17593_c1 3300050507 Bacteria 8627
542 nmdc:mga06r32_251093_c1 3300050510 Bacteria 1756
543 Ga0495601_0104443 3300053077 Bacteria 1831
544 Ga0495601_0245374 3300053077 Bacteria 1169
545 Ga0495612_0016794 3300053078 Bacteria 2932
546 Ga0495612_0025372 3300053078 Bacteria 2380
547 Ga0495612_0135872 3300053078 Bacteria 1064
548 Ga0495595_0117164 3300053084 Bacteria 1295
549 Ga0495619_0107222 3300053085 Bacteria 1905
550 Ga0495619_0192709 3300053085 Bacteria 1411
551 Ga0500566_0044825 3300053094 Bacteria 2547
552 Ga0500608_005972 3300053122 Bacteria 4904
553 Ga0500559_0000426 3300053136 Bacteria 29970
554 Ga0500577_0000470 3300053142 Bacteria 10444
555 Ga0500586_000605 3300053145 Bacteria 7286
556 Ga0500590_048836 3300053148 Bacteria 2156
557 Ga0500636_0002876 3300053177 Bacteria 9627
558 Ga0500636_0054559 3300053177 Bacteria 2343
559 Ga0500637_0233599 3300053178 Bacteria 1034
560 Ga0500611_016474 3300053727 Bacteria 1329
561 Ga0501084_0079799 3300054114 Bacteria 2743
562 Ga0501082_0007481 3300060353 Bacteria 9425
563 Ga0466962_0302444 3300061719 Bacteria 791

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0501132 Ga0501044_0501132_587_1081 132
2 3300025254 Ga0209148_1007942 Ga0209148_10079422 140
3 3300025272 Ga0209455_1002070 Ga0209455_100207010 140
4 3300049570 Ga0501033_0103632 Ga0501033_0103632_523_1095 143
5 3300049571 Ga0501034_0141135 Ga0501034_0141135_1104_1676 143
6 3300049572 Ga0501036_0017677 Ga0501036_0017677_2750_3322 143
7 3300049573 Ga0501037_0016122 Ga0501037_0016122_4400_4972 143
8 3300049580 Ga0501046_0174377 Ga0501046_0174377_741_1313 143
9 3300049581 Ga0501047_0047108 Ga0501047_0047108_1750_2322 143
10 3300049586 Ga0501070_0197486 Ga0501070_0197486_563_1135 143
11 3300049589 Ga0501073_0479554 Ga0501073_0479554_237_809 143
12 3300049822 Ga0501035_0051750 Ga0501035_0051750_2868_3440 143
13 3300049823 Ga0501044_0018287 Ga0501044_0018287_1725_2297 143
14 3300046517 Ga0495630_0178895 Ga0495630_0178895_39_518 144
15 3300048088 Ga0495602_0182596 Ga0495602_0182596_1126_1605 144
16 3300005536 Ga0070697_100029029 Ga0070697_1000290293 145
17 3300048921 Ga0496118_0561641 Ga0496118_0561641_50_544 145
18 3300037853 Ga0436364_1184315 Ga0436364_1184315_20_607 147
19 3300048924 Ga0496121_0001251 Ga0496121_0001251_17810_18385 147
20 3300035086 Ga0373934_0012084 Ga0373934_0012084_2652_3242 148
21 3300035117 Ga0373953_0132815 Ga0373953_0132815_64_654 148
22 3300035118 Ga0373954_0058169 Ga0373954_0058169_365_955 148
23 3300035120 Ga0373957_0027513 Ga0373957_0027513_234_824 148
24 3300035170 Ga0373943_0058182 Ga0373943_0058182_380_970 148
25 3300035172 Ga0373955_0060620 Ga0373955_0060620_1335_1925 148
26 3300035410 Ga0373924_0012052 Ga0373924_0012052_1585_2175 148
27 3300035692 Ga0373935_0117809 Ga0373935_0117809_1078_1668 148
28 3300035695 Ga0373927_0044780 Ga0373927_0044780_1913_2503 148
29 3300035724 Ga0373933_0035577 Ga0373933_0035577_1428_2018 148
30 3300035725 Ga0373947_0127417 Ga0373947_0127417_858_1448 148
31 3300036401 Ga0373937_0396503 Ga0373937_0396503_652_1242 148
32 3300037068 Ga0373925_0030846 Ga0373925_0030846_1201_1791 148
33 3300046454 Ga0495592_0074932 Ga0495592_0074932_1152_1742 148
34 3300046455 Ga0495603_0124825 Ga0495603_0124825_31_621 148
35 3300046459 Ga0495629_0027213 Ga0495629_0027213_1115_1705 148
36 3300046461 Ga0495641_0094827 Ga0495641_0094827_292_882 148
37 3300046472 Ga0495580_0029615 Ga0495580_0029615_420_1010 148
38 3300046473 Ga0495582_0046916 Ga0495582_0046916_158_748 148
39 3300046475 Ga0495639_0028279 Ga0495639_0028279_1509_2099 148
40 3300046477 Ga0495664_0027964 Ga0495664_0027964_2322_2912 148
41 3300046499 Ga0495594_0109855 Ga0495594_0109855_22_612 148
42 3300046516 Ga0495628_0087783 Ga0495628_0087783_797_1387 148
43 3300046517 Ga0495630_0446192 Ga0495630_0446192_153_743 148
44 3300046531 Ga0495665_0078134 Ga0495665_0078134_866_1456 148
45 3300046533 Ga0495640_0007704 Ga0495640_0007704_2141_2731 148
46 3300046642 Ga0495634_0113709 Ga0495634_0113709_1032_1622 148
47 3300046663 Ga0495635_0073028 Ga0495635_0073028_801_1391 148
48 3300046689 Ga0495613_0141922 Ga0495613_0141922_49_639 148
49 3300047315 Ga0495581_0057777 Ga0495581_0057777_1028_1618 148
50 3300047317 Ga0495604_0104206 Ga0495604_0104206_895_1485 148
51 3300047319 Ga0495674_0004075 Ga0495674_0004075_898_1488 148
52 3300047471 Ga0495684_0014889 Ga0495684_0014889_2543_3133 148
53 3300047673 Ga0495593_0042818 Ga0495593_0042818_49_639 148
54 3300049575 Ga0501039_0267449 Ga0501039_0267449_123_656 148
55 3300049591 Ga0501075_0029424 Ga0501075_0029424_1387_1920 148
56 3300049592 Ga0501076_0102012 Ga0501076_0102012_539_1072 148
57 3300049593 Ga0501077_0008635 Ga0501077_0008635_4354_4887 148
58 3300049741 Ga0501079_0023922 Ga0501079_0023922_1673_2206 148
59 3300049742 Ga0501080_0350008 Ga0501080_0350008_751_1284 148
60 3300053077 Ga0495601_0245374 Ga0495601_0245374_216_806 148
61 3300053078 Ga0495612_0016794 Ga0495612_0016794_279_869 148
62 3300054114 Ga0501084_0079799 Ga0501084_0079799_1258_1791 148
63 3300060353 Ga0501082_0007481 Ga0501082_0007481_743_1276 148
64 3300005471 Ga0070698_100159902 Ga0070698_1001599022 149
65 3300025903 Ga0207680_10182612 Ga0207680_101826121 149
66 3300026088 Ga0207641_10031099 Ga0207641_100310994 149
67 iso_pu_bacteria 2643221651 2644290930 149
68 3300046477 Ga0495664_0061528 Ga0495664_0061528_1402_1989 150
69 3300046543 Ga0495645_0079371 Ga0495645_0079371_552_1139 150
70 3300048091 Ga0495626_0011452 Ga0495626_0011452_1764_2357 150
71 3300049823 Ga0501044_0028057 Ga0501044_0028057_1780_2391 150
72 3300053142 Ga0500577_0000470 Ga0500577_0000470_1480_2079 150
73 3300021388 Ga0213875_10156079 Ga0213875_101560792 151
74 3300026067 Ga0207678_10057356 Ga0207678_100573564 151
75 3300035695 Ga0373927_0048807 Ga0373927_0048807_1784_2371 151
76 3300037853 Ga0436364_0804363 Ga0436364_0804363_344_928 151
77 3300046557 Ga0495622_0026296 Ga0495622_0026296_307_903 151
78 3300053078 Ga0495612_0025372 Ga0495612_0025372_586_1173 151
79 3300053094 Ga0500566_0044825 Ga0500566_0044825_1887_2483 151
80 3300053122 Ga0500608_005972 Ga0500608_005972_2865_3461 151
81 3300053136 Ga0500559_0000426 Ga0500559_0000426_26404_27000 151
82 iso_pu_bacteria 2893066018 2893067363 151
83 iso_pu_bacteria 2903748898 2903748969 151
84 3300025261 Ga0209233_1003764 Ga0209233_10037643 152
85 3300025272 Ga0209455_1001040 Ga0209455_100104012 152
86 3300028379 Ga0268266_10379924 Ga0268266_103799242 152
87 3300031911 Ga0307412_10028363 Ga0307412_100283632 152
88 3300048917 Ga0496114_0865747 Ga0496114_0865747_16_516 152
89 3300048929 Ga0496126_0009189 Ga0496126_0009189_2462_3037 152
90 3300005436 Ga0070713_100786622 Ga0070713_1007866222 153
91 3300005458 Ga0070681_10040811 Ga0070681_100408116 153
92 3300005545 Ga0070695_100503778 Ga0070695_1005037781 153
93 3300006881 Ga0068865_100499235 Ga0068865_1004992352 153
94 3300009093 Ga0105240_10381810 Ga0105240_103818102 153
95 3300009174 Ga0105241_10060890 Ga0105241_100608903 153
96 3300010375 Ga0105239_11838006 Ga0105239_118380062 153
97 3300013104 Ga0157370_10031834 Ga0157370_100318342 153
98 3300014968 Ga0157379_10078625 Ga0157379_100786252 153
99 3300025912 Ga0207707_10032444 Ga0207707_100324442 153
100 3300046523 Ga0495644_0144809 Ga0495644_0144809_100_687 153
101 3300048910 Ga0496107_0042406 Ga0496107_0042406_2469_3065 153
102 3300048911 Ga0496108_0409640 Ga0496108_0409640_181_777 153
103 3300048912 Ga0496109_0423681 Ga0496109_0423681_233_829 153
104 3300049823 Ga0501044_1139556 Ga0501044_1139556_20_592 153
105 3300025915 Ga0207693_10010186 Ga0207693_100101863 154
106 3300048927 Ga0496124_0534521 Ga0496124_0534521_52_654 154
107 3300048929 Ga0496126_0009570 Ga0496126_0009570_5181_5756 154
108 3300048929 Ga0496126_0039133 Ga0496126_0039133_552_1133 154
109 3300049574 Ga0501038_0202359 Ga0501038_0202359_128_700 154
110 3300049584 Ga0501068_0748206 Ga0501068_0748206_15_548 154
111 3300049590 Ga0501074_0057212 Ga0501074_0057212_2199_2780 154
112 3300049743 Ga0501081_0000547 Ga0501081_0000547_10250_10783 154
113 3300053177 Ga0500636_0054559 Ga0500636_0054559_975_1586 154
114 iso_pu_bacteria 2643221623 2644133960 154
115 iso_pu_bacteria 2738543024 2739310282 154
116 iso_pu_bacteria 8002285264 8002286362 154
117 3300005336 Ga0070680_100159670 Ga0070680_1001596702 155
118 3300005337 Ga0070682_100009413 Ga0070682_1000094136 155
119 3300005455 Ga0070663_100722612 Ga0070663_1007226122 155
120 3300005530 Ga0070679_100008944 Ga0070679_10000894411 155
121 3300005539 Ga0068853_100002614 Ga0068853_1000026145 155
122 3300005547 Ga0070693_100008395 Ga0070693_1000083955 155
123 3300005937 Ga0081455_10019063 Ga0081455_100190638 155
124 3300006358 Ga0068871_100074487 Ga0068871_1000744872 155
125 3300009545 Ga0105237_10088220 Ga0105237_100882203 155
126 3300013100 Ga0157373_10013772 Ga0157373_100137724 155
127 3300017792 Ga0163161_10799517 Ga0163161_107995172 155
128 3300021384 Ga0213876_10063105 Ga0213876_100631052 155
129 3300025900 Ga0207710_10077570 Ga0207710_100775702 155
130 3300025914 Ga0207671_10055238 Ga0207671_100552383 155
131 3300025917 Ga0207660_10074055 Ga0207660_100740552 155
132 3300025949 Ga0207667_10449228 Ga0207667_104492282 155
133 3300026041 Ga0207639_10001161 Ga0207639_1000116113 155
134 3300035691 Ga0373931_0667910 Ga0373931_0667910_49_645 155
135 3300039437 Ga0436365_1262081 Ga0436365_1262081_70_645 155
136 3300048908 Ga0496105_0014585 Ga0496105_0014585_202_798 155
137 3300048927 Ga0496124_0120621 Ga0496124_0120621_314_904 155
138 3300003322 rootL2_10340743 rootL2_103407432 156
139 3300005530 Ga0070679_100768417 Ga0070679_1007684171 156
140 3300005539 Ga0068853_100147859 Ga0068853_1001478592 156
141 3300005617 Ga0068859_100231042 Ga0068859_1002310421 156
142 3300006931 Ga0097620_100231042 Ga0097620_1002310421 156
143 3300009177 Ga0105248_10026101 Ga0105248_100261012 156
144 3300009553 Ga0105249_10112128 Ga0105249_101121282 156
145 3300021361 Ga0213872_10033863 Ga0213872_100338632 156
146 3300025961 Ga0207712_10187728 Ga0207712_101877282 156
147 3300026035 Ga0207703_10798758 Ga0207703_107987581 156
148 3300035691 Ga0373931_0144472 Ga0373931_0144472_23_619 156
149 3300039447 Ga0436361_0348492 Ga0436361_0348492_943_1542 156
150 3300048906 Ga0496103_0026151 Ga0496103_0026151_1797_2393 156
151 3300048929 Ga0496126_0012762 Ga0496126_0012762_5774_6367 156
152 3300049570 Ga0501033_0235396 Ga0501033_0235396_41_652 156
153 3300049571 Ga0501034_0789700 Ga0501034_0789700_140_751 156
154 3300049582 Ga0501048_0400346 Ga0501048_0400346_350_961 156
155 3300049743 Ga0501081_0659569 Ga0501081_0659569_187_729 156
156 3300005339 Ga0070660_100466759 Ga0070660_1004667592 157
157 3300005366 Ga0070659_100018629 Ga0070659_1000186297 157
158 3300005434 Ga0070709_10077124 Ga0070709_100771242 157
159 3300005437 Ga0070710_10007182 Ga0070710_100071822 157
160 3300025253 Ga0209677_102510 Ga0209677_1025103 157
161 3300025295 Ga0209564_1000321 Ga0209564_100032138 157
162 3300025915 Ga0207693_10006870 Ga0207693_100068705 157
163 3300025919 Ga0207657_10417169 Ga0207657_104171692 157
164 3300025932 Ga0207690_10029000 Ga0207690_100290004 157
165 3300025949 Ga0207667_10041162 Ga0207667_100411625 157
166 3300031238 Ga0265332_10067376 Ga0265332_100673762 157
167 3300031241 Ga0265325_10007580 Ga0265325_100075802 157
168 3300031250 Ga0265331_10092647 Ga0265331_100926472 157
169 3300031711 Ga0265314_10075262 Ga0265314_100752621 157
170 3300031712 Ga0265342_10089155 Ga0265342_100891552 157
171 3300045976 Ga0466967_0080769 Ga0466967_0080769_1059_1637 157
172 3300046473 Ga0495582_0332741 Ga0495582_0332741_74_667 157
173 3300046683 Ga0495658_0492310 Ga0495658_0492310_87_680 157
174 3300048929 Ga0496126_0114722 Ga0496126_0114722_470_1054 157
175 3300048929 Ga0496126_0383587 Ga0496126_0383587_406_1005 157
176 3300049574 Ga0501038_0271795 Ga0501038_0271795_263_874 157
177 3300053145 Ga0500586_000605 Ga0500586_000605_901_1494 157
178 3300005439 Ga0070711_100096489 Ga0070711_1000964892 158
179 3300005983 Ga0081540_1042824 Ga0081540_10428242 158
180 3300006844 Ga0075428_100028368 Ga0075428_1000283686 158
181 3300009094 Ga0111539_11754008 Ga0111539_117540081 158
182 3300009147 Ga0114129_10030378 Ga0114129_100303789 158
183 3300021377 Ga0213874_10100383 Ga0213874_101003832 158
184 3300025916 Ga0207663_10159321 Ga0207663_101593212 158
185 3300027671 Ga0209588_1014784 Ga0209588_10147841 158
186 3300031711 Ga0265314_10051931 Ga0265314_100519312 158
187 3300031712 Ga0265342_10087584 Ga0265342_100875841 158
188 3300033180 Ga0307510_10082383 Ga0307510_100823833 158
189 3300036401 Ga0373937_0207495 Ga0373937_0207495_329_922 158
190 3300037466 Ga0395898_1094820 Ga0395898_1094820_119_679 158
191 3300037853 Ga0436364_1330873 Ga0436364_1330873_366_950 158
192 3300039450 Ga0436363_0585583 Ga0436363_0585583_275_874 158
193 3300049583 Ga0501067_0030191 Ga0501067_0030191_758_1342 158
194 3300049589 Ga0501073_0394038 Ga0501073_0394038_225_809 158
195 3300050507 nmdc:mga05p37_17593_c1 nmdc:mga05p37_17593_c1_1677_2234 158
196 3300050510 nmdc:mga06r32_251093_c1 nmdc:mga06r32_251093_c1_671_1228 158
197 3300005983 Ga0081540_1027038 Ga0081540_10270383 159
198 3300006028 Ga0070717_10500171 Ga0070717_105001711 159
199 3300006178 Ga0075367_10144805 Ga0075367_101448052 159
200 3300025295 Ga0209564_1021625 Ga0209564_10216252 159
201 3300046660 Ga0495625_0117372 Ga0495625_0117372_621_1220 159
202 3300048915 Ga0496112_0014598 Ga0496112_0014598_1319_1906 159
203 3300048915 Ga0496112_0017956 Ga0496112_0017956_403_981 159
204 3300048919 Ga0496116_0007249 Ga0496116_0007249_5259_5855 159
205 3300048920 Ga0496117_0061528 Ga0496117_0061528_1750_2337 159
206 3300048921 Ga0496118_0006290 Ga0496118_0006290_2911_3498 159
207 3300048924 Ga0496121_0011522 Ga0496121_0011522_8925_9512 159
208 3300048924 Ga0496121_0205422 Ga0496121_0205422_52_642 159
209 3300050494 nmdc:mga06z11_93822_c1 nmdc:mga06z11_93822_c1_717_1313 159
210 3300053727 Ga0500611_016474 Ga0500611_016474_436_1035 159
211 3300003320 rootH2_10225439 rootH2_102254392 160
212 3300005327 Ga0070658_10053528 Ga0070658_100535283 160
213 3300005329 Ga0070683_100008779 Ga0070683_10000877910 160
214 3300005336 Ga0070680_100021698 Ga0070680_1000216984 160
215 3300005339 Ga0070660_100002843 Ga0070660_1000028438 160
216 3300005341 Ga0070691_10086145 Ga0070691_100861452 160
217 3300005458 Ga0070681_10048927 Ga0070681_100489274 160
218 3300005530 Ga0070679_100041621 Ga0070679_1000416212 160
219 3300005535 Ga0070684_100006680 Ga0070684_10000668010 160
220 3300005539 Ga0068853_100002454 Ga0068853_10000245415 160
221 3300005563 Ga0068855_100006336 Ga0068855_10000633612 160
222 3300005577 Ga0068857_100017087 Ga0068857_1000170872 160
223 3300005577 Ga0068857_101121740 Ga0068857_1011217402 160
224 3300005616 Ga0068852_100040747 Ga0068852_1000407473 160
225 3300009093 Ga0105240_10059068 Ga0105240_100590683 160
226 3300009545 Ga0105237_10008146 Ga0105237_100081464 160
227 3300010375 Ga0105239_10023840 Ga0105239_100238408 160
228 3300013105 Ga0157369_10001511 Ga0157369_1000151122 160
229 3300021377 Ga0213874_10079472 Ga0213874_100794722 160
230 3300025909 Ga0207705_10147708 Ga0207705_101477082 160
231 3300025912 Ga0207707_10004287 Ga0207707_1000428711 160
232 3300025913 Ga0207695_10015308 Ga0207695_100153085 160
233 3300025914 Ga0207671_10009240 Ga0207671_100092402 160
234 3300025917 Ga0207660_10001366 Ga0207660_100013666 160
235 3300025919 Ga0207657_10001686 Ga0207657_1000168610 160
236 3300025920 Ga0207649_10030607 Ga0207649_100306072 160
237 3300025921 Ga0207652_10001889 Ga0207652_100018892 160
238 3300025944 Ga0207661_10007064 Ga0207661_100070642 160
239 3300025949 Ga0207667_10002324 Ga0207667_1000232417 160
240 3300026041 Ga0207639_10018895 Ga0207639_100188952 160
241 3300026116 Ga0207674_10042259 Ga0207674_100422593 160
242 3300026142 Ga0207698_10119810 Ga0207698_101198102 160
243 3300031456 Ga0307513_10484819 Ga0307513_104848191 160
244 3300035118 Ga0373954_0030161 Ga0373954_0030161_1357_1959 160
245 3300049574 Ga0501038_0025760 Ga0501038_0025760_4405_4986 160
246 3300049583 Ga0501067_0141419 Ga0501067_0141419_507_1070 160
247 3300049589 Ga0501073_0322545 Ga0501073_0322545_267_848 160
248 3300053148 Ga0500590_048836 Ga0500590_048836_1093_1689 160
249 3300053177 Ga0500636_0002876 Ga0500636_0002876_7334_7930 160
250 3300061719 Ga0466962_0302444 Ga0466962_0302444_80_667 160
251 3300031249 Ga0265339_10283210 Ga0265339_102832102 161
252 3300041509 Ga0451843_0100938 Ga0451843_0100938_225_821 161
253 3300046462 Ga0495651_0066225 Ga0495651_0066225_1899_2498 161
254 3300046472 Ga0495580_0121568 Ga0495580_0121568_30_560 161
255 3300046517 Ga0495630_0288859 Ga0495630_0288859_660_1223 161
256 3300046536 Ga0495587_0268912 Ga0495587_0268912_276_842 161
257 3300046679 Ga0495623_0061076 Ga0495623_0061076_1596_2195 161
258 3300048904 Ga0496101_0276283 Ga0496101_0276283_522_1112 161
259 3300048924 Ga0496121_0235297 Ga0496121_0235297_228_818 161
260 3300048929 Ga0496126_0131444 Ga0496126_0131444_1092_1682 161
261 3300005539 Ga0068853_100120254 Ga0068853_1001202542 162
262 3300013104 Ga0157370_10192063 Ga0157370_101920632 162
263 3300013105 Ga0157369_10003829 Ga0157369_100038295 162
264 3300025904 Ga0207647_10262530 Ga0207647_102625302 162
265 3300025906 Ga0207699_10017128 Ga0207699_100171282 162
266 3300025913 Ga0207695_10150514 Ga0207695_101505142 162
267 3300025939 Ga0207665_10027297 Ga0207665_100272972 162
268 3300026041 Ga0207639_10091736 Ga0207639_100917362 162
269 3300036401 Ga0373937_0103533 Ga0373937_0103533_1704_2231 162
270 3300037068 Ga0373925_0016468 Ga0373925_0016468_1398_1991 162
271 3300037068 Ga0373925_0756652 Ga0373925_0756652_29_628 162
272 3300046462 Ga0495651_0074316 Ga0495651_0074316_1757_2284 162
273 3300046675 Ga0495657_0188178 Ga0495657_0188178_682_1209 162
274 3300048918 Ga0496115_0443847 Ga0496115_0443847_23_616 162
275 3300049571 Ga0501034_0068618 Ga0501034_0068618_2275_2856 162
276 3300005937 Ga0081455_10003646 Ga0081455_1000364613 163
277 3300005937 Ga0081455_10268756 Ga0081455_102687562 163
278 3300014325 Ga0163163_11445652 Ga0163163_114456521 163
279 3300014969 Ga0157376_11270606 Ga0157376_112706062 163
280 3300025916 Ga0207663_10533530 Ga0207663_105335301 163
281 3300045976 Ga0466967_0295084 Ga0466967_0295084_354_932 163
282 3300046690 Ga0495624_0199394 Ga0495624_0199394_314_904 163
283 3300048924 Ga0496121_0038959 Ga0496121_0038959_3343_3951 163
284 3300005327 Ga0070658_10303827 Ga0070658_103038272 164
285 3300005329 Ga0070683_100140016 Ga0070683_1001400162 164
286 3300005331 Ga0070670_100293900 Ga0070670_1002939002 164
287 3300005338 Ga0068868_100019259 Ga0068868_1000192592 164
288 3300005355 Ga0070671_100520918 Ga0070671_1005209182 164
289 3300005364 Ga0070673_100326205 Ga0070673_1003262052 164
290 3300005364 Ga0070673_100381686 Ga0070673_1003816862 164
291 3300005436 Ga0070713_100062589 Ga0070713_1000625893 164
292 3300005436 Ga0070713_100342146 Ga0070713_1003421462 164
293 3300005455 Ga0070663_100001666 Ga0070663_1000016667 164
294 3300005456 Ga0070678_100055673 Ga0070678_1000556733 164
295 3300005466 Ga0070685_10403969 Ga0070685_104039692 164
296 3300005535 Ga0070684_100606735 Ga0070684_1006067351 164
297 3300005539 Ga0068853_100081722 Ga0068853_1000817222 164
298 3300005564 Ga0070664_100052242 Ga0070664_1000522422 164
299 3300005616 Ga0068852_100080223 Ga0068852_1000802232 164
300 3300005834 Ga0068851_10222223 Ga0068851_102222232 164
301 3300005840 Ga0068870_10496638 Ga0068870_104966381 164
302 3300006175 Ga0070712_100175883 Ga0070712_1001758831 164
303 3300006237 Ga0097621_100147183 Ga0097621_1001471832 164
304 3300006881 Ga0068865_100043307 Ga0068865_1000433073 164
305 3300009098 Ga0105245_10027626 Ga0105245_100276261 164
306 3300009148 Ga0105243_10581901 Ga0105243_105819012 164
307 3300009177 Ga0105248_11591516 Ga0105248_115915161 164
308 3300009545 Ga0105237_10155815 Ga0105237_101558152 164
309 3300010375 Ga0105239_10025568 Ga0105239_100255686 164
310 3300011119 Ga0105246_10005044 Ga0105246_100050448 164
311 3300013296 Ga0157374_10032796 Ga0157374_100327962 164
312 3300013306 Ga0163162_10073409 Ga0163162_100734093 164
313 3300014325 Ga0163163_10097005 Ga0163163_100970052 164
314 3300014968 Ga0157379_10573455 Ga0157379_105734552 164
315 3300014969 Ga0157376_10017080 Ga0157376_100170803 164
316 3300025901 Ga0207688_10156875 Ga0207688_101568752 164
317 3300025908 Ga0207643_10634306 Ga0207643_106343061 164
318 3300025914 Ga0207671_10196493 Ga0207671_101964932 164
319 3300025915 Ga0207693_10033379 Ga0207693_100333793 164
320 3300025920 Ga0207649_10154429 Ga0207649_101544292 164
321 3300025925 Ga0207650_10308617 Ga0207650_103086172 164
322 3300025928 Ga0207700_10209738 Ga0207700_102097382 164
323 3300025931 Ga0207644_10493923 Ga0207644_104939232 164
324 3300025935 Ga0207709_10435986 Ga0207709_104359862 164
325 3300025937 Ga0207669_10923180 Ga0207669_109231802 164
326 3300025938 Ga0207704_10204239 Ga0207704_102042392 164
327 3300025940 Ga0207691_10434778 Ga0207691_104347782 164
328 3300025944 Ga0207661_10079544 Ga0207661_100795442 164
329 3300025960 Ga0207651_10286449 Ga0207651_102864492 164
330 3300026023 Ga0207677_10186551 Ga0207677_101865512 164
331 3300026067 Ga0207678_10004832 Ga0207678_1000483211 164
332 3300026121 Ga0207683_10065230 Ga0207683_100652302 164
333 3300026121 Ga0207683_10121753 Ga0207683_101217532 164
334 3300026142 Ga0207698_10225416 Ga0207698_102254162 164
335 3300036534 Ga0310109_032717 Ga0310109_032717_35_616 164
336 3300041512 Ga0451853_0145000 Ga0451853_0145000_20_619 164
337 3300046455 Ga0495603_0053181 Ga0495603_0053181_866_1459 164
338 3300046477 Ga0495664_0085857 Ga0495664_0085857_619_1215 164
339 3300046507 Ga0495606_0283901 Ga0495606_0283901_190_789 164
340 3300046531 Ga0495665_0226831 Ga0495665_0226831_249_842 164
341 3300046674 Ga0495588_0026270 Ga0495588_0026270_1899_2492 164
342 3300046680 Ga0495646_0219014 Ga0495646_0219014_57_656 164
343 3300047315 Ga0495581_0013345 Ga0495581_0013345_1839_2432 164
344 3300048903 Ga0496100_0009441 Ga0496100_0009441_407_1006 164
345 3300048906 Ga0496103_0013725 Ga0496103_0013725_562_1161 164
346 3300048907 Ga0496104_0959185 Ga0496104_0959185_92_691 164
347 3300048908 Ga0496105_0173428 Ga0496105_0173428_1080_1679 164
348 3300048909 Ga0496106_0001014 Ga0496106_0001014_12747_13346 164
349 3300048910 Ga0496107_0017012 Ga0496107_0017012_4055_4654 164
350 3300048913 Ga0496110_0042757 Ga0496110_0042757_1143_1742 164
351 3300048914 Ga0496111_0006861 Ga0496111_0006861_3938_4537 164
352 3300048915 Ga0496112_0000020 Ga0496112_0000020_70428_71009 164
353 3300048916 Ga0496113_0173056 Ga0496113_0173056_184_783 164
354 3300048918 Ga0496115_0006071 Ga0496115_0006071_6777_7376 164
355 3300049568 Ga0501031_0068936 Ga0501031_0068936_17_571 164
356 3300049569 Ga0501032_0029896 Ga0501032_0029896_2129_2683 164
357 3300049571 Ga0501034_0259298 Ga0501034_0259298_527_1081 164
358 3300049573 Ga0501037_0029001 Ga0501037_0029001_2397_2951 164
359 3300049574 Ga0501038_0004781 Ga0501038_0004781_7448_8002 164
360 3300049579 Ga0501043_0032205 Ga0501043_0032205_111_665 164
361 3300049580 Ga0501046_0129712 Ga0501046_0129712_353_907 164
362 3300049581 Ga0501047_0035895 Ga0501047_0035895_756_1310 164
363 3300049581 Ga0501047_0435218 Ga0501047_0435218_233_814 164
364 3300049589 Ga0501073_0021192 Ga0501073_0021192_959_1513 164
365 3300049742 Ga0501080_0302790 Ga0501080_0302790_601_1155 164
366 3300049744 Ga0501083_0213967 Ga0501083_0213967_318_872 164
367 3300049823 Ga0501044_0016928 Ga0501044_0016928_3577_4131 164
368 3300006942 Ga0099824_1011583 Ga0099824_10115835 165
369 3300025981 Ga0207640_10007128 Ga0207640_100071287 165
370 3300031616 Ga0307508_10000002 Ga0307508_1000000258 165
371 3300039447 Ga0436361_0960028 Ga0436361_0960028_743_1327 165
372 3300046524 Ga0495648_0000286 Ga0495648_0000286_19037_19633 165
373 3300046660 Ga0495625_0509150 Ga0495625_0509150_189_725 165
374 3300005456 Ga0070678_100040432 Ga0070678_1000404322 166
375 3300006358 Ga0068871_100518607 Ga0068871_1005186072 166
376 3300026121 Ga0207683_10080956 Ga0207683_100809562 166
377 3300035170 Ga0373943_0125811 Ga0373943_0125811_411_1007 166
378 3300048913 Ga0496110_0143414 Ga0496110_0143414_1495_2091 166
379 3300049570 Ga0501033_0029329 Ga0501033_0029329_1127_1738 166
380 3300049585 Ga0501069_0146412 Ga0501069_0146412_259_840 166
381 3300049822 Ga0501035_0171861 Ga0501035_0171861_172_753 166
382 3300049822 Ga0501035_0316061 Ga0501035_0316061_232_843 166
383 iso_pu_bacteria 2842694124 2842695522 166
384 3300005840 Ga0068870_10221503 Ga0068870_102215032 167
385 3300006038 Ga0075365_10178424 Ga0075365_101784242 167
386 3300035089 Ga0373944_0094719 Ga0373944_0094719_258_857 167
387 3300049580 Ga0501046_0149924 Ga0501046_0149924_429_1019 167
388 iso_pu_bacteria 8056681323 8056687408 167
389 3300031507 Ga0307509_10349367 Ga0307509_103493672 168
390 3300035083 Ga0373926_0088473 Ga0373926_0088473_173_775 168
391 3300035089 Ga0373944_0074090 Ga0373944_0074090_257_859 168
392 3300035113 Ga0373936_0030834 Ga0373936_0030834_388_990 168
393 3300035116 Ga0373945_0049250 Ga0373945_0049250_644_1246 168
394 3300035117 Ga0373953_0057059 Ga0373953_0057059_269_871 168
395 3300035120 Ga0373957_0052708 Ga0373957_0052708_647_1249 168
396 3300035170 Ga0373943_0005777 Ga0373943_0005777_2971_3573 168
397 3300035171 Ga0373946_0003273 Ga0373946_0003273_2552_3154 168
398 3300035172 Ga0373955_0003039 Ga0373955_0003039_4360_4962 168
399 3300035410 Ga0373924_0068403 Ga0373924_0068403_404_1006 168
400 3300035692 Ga0373935_0000953 Ga0373935_0000953_4852_5454 168
401 3300035695 Ga0373927_0001486 Ga0373927_0001486_9373_9975 168
402 3300035724 Ga0373933_0071544 Ga0373933_0071544_467_1069 168
403 3300035725 Ga0373947_0077646 Ga0373947_0077646_690_1292 168
404 3300037068 Ga0373925_0024914 Ga0373925_0024914_2752_3354 168
405 3300046454 Ga0495592_0023331 Ga0495592_0023331_2107_2709 168
406 3300046455 Ga0495603_0000047 Ga0495603_0000047_21930_22532 168
407 3300046459 Ga0495629_0000320 Ga0495629_0000320_21905_22507 168
408 3300046461 Ga0495641_0003618 Ga0495641_0003618_9336_9938 168
409 3300046462 Ga0495651_0490154 Ga0495651_0490154_91_693 168
410 3300046472 Ga0495580_0003812 Ga0495580_0003812_9280_9882 168
411 3300046473 Ga0495582_0000043 Ga0495582_0000043_53877_54479 168
412 3300046475 Ga0495639_0000091 Ga0495639_0000091_29469_30071 168
413 3300046499 Ga0495594_0000453 Ga0495594_0000453_11763_12365 168
414 3300046511 Ga0495608_0290544 Ga0495608_0290544_378_980 168
415 3300046514 Ga0495618_0051506 Ga0495618_0051506_1005_1607 168
416 3300046516 Ga0495628_0035958 Ga0495628_0035958_2822_3424 168
417 3300046517 Ga0495630_0008996 Ga0495630_0008996_839_1441 168
418 3300046526 Ga0495666_0010714 Ga0495666_0010714_2489_3091 168
419 3300046529 Ga0495652_0023709 Ga0495652_0023709_84_686 168
420 3300046531 Ga0495665_0001635 Ga0495665_0001635_7037_7639 168
421 3300046533 Ga0495640_0014392 Ga0495640_0014392_5099_5701 168
422 3300046535 Ga0495586_0083487 Ga0495586_0083487_494_1096 168
423 3300046557 Ga0495622_0002785 Ga0495622_0002785_2929_3531 168
424 3300046559 Ga0495667_0033079 Ga0495667_0033079_1614_2216 168
425 3300046642 Ga0495634_0007159 Ga0495634_0007159_4233_4835 168
426 3300046663 Ga0495635_0001788 Ga0495635_0001788_7604_8206 168
427 3300046674 Ga0495588_0090752 Ga0495588_0090752_211_813 168
428 3300046681 Ga0495647_0001913 Ga0495647_0001913_2649_3251 168
429 3300046683 Ga0495658_0003457 Ga0495658_0003457_182_784 168
430 3300046689 Ga0495613_0001794 Ga0495613_0001794_7111_7713 168
431 3300046690 Ga0495624_0000694 Ga0495624_0000694_17483_18085 168
432 3300047315 Ga0495581_0000486 Ga0495581_0000486_15406_16008 168
433 3300047317 Ga0495604_0135425 Ga0495604_0135425_1048_1650 168
434 3300047319 Ga0495674_0003925 Ga0495674_0003925_9596_10198 168
435 3300047321 Ga0495676_0017241 Ga0495676_0017241_1578_2180 168
436 3300047673 Ga0495593_0000005 Ga0495593_0000005_17421_18023 168
437 3300048089 Ga0495614_0067842 Ga0495614_0067842_519_1121 168
438 3300048917 Ga0496114_0121382 Ga0496114_0121382_945_1523 168
439 3300048918 Ga0496115_0008492 Ga0496115_0008492_567_1160 168
440 3300048918 Ga0496115_0106653 Ga0496115_0106653_1522_2100 168
441 3300048929 Ga0496126_0146376 Ga0496126_0146376_575_1153 168
442 3300048929 Ga0496126_0703885 Ga0496126_0703885_66_659 168
443 3300049568 Ga0501031_0653368 Ga0501031_0653368_19_612 168
444 3300049571 Ga0501034_0112843 Ga0501034_0112843_38_631 168
445 3300049579 Ga0501043_0493989 Ga0501043_0493989_73_666 168
446 3300049586 Ga0501070_0180710 Ga0501070_0180710_337_930 168
447 3300049823 Ga0501044_0169111 Ga0501044_0169111_508_1101 168
448 3300050494 nmdc:mga06z11_483241_c1 nmdc:mga06z11_483241_c1_38_592 168
449 3300053085 Ga0495619_0107222 Ga0495619_0107222_172_774 168
450 iso_pu_bacteria 2667528175 2671119958 168
451 iso_pu_bacteria 2908756301 2908756601 168
452 3300005937 Ga0081455_10074562 Ga0081455_100745623 169
453 3300028794 Ga0307515_10102060 Ga0307515_101020602 169
454 3300045049 Ga0466959_0294512 Ga0466959_0294512_139_723 169
455 3300047444 Ga0495675_0494131 Ga0495675_0494131_11_607 169
456 iso_pu_bacteria 2513237096 2513658799 169
457 iso_pu_bacteria 2513237137 2513860806 169
458 iso_pu_bacteria 2513237145 2513921063 169
459 iso_pu_bacteria 2517572143 2517888828 169
460 iso_pu_bacteria 2791355197 2793072916 169
461 iso_pu_bacteria 2885374607 2885376154 169
462 iso_pu_bacteria 2904690495 2904691205 169
463 iso_pu_bacteria 2906610324 2906613859 169
464 iso_pu_bacteria 2908739725 2908747429 169
465 iso_pu_bacteria 2935630451 2935635527 169
466 iso_pu_bacteria 2941507105 2941512176 169
467 iso_pu_bacteria 2941515067 2941519878 169
468 iso_pu_bacteria 2941523033 2941528181 169
469 iso_pu_bacteria 8006933436 8006936249 169
470 iso_pu_bacteria 8006973647 8006976194 169
471 iso_pu_bacteria 8056689827 8056693388 169
472 3300005563 Ga0068855_100388660 Ga0068855_1003886602 170
473 3300013306 Ga0163162_10132028 Ga0163162_101320281 170
474 3300013308 Ga0157375_10533019 Ga0157375_105330192 170
475 3300014969 Ga0157376_10173362 Ga0157376_101733622 170
476 3300031238 Ga0265332_10055621 Ga0265332_100556211 170
477 3300031249 Ga0265339_10147882 Ga0265339_101478822 170
478 3300031616 Ga0307508_10253584 Ga0307508_102535842 170
479 3300031711 Ga0265314_10128993 Ga0265314_101289932 170
480 3300031712 Ga0265342_10003978 Ga0265342_100039785 170
481 3300046472 Ga0495580_0324810 Ga0495580_0324810_27_620 170
482 3300046537 Ga0495598_0051282 Ga0495598_0051282_533_1090 170
483 3300046684 Ga0495669_0066375 Ga0495669_0066375_804_1361 170
484 3300046692 Ga0495671_0155510 Ga0495671_0155510_408_965 170
485 3300048924 Ga0496121_0043240 Ga0496121_0043240_1016_1603 170
486 3300049586 Ga0501070_0348200 Ga0501070_0348200_85_657 170
487 3300049589 Ga0501073_0720508 Ga0501073_0720508_72_644 170
488 3300049590 Ga0501074_0270702 Ga0501074_0270702_38_610 170
489 3300049592 Ga0501076_0784943 Ga0501076_0784943_29_601 170
490 3300049741 Ga0501079_0773910 Ga0501079_0773910_56_628 170
491 3300049742 Ga0501080_0659052 Ga0501080_0659052_223_792 170
492 iso_pu_bacteria 2903768456 2903770776 170
493 iso_pu_bacteria 2906660503 2906667375 170
494 iso_pu_bacteria 2922425934 2922434240 170
495 iso_pu_bacteria 3005474847 3005475047 170
496 iso_pu_bacteria 8019565922 8019572465 170
497 3300005435 Ga0070714_100017816 Ga0070714_1000178166 171
498 3300005436 Ga0070713_100002424 Ga0070713_10000242413 171
499 3300006028 Ga0070717_10000598 Ga0070717_1000059811 171
500 3300025928 Ga0207700_10001725 Ga0207700_100017252 171
501 3300025929 Ga0207664_10179492 Ga0207664_101794922 171
502 3300037466 Ga0395898_0554458 Ga0395898_0554458_213_824 171
503 3300049571 Ga0501034_0507789 Ga0501034_0507789_10_621 171
504 3300049823 Ga0501044_0156073 Ga0501044_0156073_1523_2134 171
505 iso_pu_bacteria 2602042107 2603858511 171
506 iso_pu_bacteria 2857524615 2857526367 171
507 3300009148 Ga0105243_10469394 Ga0105243_104693941 172
508 3300009545 Ga0105237_10535283 Ga0105237_105352831 172
509 3300009551 Ga0105238_10044535 Ga0105238_100445354 172
510 3300025924 Ga0207694_10190375 Ga0207694_101903752 172
511 3300026067 Ga0207678_10636021 Ga0207678_106360211 172
512 3300031090 Ga0265760_10132173 Ga0265760_101321732 172
513 3300031239 Ga0265328_10230355 Ga0265328_102303552 172
514 3300031249 Ga0265339_10104524 Ga0265339_101045242 172
515 3300031711 Ga0265314_10123022 Ga0265314_101230223 172
516 3300035083 Ga0373926_0222739 Ga0373926_0222739_32_625 172
517 3300037068 Ga0373925_0248894 Ga0373925_0248894_491_1084 172
518 3300037312 Ga0395899_0676245 Ga0395899_0676245_25_612 172
519 3300037471 Ga0395905_0022009 Ga0395905_0022009_2406_2993 172
520 3300005436 Ga0070713_100130990 Ga0070713_1001309902 173
521 3300005439 Ga0070711_100369322 Ga0070711_1003693222 173
522 3300006175 Ga0070712_100667749 Ga0070712_1006677491 173
523 3300009101 Ga0105247_10969056 Ga0105247_109690561 173
524 3300011119 Ga0105246_10405568 Ga0105246_104055681 173
525 3300025915 Ga0207693_10288046 Ga0207693_102880462 173
526 3300025916 Ga0207663_10329526 Ga0207663_103295262 173
527 3300025928 Ga0207700_10263485 Ga0207700_102634852 173
528 3300031249 Ga0265339_10001062 Ga0265339_1000106210 173
529 3300035117 Ga0373953_0001445 Ga0373953_0001445_5368_5958 173
530 3300035120 Ga0373957_0141557 Ga0373957_0141557_361_951 173
531 3300035172 Ga0373955_0087088 Ga0373955_0087088_1115_1705 173
532 3300035410 Ga0373924_0074022 Ga0373924_0074022_644_1234 173
533 3300035692 Ga0373935_0014847 Ga0373935_0014847_2947_3537 173
534 3300035724 Ga0373933_0021586 Ga0373933_0021586_643_1233 173
535 3300036401 Ga0373937_0135717 Ga0373937_0135717_1666_2256 173
536 3300046454 Ga0495592_0015319 Ga0495592_0015319_2438_3028 173
537 3300046462 Ga0495651_0021262 Ga0495651_0021262_974_1564 173
538 3300046463 Ga0495653_0025800 Ga0495653_0025800_4100_4690 173
539 3300046476 Ga0495662_0073977 Ga0495662_0073977_595_1185 173
540 3300046514 Ga0495618_0058501 Ga0495618_0058501_1800_2390 173
541 3300046516 Ga0495628_0041630 Ga0495628_0041630_2148_2738 173
542 3300046529 Ga0495652_0035518 Ga0495652_0035518_1403_1993 173
543 3300046533 Ga0495640_0027351 Ga0495640_0027351_1616_2206 173
544 3300046535 Ga0495586_0225174 Ga0495586_0225174_197_787 173
545 3300046536 Ga0495587_0031015 Ga0495587_0031015_758_1348 173
546 3300046543 Ga0495645_0052917 Ga0495645_0052917_2184_2774 173
547 3300046559 Ga0495667_0046486 Ga0495667_0046486_2054_2644 173
548 3300046642 Ga0495634_0018995 Ga0495634_0018995_179_769 173
549 3300046660 Ga0495625_0199172 Ga0495625_0199172_192_788 173
550 3300046663 Ga0495635_0053495 Ga0495635_0053495_1193_1783 173
551 3300046675 Ga0495657_0036727 Ga0495657_0036727_575_1165 173
552 3300046678 Ga0495599_0346792 Ga0495599_0346792_83_673 173
553 3300046679 Ga0495623_0062183 Ga0495623_0062183_43_633 173
554 3300046680 Ga0495646_0023490 Ga0495646_0023490_2280_2870 173
555 3300046689 Ga0495613_0311264 Ga0495613_0311264_464_1054 173
556 3300046809 Ga0495600_0019133 Ga0495600_0019133_2445_3035 173
557 3300047317 Ga0495604_0023259 Ga0495604_0023259_38_628 173
558 3300047319 Ga0495674_0010066 Ga0495674_0010066_1131_1721 173
559 3300047322 Ga0495680_0025482 Ga0495680_0025482_2659_3249 173
560 3300047471 Ga0495684_0011974 Ga0495684_0011974_4712_5302 173
561 3300048905 Ga0496102_0138248 Ga0496102_0138248_1171_1752 173
562 3300048907 Ga0496104_0070776 Ga0496104_0070776_443_1024 173
563 3300048909 Ga0496106_0194116 Ga0496106_0194116_582_1163 173
564 3300048911 Ga0496108_0900667 Ga0496108_0900667_89_676 173
565 3300048912 Ga0496109_0570050 Ga0496109_0570050_310_891 173
566 3300048913 Ga0496110_0351812 Ga0496110_0351812_543_1124 173
567 3300048917 Ga0496114_0140197 Ga0496114_0140197_916_1497 173
568 3300049586 Ga0501070_0580235 Ga0501070_0580235_57_665 173
569 3300049741 Ga0501079_0462315 Ga0501079_0462315_223_807 173
570 3300053077 Ga0495601_0104443 Ga0495601_0104443_184_774 173
571 3300053078 Ga0495612_0135872 Ga0495612_0135872_369_959 173
572 3300053084 Ga0495595_0117164 Ga0495595_0117164_320_910 173
573 3300053085 Ga0495619_0192709 Ga0495619_0192709_167_742 173
574 3300005435 Ga0070714_100289313 Ga0070714_1002893131 174
575 3300025929 Ga0207664_11033118 Ga0207664_110331181 174
576 3300026089 Ga0207648_10491817 Ga0207648_104918172 174
577 3300048905 Ga0496102_0359795 Ga0496102_0359795_557_1147 174
578 3300048929 Ga0496126_0028457 Ga0496126_0028457_4452_5057 174
579 3300053178 Ga0500637_0233599 Ga0500637_0233599_121_720 174
580 3300001976 JGI24752J21851_1002755 JGI24752J21851_10027553 181
581 3300001977 JGI24746J21847_1000148 JGI24746J21847_100014812 181
582 3300005329 Ga0070683_100588867 Ga0070683_1005888672 181
583 3300005458 Ga0070681_10114542 Ga0070681_101145423 181
584 3300005535 Ga0070684_100258767 Ga0070684_1002587672 181
585 3300009174 Ga0105241_10003924 Ga0105241_100039248 181
586 3300009551 Ga0105238_10587821 Ga0105238_105878212 181
587 3300010375 Ga0105239_10028016 Ga0105239_100280164 181
588 3300011119 Ga0105246_10000052 Ga0105246_100000529 181
589 3300013297 Ga0157378_10002713 Ga0157378_1000271311 181
590 3300025912 Ga0207707_10017763 Ga0207707_100177632 181
591 3300025912 Ga0207707_10192350 Ga0207707_101923502 181
592 3300025921 Ga0207652_11096162 Ga0207652_110961621 181
593 3300025944 Ga0207661_10523075 Ga0207661_105230751 181
594 3300035115 Ga0373941_0007472 Ga0373941_0007472_649_1194 181
595 3300046491 Ga0495584_0029790 Ga0495584_0029790_1902_2447 181
596 3300048918 Ga0496115_0003980 Ga0496115_0003980_8292_8837 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01713

Smr

Smr domain

114

200

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zqe-assembly1.cif.gz_A crystal structure of the smr domain of thermus thermophilus muts2 0.9299 90 175
4od6-assembly1.cif.gz_A structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked 0.9162 87 176
4od6-assembly1.cif.gz_A structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked 0.9058 87 176
2zqe-assembly1.cif.gz_A crystal structure of the smr domain of thermus thermophilus muts2 0.8971 90 175
3qd7-assembly1.cif.gz_X crystal structure of ydal, a stand-alone small muts-related protein from escherichia coli 0.8718 91 176
ID Description Score Start End Superfamily
2zqeA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9299 90 175 3.30.1370.110
2zqeA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8971 90 175 3.30.1370.110
3qd7X00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8718 91 176 3.30.1370.110
af_Q59Z54_97_175_3.30.1370.110 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8606 91 173 3.30.1370.110
af_P0A8B2_49_176_3.30.1370.110 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8255 74 178 3.30.1370.110
ID Description Score Start End GO Terms
AF-A0A2E1MV02-F1-model_v4 Smr domain-containing protein 0.9684 68 177
AF-A0A529XGE5-F1-model_v4 deleted 0.9659 75 179
AF-A0A527CTZ6-F1-model_v4 DNA mismatch repair protein MutS 0.9654 72 165
AF-A0A529HLL7-F1-model_v4 DNA mismatch repair protein MutS 0.9638 72 179
AF-A0A537N767-F1-model_v4 DNA mismatch repair protein MutS 0.9553 67 180

Feature Viewer

pLDDT pTM Quality
68.91 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map