F467591

General Info

Members Datasets Scaffolds Average Seq Length
596 250 573 255

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0022024|Ga0496102_0022024_4572_5417
Length 227
Sequence MTLRAAYPRLFGQLERPVGTLSRIGDHTLFYGKALAAAPFAAVHYRREVIRLIAEISMGAGTLAMIGGTVVIVGFLTLALAAFINVRISAPVVVGIGLAATLGAMRINEEIDALESMAIRPISYLVSTRILAGMLAITPLYSIAVILSFVASQFTTTFLLGQSSGLYEHYFDTFLNPIDLLWSFLQAILMALTVLLIHTYYGYFASGGPAGVGVATYGSNGNFNLSG

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
4 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
5 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
6 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
7 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
8 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
9 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
10 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
11 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
12 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
13 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
14 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
15 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
16 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
17 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
18 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
237 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
238 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.14
Metatranscriptomes 0
Isolates 3.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.28
Nodule 0.34
Rhizoplane 11.58
Rhizosphere 58.56
Stem 0
Stem Tuber 0
Unclassified 12.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1019144 3300001977 Bacteria 966
2 JGI24745J21846_1008886 3300002073 Bacteria 1135
3 JGI24744J21845_10001615 3300002077 Bacteria 4504
4 JGI24744J21845_10026482 3300002077 Bacteria 1126
5 JGI24742J22300_10001612 3300002244 Bacteria 3589
6 rootH1_10058904 3300003323 Bacteria 1045
7 Ga0055540_1000114 3300003792 Bacteria 85049
8 Ga0070676_10025540 3300005328 Bacteria 3340
9 Ga0070666_10002316 3300005335 Bacteria 11516
10 Ga0070666_10004732 3300005335 Bacteria 8324
11 Ga0070682_100028488 3300005337 Bacteria 3359
12 Ga0070682_100401983 3300005337 Bacteria 1036
13 Ga0068868_100000872 3300005338 Bacteria 20434
14 Ga0068868_100040048 3300005338 Bacteria 3645
15 Ga0068868_100077906 3300005338 Bacteria 2653
16 Ga0070689_100173517 3300005340 Bacteria 1748
17 Ga0070692_10031475 3300005345 Bacteria 2660
18 Ga0070668_100000967 3300005347 Bacteria 20100
19 Ga0070668_100002095 3300005347 Bacteria 14582
20 Ga0070668_100179993 3300005347 Bacteria 1726
21 Ga0070668_100405937 3300005347 Bacteria 1164
22 Ga0070669_100001809 3300005353 Bacteria 15403
23 Ga0070669_100013118 3300005353 Bacteria 5889
24 Ga0070669_100025047 3300005353 Bacteria 4283
25 Ga0070674_100026665 3300005356 Bacteria 3778
26 Ga0070667_100000073 3300005367 Bacteria 122757
27 Ga0070667_100000375 3300005367 Bacteria 48917
28 Ga0070667_100000854 3300005367 Bacteria 28370
29 Ga0070667_100011620 3300005367 Bacteria 7279
30 Ga0070667_100020125 3300005367 Bacteria 5540
31 Ga0070667_100044166 3300005367 Bacteria 3741
32 Ga0070667_100191778 3300005367 Bacteria 1811
33 Ga0070709_10062243 3300005434 Bacteria 2378
34 Ga0070714_100009714 3300005435 Bacteria 7579
35 Ga0070714_100193987 3300005435 Bacteria 1855
36 Ga0070714_100216039 3300005435 Bacteria 1760
37 Ga0070714_100653850 3300005435 Bacteria 1012
38 Ga0070701_10005569 3300005438 Bacteria 5214
39 Ga0070711_100005079 3300005439 Bacteria 7834
40 Ga0070705_100094393 3300005440 Bacteria 1873
41 Ga0070700_100000673 3300005441 Bacteria 16897
42 Ga0070663_100102007 3300005455 Bacteria 2143
43 Ga0070678_100000501 3300005456 Bacteria 18833
44 Ga0070678_100049191 3300005456 Bacteria 3041
45 Ga0070678_100224376 3300005456 Bacteria 1563
46 Ga0070662_100119553 3300005457 Bacteria 2018
47 Ga0070685_10170877 3300005466 Bacteria 1393
48 Ga0068853_100045447 3300005539 Bacteria 3761
49 Ga0068853_100230570 3300005539 Bacteria 1694
50 Ga0070695_100003872 3300005545 Bacteria 8731
51 Ga0070696_100018139 3300005546 Bacteria 4754
52 Ga0070665_100003119 3300005548 Bacteria 17854
53 Ga0070665_100023969 3300005548 Bacteria 6146
54 Ga0070665_100064781 3300005548 Bacteria 3666
55 Ga0070665_100100402 3300005548 Bacteria 2898
56 Ga0070704_100006899 3300005549 Bacteria 6728
57 Ga0070704_100017112 3300005549 Bacteria 4601
58 Ga0068854_100002376 3300005578 Bacteria 11615
59 Ga0068854_100030765 3300005578 Bacteria 3726
60 Ga0068852_100125564 3300005616 Bacteria 2356
61 Ga0068852_100641743 3300005616 Bacteria 1069
62 Ga0068859_100000223 3300005617 Bacteria 56082
63 Ga0068859_100022919 3300005617 Bacteria 6261
64 Ga0068859_100048579 3300005617 Bacteria 4262
65 Ga0068866_10005440 3300005718 Bacteria 5254
66 Ga0068861_100009189 3300005719 Bacteria 6817
67 Ga0068861_100285445 3300005719 Bacteria 1423
68 Ga0068863_100000194 3300005841 Bacteria 64797
69 Ga0068863_100001282 3300005841 Bacteria 25087
70 Ga0068863_100015314 3300005841 Bacteria 7370
71 Ga0068863_100049492 3300005841 Bacteria 3985
72 Ga0068858_100004857 3300005842 Bacteria 13182
73 Ga0068858_100014482 3300005842 Bacteria 7431
74 Ga0068858_100034967 3300005842 Bacteria 4661
75 Ga0068858_100048495 3300005842 Bacteria 3935
76 Ga0068860_100000127 3300005843 Bacteria 122766
77 Ga0068860_100000489 3300005843 Bacteria 48927
78 Ga0068860_100007031 3300005843 Bacteria 11270
79 Ga0068862_100000052 3300005844 Bacteria 144622
80 Ga0068862_100000054 3300005844 Bacteria 143584
81 Ga0081455_10013814 3300005937 Bacteria 7946
82 Ga0081455_10063501 3300005937 Bacteria 3099
83 Ga0081455_10144176 3300005937 Bacteria 1845
84 Ga0081538_10051144 3300005981 Bacteria 2485
85 Ga0075365_10011205 3300006038 Bacteria 5264
86 Ga0075365_10011975 3300006038 Bacteria 5125
87 Ga0075365_10038637 3300006038 Bacteria 3104
88 Ga0075365_10047917 3300006038 Bacteria 2810
89 Ga0075365_10077520 3300006038 Bacteria 2245
90 Ga0075365_10129604 3300006038 Bacteria 1745
91 Ga0075368_10066884 3300006042 Bacteria 1446
92 Ga0075363_100012872 3300006048 Bacteria 4039
93 Ga0075363_100017913 3300006048 Bacteria 3521
94 Ga0075363_100020733 3300006048 Bacteria 3300
95 Ga0075363_100044272 3300006048 Bacteria 2357
96 Ga0075364_10002408 3300006051 Bacteria 10494
97 Ga0075364_10010276 3300006051 Bacteria 5648
98 Ga0075364_10019906 3300006051 Bacteria 4217
99 Ga0075364_10020804 3300006051 Bacteria 4130
100 Ga0075364_10041921 3300006051 Bacteria 2973
101 Ga0075364_10084195 3300006051 Bacteria 2105
102 Ga0075364_10106943 3300006051 Bacteria 1864
103 Ga0075364_10159355 3300006051 Bacteria 1523
104 Ga0075364_10209230 3300006051 Bacteria 1323
105 Ga0075364_10214063 3300006051 Bacteria 1307
106 Ga0070712_100017551 3300006175 Bacteria 4635
107 Ga0075362_10060136 3300006177 Bacteria 1717
108 Ga0075367_10008166 3300006178 Bacteria 5409
109 Ga0075367_10046390 3300006178 Bacteria 2553
110 Ga0075367_10090325 3300006178 Bacteria 1863
111 Ga0075367_10125303 3300006178 Bacteria 1585
112 Ga0075369_10000399 3300006186 Bacteria 13127
113 Ga0075369_10003167 3300006186 Bacteria 5967
114 Ga0075369_10029401 3300006186 Bacteria 2308
115 Ga0075369_10105998 3300006186 Bacteria 1264
116 Ga0075370_10003177 3300006353 Bacteria 7774
117 Ga0075370_10008534 3300006353 Bacteria 5277
118 Ga0075370_10016931 3300006353 Bacteria 3931
119 Ga0075370_10032100 3300006353 Bacteria 2934
120 Ga0068871_100060452 3300006358 Bacteria 3091
121 Ga0075428_100005457 3300006844 Bacteria 14138
122 Ga0075430_100046684 3300006846 Bacteria 3658
123 Ga0075430_100053472 3300006846 Bacteria 3400
124 Ga0075430_100179874 3300006846 Bacteria 1759
125 Ga0075431_100208508 3300006847 Bacteria 1997
126 Ga0068865_100010057 3300006881 Bacteria 5885
127 Ga0068865_100011277 3300006881 Bacteria 5590
128 Ga0097620_100000223 3300006931 Bacteria 56082
129 Ga0097620_100022915 3300006931 Bacteria 6261
130 Ga0097620_100048581 3300006931 Bacteria 4262
131 Ga0105250_10039561 3300009092 Bacteria 1891
132 Ga0105245_10007994 3300009098 Bacteria 9250
133 Ga0105245_10014473 3300009098 Bacteria 6870
134 Ga0105245_10056782 3300009098 Bacteria 3519
135 Ga0105247_10000066 3300009101 Bacteria 121025
136 Ga0105247_10000085 3300009101 Bacteria 102010
137 Ga0105247_10005145 3300009101 Bacteria 8277
138 Ga0105247_10059758 3300009101 Bacteria 2361
139 Ga0105247_10191443 3300009101 Bacteria 1369
140 Ga0114129_10105830 3300009147 Bacteria 3887
141 Ga0105243_10011368 3300009148 Bacteria 6736
142 Ga0105241_10074223 3300009174 Bacteria 2648
143 Ga0105242_10040889 3300009176 Bacteria 3736
144 Ga0105248_10000144 3300009177 Bacteria 81953
145 Ga0105248_10002684 3300009177 Bacteria 19761
146 Ga0105248_10044259 3300009177 Bacteria 4993
147 Ga0105248_10169989 3300009177 Bacteria 2457
148 Ga0105248_10529610 3300009177 Bacteria 1329
149 Ga0105238_10290383 3300009551 Bacteria 1617
150 Ga0105238_10326299 3300009551 Bacteria 1521
151 Ga0105249_10000001 3300009553 Bacteria 504948
152 Ga0105249_10000093 3300009553 Bacteria 122840
153 Ga0105249_10207295 3300009553 Bacteria 1921
154 Ga0105249_10379623 3300009553 Bacteria 1439
155 Ga0105249_10410791 3300009553 Bacteria 1386
156 Ga0105239_10034683 3300010375 Bacteria 5543
157 Ga0105239_10125047 3300010375 Bacteria 2858
158 Ga0105239_10220039 3300010375 Bacteria 2129
159 Ga0105239_10235744 3300010375 Bacteria 2054
160 Ga0105246_10308644 3300011119 Bacteria 1281
161 Ga0157374_10005617 3300013296 Bacteria 10567
162 Ga0157378_10013845 3300013297 Bacteria 7054
163 Ga0157378_10112256 3300013297 Bacteria 2500
164 Ga0163162_10201778 3300013306 Bacteria 2117
165 Ga0157372_10005476 3300013307 Bacteria 13489
166 Ga0157372_10170887 3300013307 Bacteria 2515
167 Ga0157375_10015455 3300013308 Bacteria 6835
168 Ga0157375_10092156 3300013308 Bacteria 3093
169 Ga0163163_10013270 3300014325 Bacteria 7536
170 Ga0163163_10094025 3300014325 Bacteria 3015
171 Ga0163163_10567720 3300014325 Bacteria 1197
172 Ga0157380_10004687 3300014326 Bacteria 9523
173 Ga0157377_10011522 3300014745 Bacteria 4417
174 Ga0157379_10124454 3300014968 Bacteria 2320
175 Ga0157379_10322556 3300014968 Bacteria 1410
176 Ga0163161_10243111 3300017792 Bacteria 1400
177 Ga0163161_10260772 3300017792 Bacteria 1353
178 Ga0213876_10002703 3300021384 Bacteria 10336
179 Ga0213876_10038149 3300021384 Bacteria 2535
180 Ga0213876_10073321 3300021384 Bacteria 1808
181 Ga0209051_1000215 3300025303 Bacteria 97795
182 Ga0209051_1057883 3300025303 Bacteria 1239
183 Ga0207642_10001542 3300025899 Bacteria 7081
184 Ga0207642_10022914 3300025899 Bacteria 2485
185 Ga0207710_10000090 3300025900 Bacteria 121405
186 Ga0207710_10000125 3300025900 Bacteria 93726
187 Ga0207710_10004553 3300025900 Bacteria 6027
188 Ga0207710_10037173 3300025900 Bacteria 2149
189 Ga0207688_10002427 3300025901 Bacteria 10038
190 Ga0207688_10009165 3300025901 Bacteria 5390
191 Ga0207680_10014421 3300025903 Bacteria 4090
192 Ga0207680_10049890 3300025903 Bacteria 2494
193 Ga0207699_10029574 3300025906 Bacteria 3056
194 Ga0207645_10009212 3300025907 Bacteria 6839
195 Ga0207693_10000428 3300025915 Bacteria 38211
196 Ga0207693_10245137 3300025915 Bacteria 1406
197 Ga0207663_10006200 3300025916 Bacteria 6094
198 Ga0207662_10205493 3300025918 Bacteria 1276
199 Ga0207681_10000925 3300025923 Bacteria 19151
200 Ga0207681_10009411 3300025923 Bacteria 5970
201 Ga0207681_10041054 3300025923 Bacteria 3082
202 Ga0207694_10299566 3300025924 Bacteria 1324
203 Ga0207687_10003388 3300025927 Bacteria 10763
204 Ga0207687_10005157 3300025927 Bacteria 8661
205 Ga0207700_10073764 3300025928 Bacteria 2636
206 Ga0207664_10008351 3300025929 Bacteria 7216
207 Ga0207664_10055410 3300025929 Bacteria 3146
208 Ga0207664_10083007 3300025929 Bacteria 2611
209 Ga0207644_10088272 3300025931 Bacteria 2306
210 Ga0207686_10001964 3300025934 Bacteria 11331
211 Ga0207709_10053292 3300025935 Bacteria 2488
212 Ga0207670_10028903 3300025936 Bacteria 3525
213 Ga0207669_10028942 3300025937 Bacteria 3055
214 Ga0207704_10029781 3300025938 Bacteria 3050
215 Ga0207704_10046142 3300025938 Bacteria 2594
216 Ga0207665_10024360 3300025939 Bacteria 3990
217 Ga0207711_10000183 3300025941 Bacteria 67270
218 Ga0207711_10000228 3300025941 Bacteria 60300
219 Ga0207711_10049692 3300025941 Bacteria 3590
220 Ga0207711_10147418 3300025941 Bacteria 2121
221 Ga0207711_10417283 3300025941 Bacteria 1248
222 Ga0207711_10565098 3300025941 Bacteria 1061
223 Ga0207712_10000006 3300025961 Bacteria 573204
224 Ga0207712_10000073 3300025961 Bacteria 123046
225 Ga0207712_10059161 3300025961 Bacteria 2711
226 Ga0207668_10003199 3300025972 Bacteria 9595
227 Ga0207668_10005018 3300025972 Bacteria 7791
228 Ga0207640_10131572 3300025981 Bacteria 1809
229 Ga0207658_10000304 3300025986 Bacteria 50815
230 Ga0207658_10000313 3300025986 Bacteria 48919
231 Ga0207658_10000449 3300025986 Bacteria 38511
232 Ga0207658_10009151 3300025986 Bacteria 6718
233 Ga0207658_10033119 3300025986 Bacteria 3683
234 Ga0207658_10058289 3300025986 Bacteria 2873
235 Ga0207677_10022405 3300026023 Bacteria 3882
236 Ga0207677_10071065 3300026023 Bacteria 2455
237 Ga0207703_10007117 3300026035 Bacteria 8902
238 Ga0207703_10008361 3300026035 Bacteria 8181
239 Ga0207703_10012420 3300026035 Bacteria 6638
240 Ga0207703_10201405 3300026035 Bacteria 1769
241 Ga0207639_10024875 3300026041 Bacteria 4338
242 Ga0207639_10238174 3300026041 Bacteria 1581
243 Ga0207678_10109604 3300026067 Bacteria 2355
244 Ga0207708_10003370 3300026075 Bacteria 11788
245 Ga0207641_10000413 3300026088 Bacteria 49861
246 Ga0207641_10004094 3300026088 Bacteria 12714
247 Ga0207641_10063378 3300026088 Bacteria 3158
248 Ga0207641_10094623 3300026088 Bacteria 2620
249 Ga0207675_100002304 3300026118 Bacteria 18968
250 Ga0207675_100290269 3300026118 Bacteria 1591
251 Ga0207683_10034953 3300026121 Bacteria 4371
252 Ga0207683_10320412 3300026121 Bacteria 1420
253 Ga0207683_10338026 3300026121 Bacteria 1381
254 Ga0207683_10393951 3300026121 Bacteria 1274
255 Ga0207698_10075099 3300026142 Bacteria 2700
256 Ga0207698_10155097 3300026142 Bacteria 1994
257 Ga0209813_10109900 3300027866 Bacteria 948
258 Ga0268266_10004830 3300028379 Bacteria 12795
259 Ga0268266_10008175 3300028379 Bacteria 9334
260 Ga0268266_10044983 3300028379 Bacteria 3775
261 Ga0268266_10075535 3300028379 Bacteria 2927
262 Ga0268265_10000032 3300028380 Bacteria 225953
263 Ga0268265_10000063 3300028380 Bacteria 144643
264 Ga0268264_10000007 3300028381 Bacteria 815790
265 Ga0268264_10000515 3300028381 Bacteria 48941
266 Ga0268264_10004497 3300028381 Bacteria 11892
267 Ga0268264_10187482 3300028381 Bacteria 1883
268 Ga0268264_10441479 3300028381 Bacteria 1259
269 Ga0265327_10000630 3300031251 Bacteria 57536
270 Ga0316577_10293278 3300031733 Bacteria 921
271 Ga0307413_10010363 3300031824 Bacteria 4517
272 Ga0307410_10038252 3300031852 Bacteria 3141
273 Ga0307407_10208460 3300031903 Bacteria 1314
274 Ga0307409_100008091 3300031995 Bacteria 6350
275 Ga0307416_100000725 3300032002 Bacteria 17177
276 Ga0316574_0206563 3300035398 Bacteria 1261
277 Ga0316584_0015066 3300036712 Bacteria 5524
278 Ga0436364_0218929 3300037853 Bacteria 25746
279 Ga0436364_0296608 3300037853 Bacteria 7522
280 Ga0436364_1252377 3300037853 Bacteria 1990
281 Ga0436365_0016980 3300039437 Bacteria 29756
282 Ga0436365_0082434 3300039437 Bacteria 7405
283 Ga0436365_0456575 3300039437 Bacteria 43610
284 Ga0436365_0902356 3300039437 Bacteria 10276
285 Ga0436365_1106659 3300039437 Bacteria 6771
286 Ga0439461_0000626 3300041410 Bacteria 5099
287 Ga0439466_0000538 3300041411 Bacteria 14339
288 Ga0439466_0020343 3300041411 Bacteria 2365
289 Ga0439466_0029034 3300041411 Bacteria 1905
290 Ga0439465_0000186 3300041413 Bacteria 16121
291 Ga0439465_0002771 3300041413 Bacteria 5739
292 Ga0439465_0003316 3300041413 Bacteria 5260
293 Ga0439465_0015261 3300041413 Bacteria 2396
294 Ga0439465_0017886 3300041413 Bacteria 2214
295 Ga0451853_0128686 3300041512 Bacteria 1104
296 Ga0439431_0000862 3300041997 Bacteria 6555
297 Ga0439448_0007559 3300042005 Bacteria 3154
298 Ga0439434_0016374 3300042435 Bacteria 2215
299 Ga0439434_0039787 3300042435 Bacteria 1442
300 Ga0466969_0037508 3300044656 Bacteria 2444
301 Ga0466972_0002411 3300044658 Bacteria 9214
302 Ga0466972_0003509 3300044658 Bacteria 7786
303 Ga0466972_0016762 3300044658 Bacteria 3663
304 Ga0466972_0027913 3300044658 Bacteria 2789
305 Ga0466965_0000126 3300044683 Bacteria 21851
306 Ga0466965_0000284 3300044683 Bacteria 16738
307 Ga0466965_0013317 3300044683 Bacteria 3880
308 Ga0466965_0075387 3300044683 Bacteria 1701
309 Ga0466966_0004038 3300044684 Bacteria 9695
310 Ga0466966_0010861 3300044684 Bacteria 6049
311 Ga0466966_0019780 3300044684 Bacteria 4428
312 Ga0466961_0002121 3300044693 Bacteria 12334
313 Ga0466961_0005773 3300044693 Bacteria 7834
314 Ga0466963_0015360 3300044694 Bacteria 4739
315 Ga0466963_0016020 3300044694 Bacteria 4655
316 Ga0466963_0043214 3300044694 Bacteria 2962
317 Ga0466963_0128657 3300044694 Bacteria 1748
318 Ga0466964_0113648 3300044706 Bacteria 1211
319 Ga0466964_0155421 3300044706 Bacteria 1064
320 Ga0466971_0001352 3300044719 Bacteria 10283
321 Ga0466968_0000669 3300044735 Bacteria 11762
322 Ga0466968_0006917 3300044735 Bacteria 4294
323 Ga0466968_0012446 3300044735 Bacteria 3331
324 Ga0466968_0039747 3300044735 Bacteria 1981
325 Ga0466970_0002768 3300044765 Bacteria 8463
326 Ga0466970_0005688 3300044765 Bacteria 6192
327 Ga0466970_0031375 3300044765 Bacteria 2807
328 Ga0466970_0101622 3300044765 Bacteria 1566
329 Ga0466970_0143637 3300044765 Bacteria 1315
330 Ga0466957_0001806 3300044842 Bacteria 11271
331 Ga0466957_0007045 3300044842 Bacteria 6356
332 Ga0466957_0012984 3300044842 Bacteria 4825
333 Ga0466957_0023550 3300044842 Bacteria 3641
334 Ga0466957_0209093 3300044842 Bacteria 1284
335 Ga0466960_0000876 3300044901 Bacteria 10637
336 Ga0466960_0004770 3300044901 Bacteria 5326
337 Ga0466960_0008442 3300044901 Bacteria 4219
338 Ga0466960_0086676 3300044901 Bacteria 1588
339 Ga0466959_0000953 3300045049 Bacteria 17200
340 Ga0466959_0004799 3300045049 Bacteria 9125
341 Ga0466959_0039579 3300045049 Bacteria 3484
342 Ga0466958_0000627 3300045836 Bacteria 15133
343 Ga0466958_0010295 3300045836 Bacteria 5234
344 Ga0466958_0022945 3300045836 Bacteria 3659
345 Ga0466958_0030739 3300045836 Bacteria 3191
346 Ga0466967_0004312 3300045976 Bacteria 9565
347 Ga0466967_0018900 3300045976 Bacteria 5526
348 Ga0466967_0025387 3300045976 Bacteria 4885
349 Ga0466967_0030971 3300045976 Bacteria 4497
350 Ga0466967_0050128 3300045976 Bacteria 3655
351 Ga0466967_0202138 3300045976 Bacteria 1882
352 Ga0495629_0035990 3300046459 Bacteria 3497
353 Ga0495638_0001056 3300046460 Bacteria 27089
354 Ga0495638_0012164 3300046460 Bacteria 5909
355 Ga0495606_0056518 3300046507 Bacteria 2532
356 Ga0495606_0151098 3300046507 Bacteria 1363
357 Ga0495648_0001435 3300046524 Bacteria 23331
358 Ga0495654_0076020 3300046530 Bacteria 1583
359 Ga0495668_0058646 3300046616 Bacteria 2124
360 Ga0495625_0081320 3300046660 Bacteria 2255
361 Ga0495635_0138968 3300046663 Bacteria 1655
362 Ga0495672_0007144 3300047320 Bacteria 8450
363 Ga0495672_0009186 3300047320 Bacteria 7199
364 Ga0495676_0137976 3300047321 Bacteria 1751
365 Ga0495673_0000642 3300047469 Bacteria 34378
366 Ga0495686_0000940 3300047472 Bacteria 36165
367 Ga0495593_0094784 3300047673 Bacteria 1535
368 Ga0495626_0134141 3300048091 Bacteria 1055
369 Ga0496100_0000067 3300048903 Bacteria 58703
370 Ga0496100_0002274 3300048903 Bacteria 9705
371 Ga0496100_0019756 3300048903 Bacteria 4027
372 Ga0496100_0034953 3300048903 Bacteria 3158
373 Ga0496100_0127598 3300048903 Bacteria 1787
374 Ga0496100_0159598 3300048903 Bacteria 1616
375 Ga0496100_0482398 3300048903 Bacteria 954
376 Ga0496101_0000099 3300048904 Bacteria 90235
377 Ga0496101_0000333 3300048904 Bacteria 32315
378 Ga0496101_0001559 3300048904 Bacteria 13740
379 Ga0496101_0001923 3300048904 Bacteria 12564
380 Ga0496101_0008077 3300048904 Bacteria 6863
381 Ga0496102_0000056 3300048905 Bacteria 172707
382 Ga0496102_0000168 3300048905 Bacteria 88511
383 Ga0496102_0000822 3300048905 Bacteria 30122
384 Ga0496102_0002233 3300048905 Bacteria 16616
385 Ga0496102_0005671 3300048905 Bacteria 10599
386 Ga0496102_0022024 3300048905 Bacteria 5644
387 Ga0496102_0054794 3300048905 Bacteria 3637
388 Ga0496102_0094280 3300048905 Bacteria 2774
389 Ga0496102_0135198 3300048905 Bacteria 2310
390 Ga0496102_0202146 3300048905 Bacteria 1873
391 Ga0496102_0287811 3300048905 Bacteria 1549
392 Ga0496103_0000040 3300048906 Bacteria 172148
393 Ga0496103_0000116 3300048906 Bacteria 86969
394 Ga0496103_0000550 3300048906 Bacteria 29973
395 Ga0496103_0001491 3300048906 Bacteria 15645
396 Ga0496103_0005245 3300048906 Bacteria 7783
397 Ga0496103_0034652 3300048906 Bacteria 3088
398 Ga0496103_0151189 3300048906 Bacteria 1487
399 Ga0496104_0023593 3300048907 Bacteria 5656
400 Ga0496104_0196689 3300048907 Bacteria 1928
401 Ga0496104_0653600 3300048907 Bacteria 960
402 Ga0496105_0028878 3300048908 Bacteria 4538
403 Ga0496105_0543700 3300048908 Bacteria 907
404 Ga0496106_0004076 3300048909 Bacteria 10896
405 Ga0496106_0005348 3300048909 Bacteria 9501
406 Ga0496106_0013194 3300048909 Bacteria 6096
407 Ga0496106_0327651 3300048909 Bacteria 1229
408 Ga0496107_0000254 3300048910 Bacteria 28236
409 Ga0496107_0006857 3300048910 Bacteria 7846
410 Ga0496107_0008073 3300048910 Bacteria 7268
411 Ga0496107_0014957 3300048910 Bacteria 5435
412 Ga0496107_0023258 3300048910 Bacteria 4381
413 Ga0496107_0162303 3300048910 Bacteria 1656
414 Ga0496108_0000223 3300048911 Bacteria 50671
415 Ga0496108_0006695 3300048911 Bacteria 9332
416 Ga0496109_0000159 3300048912 Bacteria 66124
417 Ga0496109_0013450 3300048912 Bacteria 7099
418 Ga0496109_0032175 3300048912 Bacteria 4713
419 Ga0496110_0000744 3300048913 Bacteria 22489
420 Ga0496110_0031766 3300048913 Bacteria 4558
421 Ga0496110_0099754 3300048913 Bacteria 2603
422 Ga0496112_0002823 3300048915 Bacteria 14110
423 Ga0496112_0263793 3300048915 Bacteria 1671
424 Ga0496112_0456252 3300048915 Bacteria 1216
425 Ga0496112_0635356 3300048915 Bacteria 998
426 Ga0496113_0001516 3300048916 Bacteria 12999
427 Ga0496113_0031436 3300048916 Bacteria 3853
428 Ga0496113_0181204 3300048916 Bacteria 1670
429 Ga0496113_0183381 3300048916 Bacteria 1660
430 Ga0496114_0000116 3300048917 Bacteria 57632
431 Ga0496114_0000320 3300048917 Bacteria 35231
432 Ga0496114_0010570 3300048917 Bacteria 7343
433 Ga0496114_0240805 3300048917 Bacteria 1591
434 Ga0496114_0422846 3300048917 Bacteria 1180
435 Ga0496115_0005307 3300048918 Bacteria 9369
436 Ga0496115_0023755 3300048918 Bacteria 4759
437 Ga0496115_0082910 3300048918 Bacteria 2613
438 Ga0496116_0000056 3300048919 Bacteria 282554
439 Ga0496116_0002241 3300048919 Bacteria 20569
440 Ga0496116_0009065 3300048919 Bacteria 8530
441 Ga0496117_0000003 3300048920 Bacteria 1881097
442 Ga0496117_0000869 3300048920 Bacteria 46596
443 Ga0496117_0019421 3300048920 Bacteria 5581
444 Ga0496117_0032965 3300048920 Bacteria 3924
445 Ga0496118_0000001 3300048921 Bacteria 1881100
446 Ga0496118_0000171 3300048921 Bacteria 117495
447 Ga0496118_0000185 3300048921 Bacteria 109095
448 Ga0496118_0004915 3300048921 Bacteria 15527
449 Ga0496118_0055142 3300048921 Bacteria 3002
450 Ga0496119_0002812 3300048922 Bacteria 18623
451 Ga0496119_0009307 3300048922 Bacteria 8451
452 Ga0496119_0009932 3300048922 Bacteria 8077
453 Ga0496119_0019095 3300048922 Bacteria 5066
454 Ga0496120_0002852 3300048923 Bacteria 16640
455 Ga0496120_0002960 3300048923 Bacteria 16171
456 Ga0496120_0005876 3300048923 Bacteria 9582
457 Ga0496121_0000016 3300048924 Bacteria 562911
458 Ga0496121_0000121 3300048924 Bacteria 172480
459 Ga0496121_0008964 3300048924 Bacteria 11607
460 Ga0496121_0009747 3300048924 Bacteria 10986
461 Ga0496122_0000284 3300048925 Bacteria 113244
462 Ga0496122_0005340 3300048925 Bacteria 15361
463 Ga0496122_0007423 3300048925 Bacteria 12186
464 Ga0496123_0001928 3300048926 Bacteria 27056
465 Ga0496123_0005397 3300048926 Bacteria 12882
466 Ga0496123_0005416 3300048926 Bacteria 12856
467 Ga0496124_0000015 3300048927 Bacteria 460700
468 Ga0496124_0020455 3300048927 Bacteria 6112
469 Ga0496124_0057591 3300048927 Bacteria 3274
470 Ga0496124_0254938 3300048927 Bacteria 1295
471 Ga0496125_0000021 3300048928 Bacteria 460688
472 Ga0496126_0000015 3300048929 Bacteria 663212
473 Ga0496126_0001128 3300048929 Bacteria 44671
474 Ga0496126_0003018 3300048929 Bacteria 21826
475 Ga0496126_0004055 3300048929 Bacteria 17799
476 Ga0496126_0065018 3300048929 Bacteria 3265
477 Ga0496126_0114882 3300048929 Bacteria 2341
478 Ga0496126_0392987 3300048929 Bacteria 1126
479 Ga0501032_0000510 3300049569 Bacteria 31534
480 Ga0501033_0017294 3300049570 Bacteria 5449
481 Ga0501034_0003900 3300049571 Bacteria 16768
482 Ga0501034_0016032 3300049571 Bacteria 7690
483 Ga0501034_0295615 3300049571 Bacteria 1557
484 Ga0501034_0382268 3300049571 Bacteria 1333
485 Ga0501037_0001067 3300049573 Bacteria 20326
486 Ga0501038_0070617 3300049574 Bacteria 2964
487 Ga0501039_0000157 3300049575 Bacteria 46924
488 Ga0501043_0000971 3300049579 Bacteria 25346
489 Ga0501043_0158737 3300049579 Bacteria 1768
490 Ga0501046_0009315 3300049580 Bacteria 8497
491 Ga0501047_0011019 3300049581 Bacteria 8554
492 Ga0501070_0001100 3300049586 Bacteria 24237
493 Ga0501070_0005037 3300049586 Bacteria 11271
494 Ga0501070_0089606 3300049586 Bacteria 2546
495 Ga0501071_0457235 3300049587 Bacteria 977
496 Ga0501073_0052073 3300049589 Bacteria 2867
497 Ga0501080_0093024 3300049742 Bacteria 2800
498 Ga0501035_0000556 3300049822 Bacteria 41478
499 Ga0501035_0003315 3300049822 Bacteria 15427
500 Ga0501044_0000797 3300049823 Bacteria 38010
501 Ga0501044_0000935 3300049823 Bacteria 35094
502 Ga0501044_0015744 3300049823 Bacteria 8145
503 Ga0501044_0036217 3300049823 Bacteria 5163
504 nmdc:mga03683_11042_c1 3300050489 Bacteria 3255
505 nmdc:mga03683_125656_c1 3300050489 Bacteria 1144
506 nmdc:mga03n38_165909_c1 3300050490 Bacteria 1121
507 nmdc:mga03n38_176450_c1 3300050490 Bacteria 1092
508 nmdc:mga03n38_18215_c1 3300050490 Bacteria 2768
509 nmdc:mga03n38_22509_c1 3300050490 Bacteria 2552
510 nmdc:mga03n38_256_c1 3300050490 Bacteria 9509
511 nmdc:mga03n38_63051_c1 3300050490 Bacteria 1693
512 nmdc:mga03n38_98386_c1 3300050490 Bacteria 1407
513 nmdc:mga00v17_13106_c1 3300050491 Bacteria 4593
514 nmdc:mga00v17_167711_c1 3300050491 Bacteria 1415
515 nmdc:mga00v17_175397_c1 3300050491 Bacteria 1382
516 nmdc:mga00v17_177227_c1 3300050491 Bacteria 1375
517 nmdc:mga00v17_183933_c1 3300050491 Bacteria 1348
518 nmdc:mga00v17_190053_c1 3300050491 Bacteria 1326
519 nmdc:mga00v17_195350_c1 3300050491 Bacteria 1307
520 nmdc:mga00v17_20483_c1 3300050491 Bacteria 3789
521 nmdc:mga00v17_260_c1 3300050491 Bacteria 31041
522 nmdc:mga00v17_5610_c1 3300050491 Bacteria 6618
523 nmdc:mga00v17_5884_c1 3300050491 Bacteria 6477
524 nmdc:mga00v17_915_c1 3300050491 Bacteria 15862
525 nmdc:mga0yw44_109830_c1 3300050492 Bacteria 1766
526 nmdc:mga0yw44_2259_c2 3300050492 Bacteria 7144
527 nmdc:mga0yw44_252472_c1 3300050492 Bacteria 1174
528 nmdc:mga0yw44_49571_c1 3300050492 Bacteria 2535
529 nmdc:mga0yw44_55977_c1 3300050492 Bacteria 2401
530 nmdc:mga0yw44_6540_c1 3300050492 Bacteria 5642
531 nmdc:mga0k408_146853_c1 3300050493 Bacteria 1404
532 nmdc:mga06z11_20030_c1 3300050494 Bacteria 3086
533 nmdc:mga06z11_4956_c1 3300050494 Bacteria 5285
534 nmdc:mga06z11_69166_c1 3300050494 Bacteria 1863
535 nmdc:mga06z11_86691_c1 3300050494 Bacteria 1692
536 nmdc:mga07m45_13977_c1 3300050496 Bacteria 4268
537 nmdc:mga07m45_2471_c1 3300050496 Bacteria 8668
538 nmdc:mga07m45_33694_c1 3300050496 Bacteria 2845
539 nmdc:mga07m45_49244_c1 3300050496 Bacteria 2371
540 nmdc:mga07m45_6301_c1 3300050496 Bacteria 5992
541 nmdc:mga0qj67_168182_c1 3300050509 Bacteria 1780
542 nmdc:mga0qj67_39968_c1 3300050509 Bacteria 3685
543 nmdc:mga06r32_198105_c1 3300050510 Bacteria 1996
544 nmdc:mga0sz30_14722_c1 3300050516 Bacteria 3084
545 nmdc:mga0sz30_400_c1 3300050516 Bacteria 16502
546 nmdc:mga0sz30_41892_c2 3300050516 Bacteria 1386
547 nmdc:mga0sz30_693_c1 3300050516 Bacteria 12421
548 nmdc:mga0sz30_95238_c1 3300050516 Bacteria 1298
549 Ga0500610_0097127 3300053079 Bacteria 1527
550 Ga0500635_0001661 3300053080 Bacteria 5375
551 Ga0500635_0003540 3300053080 Bacteria 3943
552 Ga0500643_002885 3300053087 Bacteria 8554
553 Ga0500643_004060 3300053087 Bacteria 6754
554 Ga0500643_004822 3300053087 Bacteria 5960
555 Ga0500643_016465 3300053087 Bacteria 2503
556 Ga0500641_0100942 3300053096 Bacteria 1237
557 Ga0500557_010066 3300053105 Bacteria 2350
558 Ga0500562_001432 3300053108 Bacteria 5868
559 Ga0500608_037432 3300053122 Bacteria 2318
560 Ga0500642_0093177 3300053130 Bacteria 1394
561 Ga0500652_001877 3300053131 Bacteria 6329
562 Ga0500652_007216 3300053131 Bacteria 3624
563 Ga0500658_0200168 3300053134 Bacteria 913
564 Ga0500559_0114979 3300053136 Bacteria 1248
565 Ga0500616_0022371 3300053153 Bacteria 3530
566 Ga0500616_0029393 3300053153 Bacteria 3024
567 Ga0500627_0009871 3300053158 Bacteria 3458
568 Ga0500645_000007 3300053730 Bacteria 233700
569 Ga0500645_000035 3300053730 Bacteria 113679
570 Ga0500645_002293 3300053730 Bacteria 8661
571 Ga0500645_016998 3300053730 Bacteria 2285
572 Ga0466962_0015964 3300061719 Bacteria 3623
573 Ga0466962_0136183 3300061719 Bacteria 1188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2902799365 2902803283 224
2 3300013296 Ga0157374_10005617 Ga0157374_100056177 225
3 3300041512 Ga0451853_0128686 Ga0451853_0128686_328_1092 225
4 3300050490 nmdc:mga03n38_176450_c1 nmdc:mga03n38_176450_c1_31_795 225
5 3300053080 Ga0500635_0001661 Ga0500635_0001661_2759_3523 225
6 3300053131 Ga0500652_007216 Ga0500652_007216_1918_2682 225
7 3300005435 Ga0070714_100193987 Ga0070714_1001939871 227
8 3300025929 Ga0207664_10083007 Ga0207664_100830072 227
9 3300048905 Ga0496102_0022024 Ga0496102_0022024_4572_5417 227
10 3300048906 Ga0496103_0034652 Ga0496103_0034652_775_1620 227
11 3300048921 Ga0496118_0000185 Ga0496118_0000185_11031_11876 227
12 3300048091 Ga0495626_0134141 Ga0495626_0134141_204_1022 228
13 3300053079 Ga0500610_0097127 Ga0500610_0097127_309_1127 228
14 3300053108 Ga0500562_001432 Ga0500562_001432_898_1716 228
15 3300045976 Ga0466967_0050128 Ga0466967_0050128_405_1190 230
16 3300049570 Ga0501033_0017294 Ga0501033_0017294_4415_5200 230
17 3300049571 Ga0501034_0016032 Ga0501034_0016032_1147_1932 230
18 3300049579 Ga0501043_0158737 Ga0501043_0158737_556_1341 230
19 3300049580 Ga0501046_0009315 Ga0501046_0009315_3510_4295 230
20 3300049586 Ga0501070_0005037 Ga0501070_0005037_8299_9084 230
21 3300049822 Ga0501035_0003315 Ga0501035_0003315_6041_6826 230
22 3300049823 Ga0501044_0000935 Ga0501044_0000935_21313_22098 230
23 3300045976 Ga0466967_0025387 Ga0466967_0025387_3432_4217 231
24 3300009098 Ga0105245_10056782 Ga0105245_100567822 232
25 3300009551 Ga0105238_10290383 Ga0105238_102903832 232
26 3300010375 Ga0105239_10220039 Ga0105239_102200392 232
27 3300011119 Ga0105246_10308644 Ga0105246_103086442 232
28 3300013307 Ga0157372_10170887 Ga0157372_101708874 232
29 3300046507 Ga0495606_0151098 Ga0495606_0151098_151_936 232
30 3300048913 Ga0496110_0031766 Ga0496110_0031766_2765_3550 232
31 3300048917 Ga0496114_0240805 Ga0496114_0240805_273_1058 232
32 3300050490 nmdc:mga03n38_18215_c1 nmdc:mga03n38_18215_c1_1869_2654 232
33 3300050490 nmdc:mga03n38_63051_c1 nmdc:mga03n38_63051_c1_888_1673 232
34 3300053087 Ga0500643_002885 Ga0500643_002885_4493_5278 232
35 3300028381 Ga0268264_10441479 Ga0268264_104414792 233
36 3300048905 Ga0496102_0202146 Ga0496102_0202146_207_1079 233
37 3300050516 nmdc:mga0sz30_41892_c2 nmdc:mga0sz30_41892_c2_251_1045 233
38 3300006051 Ga0075364_10084195 Ga0075364_100841952 234
39 3300021384 Ga0213876_10002703 Ga0213876_100027035 234
40 3300037853 Ga0436364_0296608 Ga0436364_0296608_650_1495 234
41 3300039437 Ga0436365_0456575 Ga0436365_0456575_10675_11520 234
42 3300009551 Ga0105238_10326299 Ga0105238_103262992 235
43 3300047320 Ga0495672_0009186 Ga0495672_0009186_5546_6340 235
44 3300048915 Ga0496112_0263793 Ga0496112_0263793_136_930 235
45 3300048916 Ga0496113_0001516 Ga0496113_0001516_2341_3135 235
46 3300048925 Ga0496122_0005340 Ga0496122_0005340_2342_3136 235
47 3300048926 Ga0496123_0005397 Ga0496123_0005397_313_1107 235
48 3300048929 Ga0496126_0003018 Ga0496126_0003018_2314_3108 235
49 3300048929 Ga0496126_0114882 Ga0496126_0114882_1488_2282 235
50 3300049823 Ga0501044_0036217 Ga0501044_0036217_4262_5125 235
51 3300053087 Ga0500643_004060 Ga0500643_004060_5873_6667 235
52 3300053134 Ga0500658_0200168 Ga0500658_0200168_19_813 235
53 3300053158 Ga0500627_0009871 Ga0500627_0009871_733_1527 235
54 3300053730 Ga0500645_002293 Ga0500645_002293_3968_4762 235
55 3300005347 Ga0070668_100002095 Ga0070668_1000020959 236
56 3300025972 Ga0207668_10005018 Ga0207668_100050181 236
57 3300046460 Ga0495638_0012164 Ga0495638_0012164_1085_1942 236
58 3300042005 Ga0439448_0007559 Ga0439448_0007559_145_999 237
59 3300048904 Ga0496101_0000333 Ga0496101_0000333_17797_18654 237
60 3300048905 Ga0496102_0000056 Ga0496102_0000056_159653_160510 237
61 3300048906 Ga0496103_0000040 Ga0496103_0000040_12181_13038 237
62 3300048907 Ga0496104_0653600 Ga0496104_0653600_60_917 237
63 3300048909 Ga0496106_0013194 Ga0496106_0013194_4015_4872 237
64 3300048910 Ga0496107_0023258 Ga0496107_0023258_69_926 237
65 3300048919 Ga0496116_0000056 Ga0496116_0000056_12198_13055 237
66 3300048920 Ga0496117_0000003 Ga0496117_0000003_1868043_1868900 237
67 3300048921 Ga0496118_0000001 Ga0496118_0000001_1868046_1868903 237
68 3300048922 Ga0496119_0002812 Ga0496119_0002812_5331_6188 237
69 3300048923 Ga0496120_0002852 Ga0496120_0002852_12518_13375 237
70 3300048924 Ga0496121_0000121 Ga0496121_0000121_12198_13055 237
71 3300048929 Ga0496126_0001128 Ga0496126_0001128_9337_10194 237
72 3300048924 Ga0496121_0008964 Ga0496121_0008964_1381_2187 238
73 3300006038 Ga0075365_10047917 Ga0075365_100479172 239
74 3300046663 Ga0495635_0138968 Ga0495635_0138968_536_1342 239
75 3300048903 Ga0496100_0019756 Ga0496100_0019756_2723_3580 239
76 3300048910 Ga0496107_0162303 Ga0496107_0162303_711_1568 239
77 3300050491 nmdc:mga00v17_195350_c1 nmdc:mga00v17_195350_c1_399_1256 239
78 3300050492 nmdc:mga0yw44_252472_c1 nmdc:mga0yw44_252472_c1_248_1105 239
79 3300053153 Ga0500616_0029393 Ga0500616_0029393_1911_2717 239
80 3300009553 Ga0105249_10207295 Ga0105249_102072952 240
81 3300045976 Ga0466967_0030971 Ga0466967_0030971_831_1688 240
82 3300026121 Ga0207683_10338026 Ga0207683_103380261 241
83 3300021384 Ga0213876_10073321 Ga0213876_100733212 242
84 3300037853 Ga0436364_0218929 Ga0436364_0218929_17551_18396 242
85 3300039437 Ga0436365_1106659 Ga0436365_1106659_3463_4308 242
86 3300048929 Ga0496126_0065018 Ga0496126_0065018_487_1344 242
87 3300049571 Ga0501034_0295615 Ga0501034_0295615_633_1478 242
88 3300039437 Ga0436365_0082434 Ga0436365_0082434_102_956 243
89 3300044683 Ga0466965_0013317 Ga0466965_0013317_622_1467 243
90 3300049581 Ga0501047_0011019 Ga0501047_0011019_6838_7695 243
91 3300049822 Ga0501035_0000556 Ga0501035_0000556_32621_33478 243
92 3300049823 Ga0501044_0000797 Ga0501044_0000797_35707_36564 243
93 3300044684 Ga0466966_0010861 Ga0466966_0010861_3412_4275 244
94 3300044694 Ga0466963_0015360 Ga0466963_0015360_869_1732 244
95 3300044901 Ga0466960_0086676 Ga0466960_0086676_329_1186 244
96 3300045049 Ga0466959_0004799 Ga0466959_0004799_2572_3435 244
97 3300044658 Ga0466972_0003509 Ga0466972_0003509_5317_6174 245
98 3300044683 Ga0466965_0000284 Ga0466965_0000284_1485_2342 245
99 3300044706 Ga0466964_0155421 Ga0466964_0155421_18_875 245
100 3300044735 Ga0466968_0000669 Ga0466968_0000669_1895_2752 245
101 3300044765 Ga0466970_0143637 Ga0466970_0143637_22_879 245
102 3300044842 Ga0466957_0001806 Ga0466957_0001806_2382_3239 245
103 3300044901 Ga0466960_0008442 Ga0466960_0008442_1468_2325 245
104 3300045976 Ga0466967_0004312 Ga0466967_0004312_4607_5464 245
105 3300003323 rootH1_10058904 rootH1_100589041 246
106 3300009553 Ga0105249_10379623 Ga0105249_103796232 246
107 3300025972 Ga0207668_10003199 Ga0207668_100031997 246
108 3300046660 Ga0495625_0081320 Ga0495625_0081320_1215_2048 246
109 3300006038 Ga0075365_10129604 Ga0075365_101296042 247
110 3300006186 Ga0075369_10029401 Ga0075369_100294012 247
111 3300046459 Ga0495629_0035990 Ga0495629_0035990_2055_2900 247
112 3300047673 Ga0495593_0094784 Ga0495593_0094784_392_1237 247
113 iso_pu_bacteria 2738541274 2738708305 247
114 iso_pu_bacteria 2738543028 2739331990 247
115 3300025915 Ga0207693_10245137 Ga0207693_102451372 248
116 iso_pu_bacteria 2547132424 2548693638 248
117 iso_pu_bacteria 2738541274 2738704659 248
118 iso_pu_bacteria 2738541274 2738705471 248
119 iso_pu_bacteria 2738543028 2739332260 248
120 iso_pu_bacteria 2902792274 2902796353 248
121 iso_pu_bacteria 2902810491 2902816237 248
122 3300010375 Ga0105239_10235744 Ga0105239_102357442 249
123 3300048903 Ga0496100_0482398 Ga0496100_0482398_45_893 249
124 3300048906 Ga0496103_0151189 Ga0496103_0151189_91_939 249
125 iso_pu_bacteria 2523231044 2523384953 249
126 iso_pu_bacteria 2643221715 2644634614 249
127 iso_pu_bacteria 2738541308 2738886793 249
128 iso_pu_bacteria 2751185725 2753038574 249
129 iso_pu_bacteria 2751185792 2753326961 249
130 3300005347 Ga0070668_100000967 Ga0070668_10000096713 250
131 3300005456 Ga0070678_100224376 Ga0070678_1002243761 250
132 3300005841 Ga0068863_100049492 Ga0068863_1000494922 250
133 3300006051 Ga0075364_10002408 Ga0075364_100024082 250
134 3300006051 Ga0075364_10019906 Ga0075364_100199063 250
135 3300006186 Ga0075369_10003167 Ga0075369_100031675 250
136 3300009177 Ga0105248_10529610 Ga0105248_105296102 250
137 3300013297 Ga0157378_10112256 Ga0157378_101122561 250
138 3300014968 Ga0157379_10322556 Ga0157379_103225562 250
139 3300017792 Ga0163161_10260772 Ga0163161_102607722 250
140 3300025929 Ga0207664_10055410 Ga0207664_100554103 250
141 3300025941 Ga0207711_10147418 Ga0207711_101474182 250
142 3300026088 Ga0207641_10063378 Ga0207641_100633782 250
143 3300026121 Ga0207683_10393951 Ga0207683_103939512 250
144 3300044683 Ga0466965_0075387 Ga0466965_0075387_565_1422 250
145 3300044694 Ga0466963_0043214 Ga0466963_0043214_1427_2272 250
146 3300044694 Ga0466963_0128657 Ga0466963_0128657_751_1608 250
147 3300045976 Ga0466967_0018900 Ga0466967_0018900_1927_2772 250
148 3300046460 Ga0495638_0001056 Ga0495638_0001056_25785_26630 250
149 3300048903 Ga0496100_0002274 Ga0496100_0002274_5245_6090 250
150 3300048904 Ga0496101_0001559 Ga0496101_0001559_5220_6065 250
151 3300048905 Ga0496102_0135198 Ga0496102_0135198_332_1177 250
152 3300048907 Ga0496104_0023593 Ga0496104_0023593_2374_3219 250
153 3300048908 Ga0496105_0028878 Ga0496105_0028878_1699_2544 250
154 3300048909 Ga0496106_0005348 Ga0496106_0005348_1186_2031 250
155 3300048910 Ga0496107_0006857 Ga0496107_0006857_5702_6547 250
156 3300048917 Ga0496114_0000320 Ga0496114_0000320_26874_27719 250
157 3300048918 Ga0496115_0005307 Ga0496115_0005307_4574_5419 250
158 3300050491 nmdc:mga00v17_177227_c1 nmdc:mga00v17_177227_c1_480_1325 250
159 3300050491 nmdc:mga00v17_915_c1 nmdc:mga00v17_915_c1_13858_14715 250
160 3300050516 nmdc:mga0sz30_400_c1 nmdc:mga0sz30_400_c1_14807_15664 250
161 3300053153 Ga0500616_0022371 Ga0500616_0022371_1656_2501 250
162 iso_pu_bacteria 2919713450 2919719134 250
163 3300005367 Ga0070667_100191778 Ga0070667_1001917782 251
164 3300005435 Ga0070714_100009714 Ga0070714_1000097142 251
165 3300006844 Ga0075428_100005457 Ga0075428_10000545714 251
166 3300006846 Ga0075430_100053472 Ga0075430_1000534723 251
167 3300006847 Ga0075431_100208508 Ga0075431_1002085082 251
168 3300009147 Ga0114129_10105830 Ga0114129_101058302 251
169 3300021384 Ga0213876_10038149 Ga0213876_100381491 251
170 3300025928 Ga0207700_10073764 Ga0207700_100737643 251
171 3300025929 Ga0207664_10008351 Ga0207664_100083514 251
172 3300037853 Ga0436364_1252377 Ga0436364_1252377_86_931 251
173 3300039437 Ga0436365_0902356 Ga0436365_0902356_3798_4643 251
174 3300044694 Ga0466963_0016020 Ga0466963_0016020_2426_3271 251
175 3300044735 Ga0466968_0006917 Ga0466968_0006917_1938_2783 251
176 3300044765 Ga0466970_0002768 Ga0466970_0002768_2974_3819 251
177 3300044842 Ga0466957_0023550 Ga0466957_0023550_1014_1859 251
178 3300044901 Ga0466960_0004770 Ga0466960_0004770_2712_3557 251
179 3300045836 Ga0466958_0022945 Ga0466958_0022945_980_1825 251
180 3300045836 Ga0466958_0030739 Ga0466958_0030739_568_1413 251
181 3300046507 Ga0495606_0056518 Ga0495606_0056518_950_1795 251
182 3300049586 Ga0501070_0089606 Ga0501070_0089606_475_1332 251
183 3300049742 Ga0501080_0093024 Ga0501080_0093024_1299_2156 251
184 3300002077 JGI24744J21845_10001615 JGI24744J21845_100016152 252
185 3300002244 JGI24742J22300_10001612 JGI24742J22300_100016124 252
186 3300005328 Ga0070676_10025540 Ga0070676_100255403 252
187 3300005335 Ga0070666_10004732 Ga0070666_100047323 252
188 3300005338 Ga0068868_100000872 Ga0068868_1000008722 252
189 3300005340 Ga0070689_100173517 Ga0070689_1001735172 252
190 3300005345 Ga0070692_10031475 Ga0070692_100314753 252
191 3300005347 Ga0070668_100179993 Ga0070668_1001799932 252
192 3300005353 Ga0070669_100013118 Ga0070669_1000131185 252
193 3300005356 Ga0070674_100026665 Ga0070674_1000266653 252
194 3300005367 Ga0070667_100020125 Ga0070667_1000201253 252
195 3300005434 Ga0070709_10062243 Ga0070709_100622433 252
196 3300005435 Ga0070714_100653850 Ga0070714_1006538501 252
197 3300005438 Ga0070701_10005569 Ga0070701_100055694 252
198 3300005439 Ga0070711_100005079 Ga0070711_1000050797 252
199 3300005440 Ga0070705_100094393 Ga0070705_1000943932 252
200 3300005441 Ga0070700_100000673 Ga0070700_1000006738 252
201 3300005456 Ga0070678_100000501 Ga0070678_1000005013 252
202 3300005457 Ga0070662_100119553 Ga0070662_1001195532 252
203 3300005539 Ga0068853_100045447 Ga0068853_1000454473 252
204 3300005545 Ga0070695_100003872 Ga0070695_1000038726 252
205 3300005546 Ga0070696_100018139 Ga0070696_1000181393 252
206 3300005548 Ga0070665_100064781 Ga0070665_1000647812 252
207 3300005549 Ga0070704_100006899 Ga0070704_1000068995 252
208 3300005578 Ga0068854_100002376 Ga0068854_1000023766 252
209 3300005617 Ga0068859_100048579 Ga0068859_1000485794 252
210 3300005718 Ga0068866_10005440 Ga0068866_100054403 252
211 3300005719 Ga0068861_100009189 Ga0068861_1000091895 252
212 3300005842 Ga0068858_100004857 Ga0068858_1000048573 252
213 3300005843 Ga0068860_100007031 Ga0068860_1000070315 252
214 3300005937 Ga0081455_10013814 Ga0081455_100138143 252
215 3300005937 Ga0081455_10063501 Ga0081455_100635012 252
216 3300005937 Ga0081455_10144176 Ga0081455_101441762 252
217 3300005981 Ga0081538_10051144 Ga0081538_100511443 252
218 3300006038 Ga0075365_10011975 Ga0075365_100119752 252
219 3300006051 Ga0075364_10214063 Ga0075364_102140632 252
220 3300006175 Ga0070712_100017551 Ga0070712_1000175513 252
221 3300006358 Ga0068871_100060452 Ga0068871_1000604522 252
222 3300006881 Ga0068865_100011277 Ga0068865_1000112775 252
223 3300006931 Ga0097620_100048581 Ga0097620_1000485814 252
224 3300009092 Ga0105250_10039561 Ga0105250_100395612 252
225 3300009098 Ga0105245_10007994 Ga0105245_100079946 252
226 3300009101 Ga0105247_10005145 Ga0105247_100051456 252
227 3300009148 Ga0105243_10011368 Ga0105243_100113683 252
228 3300009174 Ga0105241_10074223 Ga0105241_100742232 252
229 3300009176 Ga0105242_10040889 Ga0105242_100408893 252
230 3300009177 Ga0105248_10044259 Ga0105248_100442593 252
231 3300010375 Ga0105239_10034683 Ga0105239_100346836 252
232 3300013297 Ga0157378_10013845 Ga0157378_100138454 252
233 3300013306 Ga0163162_10201778 Ga0163162_102017782 252
234 3300013307 Ga0157372_10005476 Ga0157372_100054766 252
235 3300013308 Ga0157375_10015455 Ga0157375_100154552 252
236 3300014326 Ga0157380_10004687 Ga0157380_100046873 252
237 3300017792 Ga0163161_10243111 Ga0163161_102431112 252
238 3300025303 Ga0209051_1057883 Ga0209051_10578832 252
239 3300025899 Ga0207642_10001542 Ga0207642_100015426 252
240 3300025899 Ga0207642_10022914 Ga0207642_100229143 252
241 3300025900 Ga0207710_10004553 Ga0207710_100045532 252
242 3300025901 Ga0207688_10002427 Ga0207688_100024276 252
243 3300025903 Ga0207680_10049890 Ga0207680_100498902 252
244 3300025906 Ga0207699_10029574 Ga0207699_100295743 252
245 3300025907 Ga0207645_10009212 Ga0207645_100092123 252
246 3300025915 Ga0207693_10000428 Ga0207693_1000042842 252
247 3300025916 Ga0207663_10006200 Ga0207663_100062004 252
248 3300025918 Ga0207662_10205493 Ga0207662_102054932 252
249 3300025923 Ga0207681_10009411 Ga0207681_100094115 252
250 3300025927 Ga0207687_10003388 Ga0207687_100033885 252
251 3300025934 Ga0207686_10001964 Ga0207686_100019646 252
252 3300025935 Ga0207709_10053292 Ga0207709_100532922 252
253 3300025936 Ga0207670_10028903 Ga0207670_100289033 252
254 3300025937 Ga0207669_10028942 Ga0207669_100289423 252
255 3300025938 Ga0207704_10029781 Ga0207704_100297813 252
256 3300025939 Ga0207665_10024360 Ga0207665_100243603 252
257 3300025941 Ga0207711_10049692 Ga0207711_100496923 252
258 3300025961 Ga0207712_10059161 Ga0207712_100591612 252
259 3300025981 Ga0207640_10131572 Ga0207640_101315722 252
260 3300025986 Ga0207658_10033119 Ga0207658_100331194 252
261 3300026023 Ga0207677_10071065 Ga0207677_100710653 252
262 3300026035 Ga0207703_10007117 Ga0207703_100071172 252
263 3300026041 Ga0207639_10024875 Ga0207639_100248754 252
264 3300026075 Ga0207708_10003370 Ga0207708_100033705 252
265 3300026118 Ga0207675_100002304 Ga0207675_10000230418 252
266 3300026121 Ga0207683_10034953 Ga0207683_100349533 252
267 3300026142 Ga0207698_10075099 Ga0207698_100750993 252
268 3300028379 Ga0268266_10044983 Ga0268266_100449834 252
269 3300028381 Ga0268264_10004497 Ga0268264_100044972 252
270 3300031733 Ga0316577_10293278 Ga0316577_102932781 252
271 3300035398 Ga0316574_0206563 Ga0316574_0206563_373_1218 252
272 3300036712 Ga0316584_0015066 Ga0316584_0015066_585_1430 252
273 3300039437 Ga0436365_0016980 Ga0436365_0016980_25623_26468 252
274 3300041413 Ga0439465_0015261 Ga0439465_0015261_230_1078 252
275 3300041413 Ga0439465_0017886 Ga0439465_0017886_22_879 252
276 3300044658 Ga0466972_0002411 Ga0466972_0002411_4139_4996 252
277 3300044683 Ga0466965_0000126 Ga0466965_0000126_13641_14498 252
278 3300044684 Ga0466966_0004038 Ga0466966_0004038_14_871 252
279 3300044693 Ga0466961_0002121 Ga0466961_0002121_7048_7905 252
280 3300044719 Ga0466971_0001352 Ga0466971_0001352_6140_6997 252
281 3300044735 Ga0466968_0012446 Ga0466968_0012446_2311_3168 252
282 3300044765 Ga0466970_0005688 Ga0466970_0005688_1116_1973 252
283 3300044842 Ga0466957_0012984 Ga0466957_0012984_2118_2975 252
284 3300045049 Ga0466959_0000953 Ga0466959_0000953_12169_13026 252
285 3300045049 Ga0466959_0039579 Ga0466959_0039579_2250_3107 252
286 3300045836 Ga0466958_0000627 Ga0466958_0000627_7323_8180 252
287 3300045976 Ga0466967_0202138 Ga0466967_0202138_62_919 252
288 3300047321 Ga0495676_0137976 Ga0495676_0137976_588_1433 252
289 3300048903 Ga0496100_0034953 Ga0496100_0034953_915_1772 252
290 3300048904 Ga0496101_0001923 Ga0496101_0001923_6965_7822 252
291 3300048905 Ga0496102_0002233 Ga0496102_0002233_3809_4666 252
292 3300048905 Ga0496102_0054794 Ga0496102_0054794_888_1745 252
293 3300048905 Ga0496102_0287811 Ga0496102_0287811_264_1121 252
294 3300048906 Ga0496103_0005245 Ga0496103_0005245_6056_6913 252
295 3300048909 Ga0496106_0004076 Ga0496106_0004076_5761_6618 252
296 3300048910 Ga0496107_0008073 Ga0496107_0008073_5577_6434 252
297 3300048912 Ga0496109_0032175 Ga0496109_0032175_2893_3750 252
298 3300048916 Ga0496113_0181204 Ga0496113_0181204_685_1542 252
299 3300048917 Ga0496114_0010570 Ga0496114_0010570_219_1076 252
300 3300048918 Ga0496115_0023755 Ga0496115_0023755_2105_2962 252
301 3300050491 nmdc:mga00v17_175397_c1 nmdc:mga00v17_175397_c1_139_996 252
302 3300050492 nmdc:mga0yw44_6540_c1 nmdc:mga0yw44_6540_c1_668_1513 252
303 3300050496 nmdc:mga07m45_49244_c1 nmdc:mga07m45_49244_c1_746_1603 252
304 3300050510 nmdc:mga06r32_198105_c1 nmdc:mga06r32_198105_c1_375_1232 252
305 3300053080 Ga0500635_0003540 Ga0500635_0003540_1220_2065 252
306 3300053087 Ga0500643_004822 Ga0500643_004822_1369_2214 252
307 3300053122 Ga0500608_037432 Ga0500608_037432_1237_2082 252
308 3300053131 Ga0500652_001877 Ga0500652_001877_4827_5672 252
309 3300053136 Ga0500559_0114979 Ga0500559_0114979_16_861 252
310 3300053730 Ga0500645_000007 Ga0500645_000007_9522_10367 252
311 3300061719 Ga0466962_0015964 Ga0466962_0015964_263_1120 252
312 iso_pu_bacteria 2643221715 2644638180 252
313 iso_pu_bacteria 2738541264 2738666897 252
314 iso_pu_bacteria 2738541356 2739145741 252
315 iso_pu_bacteria 2842134933 2842135475 252
316 iso_pu_bacteria 2842134933 2842140092 252
317 iso_pu_bacteria 2902810491 2902812056 252
318 iso_pu_bacteria 2902837492 2902843284 252
319 iso_pu_bacteria 2929212328 2929216733 252
320 3300006038 Ga0075365_10077520 Ga0075365_100775202 253
321 3300006846 Ga0075430_100179874 Ga0075430_1001798742 253
322 3300041411 Ga0439466_0000538 Ga0439466_0000538_7509_8357 253
323 3300041413 Ga0439465_0000186 Ga0439465_0000186_4674_5522 253
324 3300048915 Ga0496112_0456252 Ga0496112_0456252_35_883 253
325 3300048916 Ga0496113_0183381 Ga0496113_0183381_698_1546 253
326 3300048929 Ga0496126_0392987 Ga0496126_0392987_14_862 253
327 3300050491 nmdc:mga00v17_183933_c1 nmdc:mga00v17_183933_c1_117_965 253
328 3300050509 nmdc:mga0qj67_168182_c1 nmdc:mga0qj67_168182_c1_739_1596 253
329 3300053087 Ga0500643_016465 Ga0500643_016465_79_927 253
330 3300053096 Ga0500641_0100942 Ga0500641_0100942_41_889 253
331 3300053105 Ga0500557_010066 Ga0500557_010066_873_1721 253
332 3300053130 Ga0500642_0093177 Ga0500642_0093177_55_903 253
333 3300053730 Ga0500645_000035 Ga0500645_000035_37096_37944 253
334 3300053730 Ga0500645_016998 Ga0500645_016998_333_1181 253
335 3300005347 Ga0070668_100405937 Ga0070668_1004059372 254
336 3300005435 Ga0070714_100216039 Ga0070714_1002160392 254
337 3300005719 Ga0068861_100285445 Ga0068861_1002854452 254
338 3300006051 Ga0075364_10010276 Ga0075364_100102765 254
339 3300006051 Ga0075364_10106943 Ga0075364_101069432 254
340 3300006178 Ga0075367_10046390 Ga0075367_100463902 254
341 3300006186 Ga0075369_10105998 Ga0075369_101059982 254
342 3300006353 Ga0075370_10003177 Ga0075370_100031775 254
343 3300009553 Ga0105249_10410791 Ga0105249_104107912 254
344 3300041410 Ga0439461_0000626 Ga0439461_0000626_1010_1867 254
345 3300041411 Ga0439466_0020343 Ga0439466_0020343_768_1625 254
346 3300041413 Ga0439465_0003316 Ga0439465_0003316_4342_5199 254
347 3300041997 Ga0439431_0000862 Ga0439431_0000862_406_1263 254
348 3300042435 Ga0439434_0039787 Ga0439434_0039787_80_937 254
349 3300044658 Ga0466972_0016762 Ga0466972_0016762_2742_3599 254
350 3300044765 Ga0466970_0101622 Ga0466970_0101622_501_1358 254
351 3300044901 Ga0466960_0000876 Ga0466960_0000876_5086_5943 254
352 3300048915 Ga0496112_0002823 Ga0496112_0002823_11674_12531 254
353 3300048916 Ga0496113_0031436 Ga0496113_0031436_2642_3499 254
354 3300048925 Ga0496122_0007423 Ga0496122_0007423_3186_4043 254
355 3300048926 Ga0496123_0001928 Ga0496123_0001928_15435_16292 254
356 3300048927 Ga0496124_0254938 Ga0496124_0254938_110_967 254
357 3300048929 Ga0496126_0004055 Ga0496126_0004055_7323_8180 254
358 3300050489 nmdc:mga03683_125656_c1 nmdc:mga03683_125656_c1_268_1125 254
359 3300050490 nmdc:mga03n38_165909_c1 nmdc:mga03n38_165909_c1_120_977 254
360 3300050490 nmdc:mga03n38_256_c1 nmdc:mga03n38_256_c1_6321_7178 254
361 3300050491 nmdc:mga00v17_167711_c1 nmdc:mga00v17_167711_c1_145_1002 254
362 3300050491 nmdc:mga00v17_190053_c1 nmdc:mga00v17_190053_c1_343_1200 254
363 3300050491 nmdc:mga00v17_5884_c1 nmdc:mga00v17_5884_c1_4548_5405 254
364 3300050496 nmdc:mga07m45_6301_c1 nmdc:mga07m45_6301_c1_235_1092 254
365 3300050516 nmdc:mga0sz30_95238_c1 nmdc:mga0sz30_95238_c1_337_1194 254
366 3300005335 Ga0070666_10002316 Ga0070666_100023165 255
367 3300005353 Ga0070669_100001809 Ga0070669_10000180913 255
368 3300005353 Ga0070669_100025047 Ga0070669_1000250474 255
369 3300005367 Ga0070667_100000073 Ga0070667_10000007352 255
370 3300005367 Ga0070667_100000375 Ga0070667_1000003753 255
371 3300005548 Ga0070665_100003119 Ga0070665_1000031193 255
372 3300005548 Ga0070665_100023969 Ga0070665_1000239695 255
373 3300005617 Ga0068859_100000223 Ga0068859_10000022328 255
374 3300005617 Ga0068859_100022919 Ga0068859_1000229194 255
375 3300005841 Ga0068863_100000194 Ga0068863_1000001943 255
376 3300005841 Ga0068863_100001282 Ga0068863_10000128212 255
377 3300005842 Ga0068858_100014482 Ga0068858_1000144823 255
378 3300005842 Ga0068858_100048495 Ga0068858_1000484954 255
379 3300005843 Ga0068860_100000127 Ga0068860_10000012753 255
380 3300005843 Ga0068860_100000489 Ga0068860_1000004893 255
381 3300005844 Ga0068862_100000052 Ga0068862_10000005288 255
382 3300005844 Ga0068862_100000054 Ga0068862_1000000543 255
383 3300006931 Ga0097620_100000223 Ga0097620_10000022328 255
384 3300006931 Ga0097620_100022915 Ga0097620_1000229155 255
385 3300009101 Ga0105247_10000066 Ga0105247_1000006662 255
386 3300009101 Ga0105247_10000085 Ga0105247_10000085113 255
387 3300009177 Ga0105248_10000144 Ga0105248_100001448 255
388 3300009177 Ga0105248_10002684 Ga0105248_100026843 255
389 3300009553 Ga0105249_10000001 Ga0105249_100000013 255
390 3300009553 Ga0105249_10000093 Ga0105249_1000009363 255
391 3300014325 Ga0163163_10094025 Ga0163163_100940252 255
392 3300025900 Ga0207710_10000125 Ga0207710_10000125104 255
393 3300025903 Ga0207680_10014421 Ga0207680_100144213 255
394 3300025923 Ga0207681_10041054 Ga0207681_100410543 255
395 3300025941 Ga0207711_10000228 Ga0207711_1000022812 255
396 3300025961 Ga0207712_10000006 Ga0207712_10000006490 255
397 3300025986 Ga0207658_10000313 Ga0207658_1000031352 255
398 3300026035 Ga0207703_10008361 Ga0207703_100083617 255
399 3300026088 Ga0207641_10004094 Ga0207641_1000409412 255
400 3300028379 Ga0268266_10004830 Ga0268266_1000483011 255
401 3300028380 Ga0268265_10000032 Ga0268265_100000323 255
402 3300028381 Ga0268264_10000515 Ga0268264_1000051552 255
403 3300044656 Ga0466969_0037508 Ga0466969_0037508_579_1442 255
404 3300044684 Ga0466966_0019780 Ga0466966_0019780_1531_2394 255
405 3300044693 Ga0466961_0005773 Ga0466961_0005773_2744_3607 255
406 3300044706 Ga0466964_0113648 Ga0466964_0113648_152_1015 255
407 3300044735 Ga0466968_0039747 Ga0466968_0039747_117_980 255
408 3300044765 Ga0466970_0031375 Ga0466970_0031375_1343_2206 255
409 3300044842 Ga0466957_0007045 Ga0466957_0007045_1515_2378 255
410 3300045836 Ga0466958_0010295 Ga0466958_0010295_1206_2069 255
411 3300048903 Ga0496100_0000067 Ga0496100_0000067_47401_48258 255
412 3300048904 Ga0496101_0000099 Ga0496101_0000099_21529_22386 255
413 3300048905 Ga0496102_0000822 Ga0496102_0000822_1207_2067 255
414 3300048905 Ga0496102_0005671 Ga0496102_0005671_6426_7283 255
415 3300048906 Ga0496103_0001491 Ga0496103_0001491_1198_2058 255
416 3300048910 Ga0496107_0000254 Ga0496107_0000254_323_1180 255
417 3300048910 Ga0496107_0014957 Ga0496107_0014957_4053_4913 255
418 3300048911 Ga0496108_0006695 Ga0496108_0006695_5320_6177 255
419 3300048912 Ga0496109_0000159 Ga0496109_0000159_10844_11701 255
420 3300048913 Ga0496110_0000744 Ga0496110_0000744_21542_22399 255
421 3300048917 Ga0496114_0000116 Ga0496114_0000116_21518_22375 255
422 3300048918 Ga0496115_0082910 Ga0496115_0082910_1300_2157 255
423 3300048919 Ga0496116_0009065 Ga0496116_0009065_2921_3778 255
424 3300048920 Ga0496117_0032965 Ga0496117_0032965_1837_2697 255
425 3300048921 Ga0496118_0004915 Ga0496118_0004915_1207_2067 255
426 3300048922 Ga0496119_0019095 Ga0496119_0019095_1822_2682 255
427 3300048924 Ga0496121_0000016 Ga0496121_0000016_355994_356851 255
428 3300048925 Ga0496122_0000284 Ga0496122_0000284_69913_70770 255
429 3300048926 Ga0496123_0005416 Ga0496123_0005416_10426_11283 255
430 3300048927 Ga0496124_0000015 Ga0496124_0000015_21539_22396 255
431 3300048927 Ga0496124_0057591 Ga0496124_0057591_1194_2054 255
432 3300048928 Ga0496125_0000021 Ga0496125_0000021_438305_439162 255
433 3300048929 Ga0496126_0000015 Ga0496126_0000015_438305_439162 255
434 3300049571 Ga0501034_0382268 Ga0501034_0382268_420_1274 255
435 3300061719 Ga0466962_0136183 Ga0466962_0136183_80_943 255
436 3300001977 JGI24746J21847_1019144 JGI24746J21847_10191441 256
437 3300002073 JGI24745J21846_1008886 JGI24745J21846_10088861 256
438 3300002077 JGI24744J21845_10026482 JGI24744J21845_100264821 256
439 3300003792 Ga0055540_1000114 Ga0055540_10001147 256
440 3300005337 Ga0070682_100028488 Ga0070682_1000284883 256
441 3300005337 Ga0070682_100401983 Ga0070682_1004019831 256
442 3300005338 Ga0068868_100040048 Ga0068868_1000400484 256
443 3300005338 Ga0068868_100077906 Ga0068868_1000779062 256
444 3300005367 Ga0070667_100000854 Ga0070667_1000008546 256
445 3300005367 Ga0070667_100011620 Ga0070667_1000116206 256
446 3300005367 Ga0070667_100044166 Ga0070667_1000441661 256
447 3300005455 Ga0070663_100102007 Ga0070663_1001020072 256
448 3300005456 Ga0070678_100049191 Ga0070678_1000491913 256
449 3300005466 Ga0070685_10170877 Ga0070685_101708771 256
450 3300005539 Ga0068853_100230570 Ga0068853_1002305702 256
451 3300005548 Ga0070665_100100402 Ga0070665_1001004023 256
452 3300005549 Ga0070704_100017112 Ga0070704_1000171124 256
453 3300005578 Ga0068854_100030765 Ga0068854_1000307653 256
454 3300005616 Ga0068852_100125564 Ga0068852_1001255642 256
455 3300005616 Ga0068852_100641743 Ga0068852_1006417432 256
456 3300005841 Ga0068863_100015314 Ga0068863_1000153141 256
457 3300005842 Ga0068858_100034967 Ga0068858_1000349674 256
458 3300006038 Ga0075365_10011205 Ga0075365_100112055 256
459 3300006038 Ga0075365_10038637 Ga0075365_100386373 256
460 3300006042 Ga0075368_10066884 Ga0075368_100668842 256
461 3300006048 Ga0075363_100012872 Ga0075363_1000128725 256
462 3300006048 Ga0075363_100017913 Ga0075363_1000179132 256
463 3300006048 Ga0075363_100020733 Ga0075363_1000207333 256
464 3300006048 Ga0075363_100044272 Ga0075363_1000442722 256
465 3300006051 Ga0075364_10020804 Ga0075364_100208045 256
466 3300006051 Ga0075364_10041921 Ga0075364_100419211 256
467 3300006051 Ga0075364_10159355 Ga0075364_101593552 256
468 3300006051 Ga0075364_10209230 Ga0075364_102092302 256
469 3300006177 Ga0075362_10060136 Ga0075362_100601361 256
470 3300006178 Ga0075367_10008166 Ga0075367_100081662 256
471 3300006178 Ga0075367_10090325 Ga0075367_100903252 256
472 3300006178 Ga0075367_10125303 Ga0075367_101253032 256
473 3300006186 Ga0075369_10000399 Ga0075369_100003997 256
474 3300006353 Ga0075370_10008534 Ga0075370_100085342 256
475 3300006353 Ga0075370_10016931 Ga0075370_100169314 256
476 3300006353 Ga0075370_10032100 Ga0075370_100321002 256
477 3300006846 Ga0075430_100046684 Ga0075430_1000466842 256
478 3300006881 Ga0068865_100010057 Ga0068865_1000100574 256
479 3300009098 Ga0105245_10014473 Ga0105245_100144733 256
480 3300009101 Ga0105247_10059758 Ga0105247_100597582 256
481 3300009101 Ga0105247_10191443 Ga0105247_101914431 256
482 3300009177 Ga0105248_10169989 Ga0105248_101699892 256
483 3300010375 Ga0105239_10125047 Ga0105239_101250473 256
484 3300013308 Ga0157375_10092156 Ga0157375_100921562 256
485 3300014325 Ga0163163_10013270 Ga0163163_100132706 256
486 3300014325 Ga0163163_10567720 Ga0163163_105677202 256
487 3300014745 Ga0157377_10011522 Ga0157377_100115224 256
488 3300014968 Ga0157379_10124454 Ga0157379_101244542 256
489 3300025303 Ga0209051_1000215 Ga0209051_100021590 256
490 3300025900 Ga0207710_10000090 Ga0207710_1000009062 256
491 3300025900 Ga0207710_10037173 Ga0207710_100371732 256
492 3300025901 Ga0207688_10009165 Ga0207688_100091653 256
493 3300025923 Ga0207681_10000925 Ga0207681_100009257 256
494 3300025924 Ga0207694_10299566 Ga0207694_102995662 256
495 3300025927 Ga0207687_10005157 Ga0207687_100051576 256
496 3300025931 Ga0207644_10088272 Ga0207644_100882722 256
497 3300025938 Ga0207704_10046142 Ga0207704_100461422 256
498 3300025941 Ga0207711_10000183 Ga0207711_1000018353 256
499 3300025941 Ga0207711_10417283 Ga0207711_104172831 256
500 3300025941 Ga0207711_10565098 Ga0207711_105650982 256
501 3300025961 Ga0207712_10000073 Ga0207712_1000007363 256
502 3300025986 Ga0207658_10000304 Ga0207658_1000030432 256
503 3300025986 Ga0207658_10000449 Ga0207658_1000044938 256
504 3300025986 Ga0207658_10009151 Ga0207658_100091514 256
505 3300025986 Ga0207658_10058289 Ga0207658_100582892 256
506 3300026023 Ga0207677_10022405 Ga0207677_100224052 256
507 3300026035 Ga0207703_10012420 Ga0207703_100124205 256
508 3300026035 Ga0207703_10201405 Ga0207703_102014052 256
509 3300026041 Ga0207639_10238174 Ga0207639_102381742 256
510 3300026067 Ga0207678_10109604 Ga0207678_101096043 256
511 3300026088 Ga0207641_10000413 Ga0207641_1000041316 256
512 3300026088 Ga0207641_10094623 Ga0207641_100946233 256
513 3300026118 Ga0207675_100290269 Ga0207675_1002902691 256
514 3300026121 Ga0207683_10320412 Ga0207683_103204122 256
515 3300026142 Ga0207698_10155097 Ga0207698_101550972 256
516 3300027866 Ga0209813_10109900 Ga0209813_101099001 256
517 3300028379 Ga0268266_10008175 Ga0268266_100081753 256
518 3300028379 Ga0268266_10075535 Ga0268266_100755352 256
519 3300028380 Ga0268265_10000063 Ga0268265_1000006388 256
520 3300028381 Ga0268264_10000007 Ga0268264_1000000753 256
521 3300028381 Ga0268264_10187482 Ga0268264_101874823 256
522 3300031251 Ga0265327_10000630 Ga0265327_100006304 256
523 3300031824 Ga0307413_10010363 Ga0307413_100103634 256
524 3300031852 Ga0307410_10038252 Ga0307410_100382524 256
525 3300031903 Ga0307407_10208460 Ga0307407_102084602 256
526 3300031995 Ga0307409_100008091 Ga0307409_1000080914 256
527 3300032002 Ga0307416_100000725 Ga0307416_10000072511 256
528 3300041411 Ga0439466_0029034 Ga0439466_0029034_633_1490 256
529 3300041413 Ga0439465_0002771 Ga0439465_0002771_2076_2933 256
530 3300042435 Ga0439434_0016374 Ga0439434_0016374_1179_2036 256
531 3300044658 Ga0466972_0027913 Ga0466972_0027913_1672_2529 256
532 3300044842 Ga0466957_0209093 Ga0466957_0209093_340_1197 256
533 3300046524 Ga0495648_0001435 Ga0495648_0001435_9251_10108 256
534 3300046530 Ga0495654_0076020 Ga0495654_0076020_288_1145 256
535 3300046616 Ga0495668_0058646 Ga0495668_0058646_174_1031 256
536 3300047320 Ga0495672_0007144 Ga0495672_0007144_3058_3915 256
537 3300047469 Ga0495673_0000642 Ga0495673_0000642_16077_16934 256
538 3300047472 Ga0495686_0000940 Ga0495686_0000940_25901_26758 256
539 3300048903 Ga0496100_0127598 Ga0496100_0127598_291_1148 256
540 3300048903 Ga0496100_0159598 Ga0496100_0159598_638_1495 256
541 3300048904 Ga0496101_0008077 Ga0496101_0008077_5420_6277 256
542 3300048905 Ga0496102_0000168 Ga0496102_0000168_46680_47537 256
543 3300048905 Ga0496102_0094280 Ga0496102_0094280_669_1526 256
544 3300048906 Ga0496103_0000116 Ga0496103_0000116_24929_25789 256
545 3300048906 Ga0496103_0000550 Ga0496103_0000550_1037_1894 256
546 3300048907 Ga0496104_0196689 Ga0496104_0196689_242_1099 256
547 3300048908 Ga0496105_0543700 Ga0496105_0543700_30_887 256
548 3300048909 Ga0496106_0327651 Ga0496106_0327651_144_1001 256
549 3300048911 Ga0496108_0000223 Ga0496108_0000223_43541_44398 256
550 3300048912 Ga0496109_0013450 Ga0496109_0013450_4228_5085 256
551 3300048913 Ga0496110_0099754 Ga0496110_0099754_705_1562 256
552 3300048915 Ga0496112_0635356 Ga0496112_0635356_83_940 256
553 3300048917 Ga0496114_0422846 Ga0496114_0422846_124_981 256
554 3300048919 Ga0496116_0002241 Ga0496116_0002241_10920_11777 256
555 3300048920 Ga0496117_0000869 Ga0496117_0000869_41007_41864 256
556 3300048920 Ga0496117_0019421 Ga0496117_0019421_658_1518 256
557 3300048921 Ga0496118_0000171 Ga0496118_0000171_29228_30085 256
558 3300048921 Ga0496118_0055142 Ga0496118_0055142_658_1518 256
559 3300048922 Ga0496119_0009307 Ga0496119_0009307_4460_5320 256
560 3300048922 Ga0496119_0009932 Ga0496119_0009932_6210_7067 256
561 3300048923 Ga0496120_0002960 Ga0496120_0002960_3178_4038 256
562 3300048923 Ga0496120_0005876 Ga0496120_0005876_8639_9496 256
563 3300048924 Ga0496121_0009747 Ga0496121_0009747_2255_3112 256
564 3300048927 Ga0496124_0020455 Ga0496124_0020455_1708_2565 256
565 3300049569 Ga0501032_0000510 Ga0501032_0000510_13758_14615 256
566 3300049571 Ga0501034_0003900 Ga0501034_0003900_10925_11782 256
567 3300049573 Ga0501037_0001067 Ga0501037_0001067_4652_5509 256
568 3300049574 Ga0501038_0070617 Ga0501038_0070617_1008_1865 256
569 3300049575 Ga0501039_0000157 Ga0501039_0000157_14818_15675 256
570 3300049579 Ga0501043_0000971 Ga0501043_0000971_10109_10966 256
571 3300049586 Ga0501070_0001100 Ga0501070_0001100_14745_15602 256
572 3300049587 Ga0501071_0457235 Ga0501071_0457235_50_907 256
573 3300049589 Ga0501073_0052073 Ga0501073_0052073_1129_1986 256
574 3300049823 Ga0501044_0015744 Ga0501044_0015744_3239_4096 256
575 3300050489 nmdc:mga03683_11042_c1 nmdc:mga03683_11042_c1_25_882 256
576 3300050490 nmdc:mga03n38_22509_c1 nmdc:mga03n38_22509_c1_383_1240 256
577 3300050490 nmdc:mga03n38_98386_c1 nmdc:mga03n38_98386_c1_502_1359 256
578 3300050491 nmdc:mga00v17_13106_c1 nmdc:mga00v17_13106_c1_3248_4105 256
579 3300050491 nmdc:mga00v17_20483_c1 nmdc:mga00v17_20483_c1_356_1213 256
580 3300050491 nmdc:mga00v17_260_c1 nmdc:mga00v17_260_c1_17857_18714 256
581 3300050491 nmdc:mga00v17_5610_c1 nmdc:mga00v17_5610_c1_333_1190 256
582 3300050492 nmdc:mga0yw44_109830_c1 nmdc:mga0yw44_109830_c1_830_1687 256
583 3300050492 nmdc:mga0yw44_2259_c2 nmdc:mga0yw44_2259_c2_1494_2351 256
584 3300050492 nmdc:mga0yw44_49571_c1 nmdc:mga0yw44_49571_c1_1284_2141 256
585 3300050492 nmdc:mga0yw44_55977_c1 nmdc:mga0yw44_55977_c1_549_1406 256
586 3300050493 nmdc:mga0k408_146853_c1 nmdc:mga0k408_146853_c1_262_1119 256
587 3300050494 nmdc:mga06z11_20030_c1 nmdc:mga06z11_20030_c1_412_1269 256
588 3300050494 nmdc:mga06z11_4956_c1 nmdc:mga06z11_4956_c1_1601_2458 256
589 3300050494 nmdc:mga06z11_69166_c1 nmdc:mga06z11_69166_c1_322_1179 256
590 3300050494 nmdc:mga06z11_86691_c1 nmdc:mga06z11_86691_c1_685_1542 256
591 3300050496 nmdc:mga07m45_13977_c1 nmdc:mga07m45_13977_c1_2581_3438 256
592 3300050496 nmdc:mga07m45_2471_c1 nmdc:mga07m45_2471_c1_567_1424 256
593 3300050496 nmdc:mga07m45_33694_c1 nmdc:mga07m45_33694_c1_1023_1880 256
594 3300050509 nmdc:mga0qj67_39968_c1 nmdc:mga0qj67_39968_c1_863_1720 256
595 3300050516 nmdc:mga0sz30_14722_c1 nmdc:mga0sz30_14722_c1_2114_2971 256
596 3300050516 nmdc:mga0sz30_693_c1 nmdc:mga0sz30_693_c1_5093_5950 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

53

219

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.8585 24 256
6zy9-assembly1.cif.gz_H cryo-em structure of mlafedb in complex with amp-pnp 0.812 14 250
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.7837 24 256
7ch8-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd with adp-v 0.7825 12 245
6zy2-assembly1.cif.gz_H cryo-em structure of apo mlafedb 0.7784 19 245
ID Description Score Start End Superfamily
af_A0A0P0VGF8_899_1134_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6416 198 249 1.10.510.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5289 94 237 3.40.1710.10
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.5032 49 243 1.10.357.20
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4779 49 243 1.10.357.20
af_O44196_293_482_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4534 48 248 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A3M2KZG9-F1-model_v4 ABC transporter permease 0.8972 21 245 GO:0005548
GO:0043190
AF-A0A1V4PYY5-F1-model_v4 ABC transporter permease 0.8966 21 245 GO:0005548
GO:0043190
AF-A0A2S2C886-F1-model_v4 ABC transporter permease 0.8924 18 247 GO:0005548
GO:0043190
AF-A0A542S2E8-F1-model_v4 Phospholipid/cholesterol/gamma-HCH transport system permease protein 0.8895 14 256 GO:0005548
GO:0043190
AF-A0A5N5E7V5-F1-model_v4 ABC transporter permease 0.8893 39 245 GO:0005548
GO:0043190

Feature Viewer

pLDDT pTM Quality
78.4 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map