F467598

General Info

Members Datasets Scaffolds Average Seq Length
596 494 242 402

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0035109|Ga0501031_0035109_597_1943
Length 448
Sequence LPDRLISSIGLIARSIKFISIYQWLALDCASDFGDSSMPASRPETASAAARPMPWLIILAGSLIAVLTFGPRSAMGFFQLPMLQDTGWDRTTFGLAMALQNLAWGVSQPFFGAIADKFGTWRVLLISGLVYALGLYLMSLGTSPLWLHVGGGVLVGLGVGAGSFGILLSAFARNVTPEQRSMAFGICTAAGSAGMFLFAPLSQGLISAFGWSDSLVYLGILMLAVPVIAIPLRGNSSSGITAASEYKQTIGEALREALGYRSYLLLVAGFFVCGYQVAFITAHFPAYLSDIGIDARYAVISLALIGFFNIIGSLAAGFIGQRYSKPYFLAYIYLARSVAVSAFILLPKSPVSVIVFAVVMGLLWLSTVPPTNGLVAIMFGTRHLGLLGGIVFLSHQVGSFLGVWMGGYLYDHFGTYDPVWWLGVALGLFAAVVHWPIEEKGVTRPAVA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
8 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
9 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
12 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
13 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
14 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
15 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2516143018 Ensifer sp. BR816 Isolate Nodule
20 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
21 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
22 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
23 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
24 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
25 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
26 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
27 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
28 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
29 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
30 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
31 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
32 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
33 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
34 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
35 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
36 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
37 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
38 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
39 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
40 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
41 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
42 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
43 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
44 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
45 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
46 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
47 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
48 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
49 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
50 2643221557 Ensifer sp. Root558 Isolate Unclassified
51 2643221558 Rhizobium sp. Root149 Isolate Unclassified
52 2643221568 Rhizobium sp. Root564 Isolate Unclassified
53 2643221582 Rhizobium sp. Root651 Isolate Unclassified
54 2643221607 Rhizobium sp. Root73 Isolate Unclassified
55 2643221610 Ensifer sp. Root74 Isolate Unclassified
56 2643221618 Ensifer sp. Root231 Isolate Unclassified
57 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
58 2643221626 Ensifer sp. Root31 Isolate Unclassified
59 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
60 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
61 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
62 2643221655 Ensifer sp. Root1252 Isolate Unclassified
63 2643221659 Ensifer sp. Root127 Isolate Unclassified
64 2643221668 Ensifer sp. Root423 Isolate Unclassified
65 2643221675 Ensifer sp. Root1298 Isolate Unclassified
66 2643221680 Ensifer sp. Root1312 Isolate Unclassified
67 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
68 2643221688 Rhizobium sp. Root482 Isolate Unclassified
69 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
70 2643221693 Rhizobium sp. Root491 Isolate Unclassified
71 2643221698 Ensifer sp. Root142 Isolate Unclassified
72 2643221712 Ensifer sp. Root258 Isolate Unclassified
73 2643221718 Rhizobium sp. Root268 Isolate Unclassified
74 2643221719 Rhizobium sp. Root274 Isolate Unclassified
75 2643221726 Ensifer sp. Root954 Isolate Unclassified
76 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
77 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
78 2738543024 Aminobacter sp. AP02 Isolate Unclassified
79 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
80 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
81 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
82 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
83 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
84 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
85 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
86 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
87 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
88 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
89 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
90 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
91 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
92 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
93 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
94 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
95 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
96 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
97 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
98 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
99 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
100 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
101 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
102 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
103 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
104 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
105 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
106 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
107 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
108 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
109 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
110 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
111 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
112 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
113 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
114 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
115 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
116 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
117 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
118 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
119 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
120 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
121 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
122 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
123 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
124 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
125 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
126 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
127 2844163670 Ensifer sp. 1H6 Isolate Unclassified
128 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
129 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
130 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
131 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
132 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
133 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
134 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
135 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
136 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
137 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
138 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
139 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
140 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
141 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
142 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
143 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
144 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
145 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
146 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
147 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
148 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
149 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
150 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
151 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
152 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
153 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
154 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
155 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
156 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
157 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
158 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
159 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
160 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
161 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
162 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
163 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
164 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
165 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
166 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
167 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
168 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
169 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
170 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
171 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
172 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
173 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
174 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
175 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
176 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
177 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
178 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
179 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
180 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
181 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
182 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
183 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
184 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
185 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
186 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
187 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
188 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
189 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
190 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
191 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
192 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
193 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
194 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
195 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
196 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
197 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
198 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
199 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
200 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
201 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
202 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
203 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
204 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
205 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
206 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
207 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
208 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
209 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
210 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
211 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
212 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
213 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
214 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
215 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
216 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
217 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
218 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
219 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
220 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
221 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
222 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
223 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
224 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
225 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
226 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
227 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
228 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
229 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
230 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
231 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
232 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
233 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
234 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
235 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
236 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
237 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
238 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
239 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
240 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
241 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
242 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
243 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
244 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
245 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
246 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
247 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
248 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
249 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
250 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
251 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
252 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
253 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
254 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
255 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
256 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
257 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
258 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
259 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
260 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
261 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
262 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
263 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
264 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
265 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
266 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
267 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
268 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
269 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
270 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
271 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
272 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
273 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
274 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
275 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
276 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
277 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
278 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
279 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
280 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
281 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
282 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
283 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
284 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
285 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
286 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
287 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
288 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
289 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
290 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
291 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
292 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
293 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
294 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
295 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
296 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
297 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
298 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
299 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
300 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
301 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
302 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
303 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
304 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
305 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
306 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
307 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
308 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
309 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
310 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
311 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
312 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
313 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
314 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
315 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
316 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
317 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
318 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
319 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
320 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
321 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
322 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
323 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
324 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
325 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
326 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
327 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
328 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
329 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
330 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
331 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
332 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
333 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
334 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
335 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
336 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
337 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
338 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
339 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
340 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
341 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
342 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
343 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
344 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
345 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
346 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
347 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
348 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
349 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
350 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
351 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
352 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
353 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
354 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
355 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
356 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
357 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
358 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
359 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
360 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
361 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
362 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
363 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
364 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
365 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
366 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
367 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
368 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
369 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
370 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
371 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
372 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
373 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
374 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
375 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
376 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
377 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
378 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
379 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
380 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
381 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
382 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
383 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
384 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
385 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
387 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
388 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
389 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
390 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
391 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
392 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
394 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
402 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
403 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
404 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
405 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
407 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
408 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
409 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
410 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
411 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
412 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
413 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
414 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
415 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
416 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
417 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
418 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
419 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
420 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
421 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
422 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
423 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
424 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
425 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
426 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
427 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
428 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
429 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
430 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
431 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
432 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
433 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
434 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
435 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
436 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
437 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
438 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
439 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
440 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
441 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
442 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
455 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
456 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
457 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
458 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
459 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
460 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
461 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
462 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
466 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
467 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
468 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
469 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
470 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
471 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
472 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
473 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
474 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
475 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
476 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
477 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
478 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
479 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
480 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
481 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
482 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
483 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
484 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
485 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
486 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
487 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
488 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
489 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
490 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
491 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
492 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
493 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
494 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 40.44
Metatranscriptomes 0
Isolates 59.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.84
Bulb 0
Endosphere 9.4
Nodule 42.95
Rhizoplane 2.18
Rhizosphere 25.67
Stem 0
Stem Tuber 0
Unclassified 18.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000002 3300002987 Bacteria 289163
2 JGI25151J46595_10034472 3300003187 Bacteria 1935
3 rootH1_10022292 3300003316 Bacteria 17443
4 rootH1_10022292 3300003323 Bacteria 4741
5 JGI25160J50197_1000008 3300003354 Bacteria 289163
6 JGI25161J50226_1000380 3300003374 Bacteria 22370
7 Ga0055526_1001532 3300003771 Bacteria 16363
8 Ga0055526_1004557 3300003771 Bacteria 8278
9 Ga0055526_1012628 3300003771 Bacteria 3663
10 Ga0055524_1002806 3300003775 Bacteria 8747
11 Ga0055536_1000472 3300003781 Bacteria 28068
12 Ga0055536_1008956 3300003781 Bacteria 4218
13 Ga0055530_10021533 3300003791 Bacteria 1898
14 Ga0058692_1000888 3300003856 Bacteria 11774
15 Ga0058692_1001670 3300003856 Bacteria 7967
16 Ga0055543_1000971 3300004625 Bacteria 12999
17 Ga0065165_1000015 3300005262 Bacteria 289201
18 Ga0070714_100043608 3300005435 Bacteria 3794
19 Ga0070714_100147103 3300005435 Bacteria 2120
20 Ga0070694_100107570 3300005444 Bacteria 1982
21 Ga0070708_100054785 3300005445 Bacteria 3544
22 Ga0070663_100022158 3300005455 Bacteria 4242
23 Ga0070681_10014974 3300005458 Bacteria 7711
24 Ga0070707_100020390 3300005468 Bacteria 6252
25 Ga0070707_100067730 3300005468 Bacteria 3435
26 Ga0070698_100133264 3300005471 Bacteria 2439
27 Ga0070665_100046844 3300005548 Bacteria 4341
28 Ga0070665_100311745 3300005548 Bacteria 1577
29 Ga0068856_100022260 3300005614 Bacteria 6162
30 Ga0070717_10059479 3300006028 Bacteria 3162
31 Ga0075365_10017001 3300006038 Bacteria 4442
32 Ga0075364_10000626 3300006051 Bacteria 18199
33 Ga0075364_10088451 3300006051 Bacteria 2054
34 Ga0075434_100240396 3300006871 Bacteria 1831
35 Ga0079104_1000032 3300006946 Bacteria 203094
36 Ga0079104_1007020 3300006946 Bacteria 4150
37 Ga0099826_10000859 3300006948 Bacteria 16488
38 Ga0075435_100066606 3300007076 Bacteria 2931
39 Ga0105243_10009258 3300009148 Bacteria 7520
40 Ga0157373_10003685 3300013100 Bacteria 11585
41 Ga0157373_10045637 3300013100 Bacteria 3128
42 Ga0157373_10047878 3300013100 Bacteria 3048
43 Ga0157371_10000380 3300013102 Bacteria 55836
44 Ga0157371_10030229 3300013102 Bacteria 3909
45 Ga0157370_10000748 3300013104 Bacteria 40596
46 Ga0157370_10076195 3300013104 Bacteria 3160
47 Ga0157369_10207579 3300013105 Bacteria 2054
48 Ga0171463_1001 3300013249 Bacteria 1406070
49 Ga0157374_10000790 3300013296 Bacteria 27725
50 Ga0183363_1394 3300015690 Bacteria 3913
51 Ga0214544_1009397 3300021320 Bacteria 15366
52 Ga0214542_1000006 3300021321 Bacteria 345164
53 Ga0214542_1018535 3300021321 Bacteria 5844
54 Ga0214543_1000003 3300021327 Bacteria 692327
55 Ga0214543_1000014 3300021327 Bacteria 324986
56 Ga0228711_1000001 3300022739 Bacteria 357377
57 Ga0228710_1000001 3300022740 Bacteria 314328
58 Ga0209130_1000007 3300025284 Bacteria 591584
59 Ga0209676_1009867 3300025292 Bacteria 4056
60 Ga0209676_1018539 3300025292 Bacteria 2425
61 Ga0209025_1000074 3300025294 Bacteria 277445
62 Ga0209025_1000080 3300025294 Bacteria 267244
63 Ga0209025_1000100 3300025294 Bacteria 229182
64 Ga0209025_1000149 3300025294 Bacteria 173393
65 Ga0209025_1019532 3300025294 Bacteria 3762
66 Ga0209564_1000439 3300025295 Bacteria 71637
67 Ga0209758_1000121 3300025297 Bacteria 192028
68 Ga0209050_1001222 3300025298 Bacteria 29857
69 Ga0209050_1004350 3300025298 Bacteria 9629
70 Ga0209256_1001410 3300025299 Bacteria 24985
71 Ga0209256_1001505 3300025299 Bacteria 23627
72 Ga0207426_1000064 3300025302 Bacteria 358276
73 Ga0209051_1001371 3300025303 Bacteria 21046
74 Ga0209051_1017747 3300025303 Bacteria 3171
75 Ga0209257_1001514 3300025304 Bacteria 27239
76 Ga0209257_1002234 3300025304 Bacteria 19896
77 Ga0207684_10021512 3300025910 Bacteria 5507
78 Ga0207707_10022838 3300025912 Bacteria 5470
79 Ga0207693_10162024 3300025915 Bacteria 1760
80 Ga0207693_10192747 3300025915 Bacteria 1604
81 Ga0207646_10003818 3300025922 Bacteria 16740
82 Ga0207646_10043524 3300025922 Bacteria 4032
83 Ga0207664_10050721 3300025929 Bacteria 3273
84 Ga0207664_10163688 3300025929 Bacteria 1899
85 Ga0207678_10124460 3300026067 Bacteria 2200
86 Ga0207702_10011479 3300026078 Bacteria 7382
87 Ga0209281_1000053 3300027111 Bacteria 309587
88 Ga0209281_1000164 3300027111 Bacteria 157372
89 Ga0209281_1000332 3300027111 Bacteria 81534
90 Ga0209371_1000021 3300027312 Bacteria 555864
91 Ga0209371_1009806 3300027312 Bacteria 3012
92 Ga0209282_1000007 3300027666 Bacteria 254917
93 Ga0209282_1000483 3300027666 Bacteria 19392
94 Ga0209813_10017951 3300027866 Bacteria 1949
95 Ga0268266_10051818 3300028379 Bacteria 3524
96 Ga0268266_10064736 3300028379 Bacteria 3159
97 Ga0268266_10170846 3300028379 Bacteria 1973
98 Ga0307515_10000070 3300028794 Bacteria 239322
99 Ga0307515_10000444 3300028794 Bacteria 99282
100 Ga0268256_1000020 3300030500 Bacteria 557873
101 Ga0268256_1002522 3300030500 Bacteria 9240
102 Ga0307513_10142842 3300031456 Bacteria 2317
103 Ga0307408_100099608 3300031548 Bacteria 2212
104 Ga0265314_10003051 3300031711 Bacteria 16519
105 Ga0307516_10152895 3300031730 Bacteria 2066
106 Ga0315914_1000006 3300031967 Bacteria 239817
107 Ga0315913_1000002 3300033430 Bacteria 241452
108 Ga0315915_1000001 3300033464 Bacteria 481518
109 Ga0373926_0013772 3300035083 Bacteria 2746
110 Ga0373925_0138571 3300037068 Bacteria 1903
111 Ga0395905_0010927 3300037471 Bacteria 8786
112 Ga0395905_0046789 3300037471 Bacteria 4056
113 Ga0436362_0890796 3300039453 Bacteria 2475
114 Ga0439465_0016137 3300041413 Bacteria 2329
115 Ga0439449_0006043 3300042007 Bacteria 4626
116 Ga0450918_006841 3300042531 Bacteria 2026
117 Ga0466970_0076005 3300044765 Bacteria 1809
118 Ga0451576_0036178 3300045051 Bacteria 5235
119 Ga0495638_0015665 3300046460 Bacteria 5085
120 Ga0495638_0040030 3300046460 Bacteria 2971
121 Ga0495633_0029811 3300046558 Bacteria 2653
122 Ga0495588_0001302 3300046674 Bacteria 10683
123 Ga0495681_0022147 3300047470 Bacteria 3408
124 Ga0496110_0244778 3300048913 Bacteria 1632
125 Ga0496111_0001122 3300048914 Bacteria 14834
126 Ga0496112_0041910 3300048915 Bacteria 4480
127 Ga0496116_0000036 3300048919 Bacteria 388508
128 Ga0496117_0000002 3300048920 Bacteria 2483758
129 Ga0496117_0004346 3300048920 Bacteria 15725
130 Ga0496117_0040942 3300048920 Bacteria 3401
131 Ga0496118_0000214 3300048921 Bacteria 100898
132 Ga0496118_0039079 3300048921 Bacteria 3792
133 Ga0496119_0019004 3300048922 Bacteria 5085
134 Ga0496119_0023620 3300048922 Bacteria 4351
135 Ga0496120_0000125 3300048923 Bacteria 128983
136 Ga0496120_0025259 3300048923 Bacteria 3690
137 Ga0496121_0000001 3300048924 Bacteria 1830318
138 Ga0496121_0001579 3300048924 Bacteria 37950
139 Ga0496121_0009182 3300048924 Bacteria 11430
140 Ga0496121_0091440 3300048924 Bacteria 2376
141 Ga0496122_0000001 3300048925 Bacteria 1827766
142 Ga0496122_0000492 3300048925 Bacteria 82125
143 Ga0496123_0000001 3300048926 Bacteria 1831497
144 Ga0496123_0000460 3300048926 Bacteria 71476
145 Ga0496123_0026635 3300048926 Bacteria 4325
146 Ga0496123_0099964 3300048926 Bacteria 1691
147 Ga0496124_0000133 3300048927 Bacteria 154328
148 Ga0496124_0000679 3300048927 Bacteria 55901
149 Ga0496124_0004429 3300048927 Bacteria 16380
150 Ga0496124_0032190 3300048927 Bacteria 4634
151 Ga0496124_0198614 3300048927 Bacteria 1527
152 Ga0496125_0000001 3300048928 Bacteria 1766138
153 Ga0496125_0000912 3300048928 Bacteria 46601
154 Ga0496126_0000156 3300048929 Bacteria 158537
155 Ga0496126_0000811 3300048929 Bacteria 55747
156 Ga0496126_0005996 3300048929 Bacteria 13651
157 Ga0496126_0052873 3300048929 Bacteria 3688
158 Ga0496126_0110464 3300048929 Bacteria 2395
159 Ga0501031_0004479 3300049568 Bacteria 9060
160 Ga0501031_0011463 3300049568 Bacteria 5776
161 Ga0501031_0035109 3300049568 Bacteria 3270
162 Ga0501032_0000119 3300049569 Bacteria 65020
163 Ga0501032_0016154 3300049569 Bacteria 5254
164 Ga0501032_0179804 3300049569 Bacteria 1385
165 Ga0501033_0000296 3300049570 Bacteria 47834
166 Ga0501033_0000426 3300049570 Bacteria 40278
167 Ga0501033_0007707 3300049570 Bacteria 8352
168 Ga0501033_0031792 3300049570 Bacteria 3963
169 Ga0501033_0104349 3300049570 Bacteria 2066
170 Ga0501034_0001333 3300049571 Bacteria 33330
171 Ga0501034_0005085 3300049571 Bacteria 14445
172 Ga0501034_0008254 3300049571 Bacteria 11023
173 Ga0501036_0004059 3300049572 Bacteria 11774
174 Ga0501037_0000077 3300049573 Bacteria 91081
175 Ga0501037_0003050 3300049573 Bacteria 12158
176 Ga0501038_0000046 3300049574 Bacteria 106465
177 Ga0501038_0052814 3300049574 Bacteria 3502
178 Ga0501038_0053693 3300049574 Bacteria 3468
179 Ga0501039_0000003 3300049575 Bacteria 357424
180 Ga0501040_0141726 3300049576 Bacteria 1694
181 Ga0501043_0000104 3300049579 Bacteria 78808
182 Ga0501043_0000315 3300049579 Bacteria 43857
183 Ga0501043_0061864 3300049579 Bacteria 2939
184 Ga0501046_0050236 3300049580 Bacteria 3295
185 Ga0501046_0190767 3300049580 Bacteria 1529
186 Ga0501047_0005529 3300049581 Bacteria 11893
187 Ga0501047_0032885 3300049581 Bacteria 5008
188 Ga0501047_0051861 3300049581 Bacteria 3965
189 Ga0501069_0000016 3300049585 Bacteria 142565
190 Ga0501069_0006066 3300049585 Bacteria 6309
191 Ga0501070_0000048 3300049586 Bacteria 105951
192 Ga0501070_0000333 3300049586 Bacteria 42916
193 Ga0501070_0000812 3300049586 Bacteria 28368
194 Ga0501070_0074481 3300049586 Bacteria 2810
195 Ga0501070_0083552 3300049586 Bacteria 2644
196 Ga0501071_0005866 3300049587 Bacteria 7939
197 Ga0501071_0234982 3300049587 Bacteria 1381
198 Ga0501073_0014519 3300049589 Bacteria 5724
199 Ga0501073_0159244 3300049589 Bacteria 1564
200 Ga0501074_0000001 3300049590 Bacteria 123588
201 Ga0501074_0036256 3300049590 Bacteria 3573
202 Ga0501074_0053514 3300049590 Bacteria 2911
203 Ga0501076_0040256 3300049592 Bacteria 3672
204 Ga0501080_0000270 3300049742 Bacteria 39305
205 Ga0501080_0001902 3300049742 Bacteria 17987
206 Ga0501080_0019484 3300049742 Bacteria 6284
207 Ga0501080_0371643 3300049742 Bacteria 1289
208 Ga0501083_0000069 3300049744 Bacteria 68635
209 Ga0501280_002724 3300049776 Bacteria 2868
210 Ga0501035_0000048 3300049822 Bacteria 146466
211 Ga0501035_0000694 3300049822 Bacteria 36664
212 Ga0501035_0005330 3300049822 Bacteria 12166
213 Ga0501035_0016160 3300049822 Bacteria 6886
214 Ga0501035_0062300 3300049822 Bacteria 3319
215 Ga0501044_0000003 3300049823 Bacteria 345647
216 Ga0501044_0006733 3300049823 Bacteria 12670
217 Ga0501044_0023415 3300049823 Bacteria 6568
218 Ga0501044_0041819 3300049823 Bacteria 4771
219 Ga0501044_0124692 3300049823 Bacteria 2574
220 Ga0501044_0127963 3300049823 Bacteria 2536
221 nmdc:mga00v17_1425_c1 3300050491 Bacteria 12551
222 nmdc:mga00v17_187_c1 3300050491 Bacteria 37112
223 nmdc:mga00v17_530_c1 3300050491 Bacteria 21410
224 nmdc:mga0yw44_40788_c1 3300050492 Bacteria 2760
225 nmdc:mga0yw44_71918_c1 3300050492 Bacteria 2148
226 nmdc:mga0k408_68190_c1 3300050493 Bacteria 2075
227 nmdc:mga06z11_55895_c1 3300050494 Bacteria 2040
228 nmdc:mga0rr50_61352_c1 3300050513 Bacteria 2832
229 nmdc:mga0sz30_150_c1 3300050516 Bacteria 25823
230 nmdc:mga0sz30_4678_c1 3300050516 Bacteria 2074
231 Ga0500643_014263 3300053087 Bacteria 2771
232 Ga0500572_001399 3300053111 Bacteria 6626
233 Ga0500607_093313 3300053121 Bacteria 1510
234 Ga0500568_0001123 3300053139 Bacteria 17968
235 Ga0500616_0000224 3300053153 Bacteria 88293
236 Ga0500622_0004347 3300053156 Bacteria 8951
237 Ga0500624_000336 3300053157 Bacteria 15794
238 Ga0500634_0007390 3300053161 Bacteria 5415
239 Ga0500636_0000004 3300053177 Bacteria 202392
240 Ga0500636_0008398 3300053177 Bacteria 5989
241 Ga0500611_013360 3300053727 Bacteria 1408
242 Ga0501082_0030997 3300060353 Bacteria 4609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0110464 Ga0496126_0110464_1300_2379 331
2 3300049569 Ga0501032_0179804 Ga0501032_0179804_15_1127 350
3 3300049587 Ga0501071_0234982 Ga0501071_0234982_11_1123 350
4 3300048924 Ga0496121_0009182 Ga0496121_0009182_5908_7110 356
5 3300049571 Ga0501034_0005085 Ga0501034_0005085_7949_9187 362
6 3300049581 Ga0501047_0032885 Ga0501047_0032885_3217_4455 362
7 3300005548 Ga0070665_100311745 Ga0070665_1003117451 364
8 3300028379 Ga0268266_10170846 Ga0268266_101708462 364
9 3300003323 rootH1_10022292 rootH1_100222923 366
10 3300006946 Ga0079104_1000032 Ga0079104_100003211 366
11 3300027111 Ga0209281_1000053 Ga0209281_1000053125 366
12 3300028379 Ga0268266_10064736 Ga0268266_100647364 366
13 3300048913 Ga0496110_0244778 Ga0496110_0244778_309_1511 366
14 3300048914 Ga0496111_0001122 Ga0496111_0001122_7409_8611 366
15 3300048926 Ga0496123_0026635 Ga0496123_0026635_2473_3675 366
16 3300048927 Ga0496124_0198614 Ga0496124_0198614_20_1222 366
17 3300005444 Ga0070694_100107570 Ga0070694_1001075701 367
18 3300005445 Ga0070708_100054785 Ga0070708_1000547852 367
19 3300005468 Ga0070707_100067730 Ga0070707_1000677302 367
20 3300044765 Ga0466970_0076005 Ga0466970_0076005_401_1645 369
21 3300049570 Ga0501033_0104349 Ga0501033_0104349_142_1332 370
22 3300049568 Ga0501031_0004479 Ga0501031_0004479_4249_5481 371
23 3300049569 Ga0501032_0000119 Ga0501032_0000119_40979_42211 371
24 3300049570 Ga0501033_0000426 Ga0501033_0000426_3780_5012 371
25 3300049571 Ga0501034_0001333 Ga0501034_0001333_9289_10521 371
26 3300049572 Ga0501036_0004059 Ga0501036_0004059_3779_5011 371
27 3300049573 Ga0501037_0003050 Ga0501037_0003050_4154_5386 371
28 3300049574 Ga0501038_0000046 Ga0501038_0000046_13176_14408 371
29 3300049575 Ga0501039_0000003 Ga0501039_0000003_3686_4918 371
30 3300049579 Ga0501043_0000315 Ga0501043_0000315_3717_4949 371
31 3300049580 Ga0501046_0050236 Ga0501046_0050236_1241_2473 371
32 3300049580 Ga0501046_0190767 Ga0501046_0190767_263_1453 371
33 3300049742 Ga0501080_0371643 Ga0501080_0371643_32_1222 371
34 3300049822 Ga0501035_0000694 Ga0501035_0000694_31754_32986 371
35 3300049823 Ga0501044_0127963 Ga0501044_0127963_1012_2244 371
36 3300049568 Ga0501031_0011463 Ga0501031_0011463_2664_3902 372
37 3300049589 Ga0501073_0159244 Ga0501073_0159244_18_1217 372
38 3300003781 Ga0055536_1008956 Ga0055536_10089565 374
39 3300003791 Ga0055530_10021533 Ga0055530_100215331 374
40 3300025292 Ga0209676_1009867 Ga0209676_10098672 374
41 3300025297 Ga0209758_1000121 Ga0209758_1000121213 374
42 3300025298 Ga0209050_1004350 Ga0209050_10043507 374
43 3300025303 Ga0209051_1001371 Ga0209051_10013712 374
44 3300025304 Ga0209257_1002234 Ga0209257_100223422 374
45 iso_pu_bacteria 2854896431 2854898837 379
46 3300045051 Ga0451576_0036178 Ga0451576_0036178_3121_4380 380
47 3300046460 Ga0495638_0015665 Ga0495638_0015665_1393_2583 381
48 3300037471 Ga0395905_0010927 Ga0395905_0010927_2490_3860 382
49 3300021321 Ga0214542_1018535 Ga0214542_10185354 383
50 3300021327 Ga0214543_1000003 Ga0214543_1000003445 383
51 3300042007 Ga0439449_0006043 Ga0439449_0006043_612_1850 383
52 3300053121 Ga0500607_093313 Ga0500607_093313_33_1184 383
53 3300049570 Ga0501033_0007707 Ga0501033_0007707_7025_8263 384
54 3300049574 Ga0501038_0053693 Ga0501038_0053693_2067_3305 384
55 3300049581 Ga0501047_0051861 Ga0501047_0051861_2496_3734 384
56 3300049586 Ga0501070_0000812 Ga0501070_0000812_25719_26957 384
57 3300049742 Ga0501080_0001902 Ga0501080_0001902_11393_12631 384
58 3300049776 Ga0501280_002724 Ga0501280_002724_1088_2308 384
59 3300049822 Ga0501035_0005330 Ga0501035_0005330_8827_10065 384
60 3300006038 Ga0075365_10017001 Ga0075365_100170013 385
61 3300049570 Ga0501033_0031792 Ga0501033_0031792_2019_3257 385
62 3300049571 Ga0501034_0008254 Ga0501034_0008254_7124_8362 385
63 3300049823 Ga0501044_0023415 Ga0501044_0023415_1213_2451 385
64 3300050492 nmdc:mga0yw44_40788_c1 nmdc:mga0yw44_40788_c1_12_1247 385
65 3300013100 Ga0157373_10047878 Ga0157373_100478781 386
66 3300013104 Ga0157370_10076195 Ga0157370_100761954 386
67 3300009148 Ga0105243_10009258 Ga0105243_100092584 388
68 3300013100 Ga0157373_10003685 Ga0157373_100036854 388
69 3300013102 Ga0157371_10000380 Ga0157371_1000038040 388
70 3300013104 Ga0157370_10000748 Ga0157370_1000074825 388
71 3300039453 Ga0436362_0890796 Ga0436362_0890796_1060_2280 388
72 3300048920 Ga0496117_0000002 Ga0496117_0000002_1539996_1541186 388
73 3300048921 Ga0496118_0000214 Ga0496118_0000214_7804_8994 388
74 3300048922 Ga0496119_0023620 Ga0496119_0023620_961_2151 388
75 3300048923 Ga0496120_0000125 Ga0496120_0000125_108643_109833 388
76 3300048925 Ga0496122_0000001 Ga0496122_0000001_910785_911975 388
77 3300048926 Ga0496123_0000001 Ga0496123_0000001_914516_915706 388
78 3300048927 Ga0496124_0004429 Ga0496124_0004429_8241_9431 388
79 3300050491 nmdc:mga00v17_187_c1 nmdc:mga00v17_187_c1_32541_33731 388
80 3300050493 nmdc:mga0k408_68190_c1 nmdc:mga0k408_68190_c1_574_1764 388
81 3300050494 nmdc:mga06z11_55895_c1 nmdc:mga06z11_55895_c1_368_1558 388
82 3300050516 nmdc:mga0sz30_150_c1 nmdc:mga0sz30_150_c1_10199_11389 388
83 3300050516 nmdc:mga0sz30_4678_c1 nmdc:mga0sz30_4678_c1_730_1920 388
84 3300049590 Ga0501074_0036256 Ga0501074_0036256_1051_2289 390
85 3300049569 Ga0501032_0016154 Ga0501032_0016154_1528_2766 391
86 3300049570 Ga0501033_0000296 Ga0501033_0000296_39038_40276 391
87 3300049573 Ga0501037_0000077 Ga0501037_0000077_13501_14739 391
88 3300049574 Ga0501038_0052814 Ga0501038_0052814_996_2234 391
89 3300049579 Ga0501043_0000104 Ga0501043_0000104_27199_28437 391
90 3300049581 Ga0501047_0005529 Ga0501047_0005529_4191_5429 391
91 3300049585 Ga0501069_0000016 Ga0501069_0000016_103131_104369 391
92 3300049585 Ga0501069_0006066 Ga0501069_0006066_283_1521 391
93 3300049586 Ga0501070_0000048 Ga0501070_0000048_63250_64488 391
94 3300049586 Ga0501070_0000333 Ga0501070_0000333_35395_36633 391
95 3300049586 Ga0501070_0074481 Ga0501070_0074481_441_1679 391
96 3300049586 Ga0501070_0083552 Ga0501070_0083552_931_2169 391
97 3300049587 Ga0501071_0005866 Ga0501071_0005866_6169_7407 391
98 3300049589 Ga0501073_0014519 Ga0501073_0014519_1568_2806 391
99 3300049590 Ga0501074_0000001 Ga0501074_0000001_5859_7097 391
100 3300049590 Ga0501074_0053514 Ga0501074_0053514_376_1614 391
101 3300049592 Ga0501076_0040256 Ga0501076_0040256_1626_2864 391
102 3300049742 Ga0501080_0000270 Ga0501080_0000270_15607_16845 391
103 3300049742 Ga0501080_0019484 Ga0501080_0019484_1777_3015 391
104 3300049744 Ga0501083_0000069 Ga0501083_0000069_24130_25368 391
105 3300049822 Ga0501035_0000048 Ga0501035_0000048_75007_76245 391
106 3300049822 Ga0501035_0016160 Ga0501035_0016160_1333_2571 391
107 3300049822 Ga0501035_0062300 Ga0501035_0062300_2051_3289 391
108 3300049823 Ga0501044_0000003 Ga0501044_0000003_177733_178971 391
109 3300049823 Ga0501044_0006733 Ga0501044_0006733_5103_6341 391
110 3300049823 Ga0501044_0041819 Ga0501044_0041819_2245_3483 391
111 3300049823 Ga0501044_0124692 Ga0501044_0124692_92_1330 391
112 3300060353 Ga0501082_0030997 Ga0501082_0030997_255_1493 391
113 3300006051 Ga0075364_10000626 Ga0075364_100006263 392
114 3300050491 nmdc:mga00v17_530_c1 nmdc:mga00v17_530_c1_13909_15135 392
115 3300053139 Ga0500568_0001123 Ga0500568_0001123_496_1731 392
116 3300053727 Ga0500611_013360 Ga0500611_013360_142_1377 392
117 iso_pu_bacteria 2585427633 2585995053 392
118 iso_pu_bacteria 2585427634 2585999596 392
119 3300005458 Ga0070681_10014974 Ga0070681_100149749 393
120 3300025912 Ga0207707_10022838 Ga0207707_100228381 393
121 3300025922 Ga0207646_10043524 Ga0207646_100435245 393
122 3300005455 Ga0070663_100022158 Ga0070663_1000221583 394
123 3300025294 Ga0209025_1019532 Ga0209025_10195324 394
124 3300026067 Ga0207678_10124460 Ga0207678_101244601 394
125 3300048927 Ga0496124_0000133 Ga0496124_0000133_12603_13817 394
126 3300050492 nmdc:mga0yw44_71918_c1 nmdc:mga0yw44_71918_c1_178_1416 394
127 3300053087 Ga0500643_014263 Ga0500643_014263_1029_2288 394
128 3300013100 Ga0157373_10045637 Ga0157373_100456373 395
129 3300041413 Ga0439465_0016137 Ga0439465_0016137_257_1543 395
130 3300049576 Ga0501040_0141726 Ga0501040_0141726_353_1591 395
131 3300003856 Ga0058692_1000888 Ga0058692_10008881 396
132 3300006051 Ga0075364_10088451 Ga0075364_100884512 396
133 3300006948 Ga0099826_10000859 Ga0099826_100008596 396
134 3300013102 Ga0157371_10030229 Ga0157371_100302293 396
135 3300013105 Ga0157369_10207579 Ga0157369_102075792 396
136 3300013249 Ga0171463_1001 Ga0171463_1001257 396
137 3300027312 Ga0209371_1009806 Ga0209371_10098062 396
138 3300027666 Ga0209282_1000483 Ga0209282_100048316 396
139 3300027866 Ga0209813_10017951 Ga0209813_100179512 396
140 3300030500 Ga0268256_1002522 Ga0268256_10025223 396
141 3300046558 Ga0495633_0029811 Ga0495633_0029811_1238_2452 396
142 3300047470 Ga0495681_0022147 Ga0495681_0022147_1126_2340 396
143 3300048919 Ga0496116_0000036 Ga0496116_0000036_227890_229086 396
144 3300048920 Ga0496117_0004346 Ga0496117_0004346_3178_4368 396
145 3300048924 Ga0496121_0001579 Ga0496121_0001579_3205_4461 396
146 3300048924 Ga0496121_0091440 Ga0496121_0091440_1027_2232 396
147 3300048925 Ga0496122_0000492 Ga0496122_0000492_56940_58130 396
148 3300048926 Ga0496123_0000460 Ga0496123_0000460_39791_40981 396
149 3300048927 Ga0496124_0000679 Ga0496124_0000679_24185_25375 396
150 3300048928 Ga0496125_0000912 Ga0496125_0000912_8279_9469 396
151 3300048929 Ga0496126_0000156 Ga0496126_0000156_145152_146348 396
152 3300048929 Ga0496126_0000811 Ga0496126_0000811_21180_22370 396
153 3300048929 Ga0496126_0005996 Ga0496126_0005996_3130_4320 396
154 3300053153 Ga0500616_0000224 Ga0500616_0000224_13393_14598 396
155 3300053157 Ga0500624_000336 Ga0500624_000336_11862_13076 396
156 3300005435 Ga0070714_100043608 Ga0070714_1000436082 398
157 3300005435 Ga0070714_100147103 Ga0070714_1001471033 398
158 3300005468 Ga0070707_100020390 Ga0070707_1000203905 398
159 3300005471 Ga0070698_100133264 Ga0070698_1001332642 398
160 3300005614 Ga0068856_100022260 Ga0068856_1000222602 398
161 3300006028 Ga0070717_10059479 Ga0070717_100594793 398
162 3300006871 Ga0075434_100240396 Ga0075434_1002403961 398
163 3300006946 Ga0079104_1007020 Ga0079104_10070203 398
164 3300007076 Ga0075435_100066606 Ga0075435_1000666062 398
165 3300013296 Ga0157374_10000790 Ga0157374_1000079014 398
166 3300021320 Ga0214544_1009397 Ga0214544_10093973 398
167 3300021321 Ga0214542_1000006 Ga0214542_100000612 398
168 3300021327 Ga0214543_1000014 Ga0214543_1000014311 398
169 3300022739 Ga0228711_1000001 Ga0228711_1000001107 398
170 3300022740 Ga0228710_1000001 Ga0228710_1000001218 398
171 3300025910 Ga0207684_10021512 Ga0207684_100215121 398
172 3300025915 Ga0207693_10162024 Ga0207693_101620242 398
173 3300025915 Ga0207693_10192747 Ga0207693_101927472 398
174 3300025922 Ga0207646_10003818 Ga0207646_100038188 398
175 3300025929 Ga0207664_10050721 Ga0207664_100507212 398
176 3300025929 Ga0207664_10163688 Ga0207664_101636882 398
177 3300026078 Ga0207702_10011479 Ga0207702_100114795 398
178 3300027111 Ga0209281_1000164 Ga0209281_100016412 398
179 3300027111 Ga0209281_1000332 Ga0209281_100033232 398
180 3300027666 Ga0209282_1000007 Ga0209282_1000007145 398
181 3300031967 Ga0315914_1000006 Ga0315914_100000698 398
182 3300033430 Ga0315913_1000002 Ga0315913_1000002145 398
183 3300033464 Ga0315915_1000001 Ga0315915_1000001342 398
184 3300035083 Ga0373926_0013772 Ga0373926_0013772_887_2098 398
185 3300037068 Ga0373925_0138571 Ga0373925_0138571_440_1651 398
186 3300048915 Ga0496112_0041910 Ga0496112_0041910_2605_3828 398
187 3300048920 Ga0496117_0040942 Ga0496117_0040942_799_2013 398
188 3300048921 Ga0496118_0039079 Ga0496118_0039079_307_1527 398
189 3300048922 Ga0496119_0019004 Ga0496119_0019004_2605_3825 398
190 3300048923 Ga0496120_0025259 Ga0496120_0025259_1224_2444 398
191 3300048924 Ga0496121_0000001 Ga0496121_0000001_841174_842388 398
192 3300048926 Ga0496123_0099964 Ga0496123_0099964_19_1233 398
193 3300048927 Ga0496124_0032190 Ga0496124_0032190_3318_4532 398
194 3300048928 Ga0496125_0000001 Ga0496125_0000001_955107_956321 398
195 3300048929 Ga0496126_0052873 Ga0496126_0052873_1438_2652 398
196 3300050491 nmdc:mga00v17_1425_c1 nmdc:mga00v17_1425_c1_5289_6503 398
197 3300050513 nmdc:mga0rr50_61352_c1 nmdc:mga0rr50_61352_c1_570_1793 398
198 3300025294 Ga0209025_1000074 Ga0209025_1000074205 399
199 3300025294 Ga0209025_1000080 Ga0209025_100008088 399
200 3300027312 Ga0209371_1000021 Ga0209371_1000021532 399
201 3300030500 Ga0268256_1000020 Ga0268256_1000020538 399
202 3300046674 Ga0495588_0001302 Ga0495588_0001302_6252_7466 399
203 iso_pu_bacteria 2600254933 2600375220 399
204 3300031730 Ga0307516_10152895 Ga0307516_101528952 400
205 iso_pu_bacteria 2537561587 2537874452 400
206 iso_pu_bacteria 2554235003 2554247062 400
207 iso_pu_bacteria 2558860242 2559294287 400
208 iso_pu_bacteria 2558860983 2561466022 400
209 iso_pu_bacteria 2599185210 2599602648 400
210 iso_pu_bacteria 2599185236 2599723129 400
211 iso_pu_bacteria 2600255279 2601608726 400
212 iso_pu_bacteria 2600255308 2601745500 400
213 iso_pu_bacteria 2643221582 2643918662 400
214 iso_pu_bacteria 2643221653 2644296883 400
215 iso_pu_bacteria 2643221693 2644518795 400
216 iso_pu_bacteria 2643221719 2644655137 400
217 iso_pu_bacteria 2808606387 2808985938 400
218 iso_pu_bacteria 2818991272 2819242598 400
219 iso_pu_bacteria 2818991439 2819556058 400
220 iso_pu_bacteria 2838675328 2838676784 400
221 iso_pu_bacteria 2838714209 2838715668 400
222 iso_pu_bacteria 2838719591 2838720532 400
223 iso_pu_bacteria 2838724970 2838726424 400
224 iso_pu_bacteria 2841846520 2841847466 400
225 iso_pu_bacteria 2841859092 2841859998 400
226 iso_pu_bacteria 2842124991 2842126504 400
227 iso_pu_bacteria 2842130223 2842131677 400
228 iso_pu_bacteria 2842152218 2842153154 400
229 iso_pu_bacteria 2842170452 2842171911 400
230 iso_pu_bacteria 2842175837 2842176773 400
231 iso_pu_bacteria 2842187318 2842188776 400
232 iso_pu_bacteria 2842211629 2842213087 400
233 iso_pu_bacteria 2842224351 2842225294 400
234 iso_pu_bacteria 2842515876 2842516783 400
235 iso_pu_bacteria 2899792073 2899796551 400
236 iso_pu_bacteria 2899803654 2899803733 400
237 iso_pu_bacteria 2899845264 2899847183 400
238 iso_pu_bacteria 2919114240 2919115871 400
239 iso_pu_bacteria 2926754445 2926756811 400
240 iso_pu_bacteria 2926760298 2926761050 400
241 iso_pu_bacteria 2929138655 2929139474 400
242 iso_pu_bacteria 2933006813 2933007797 400
243 iso_pu_bacteria 2933011516 2933012575 400
244 iso_pu_bacteria 2933594066 2933595017 400
245 iso_pu_bacteria 2979089926 2979093671 400
246 iso_pu_bacteria 2979095461 2979098945 400
247 iso_pu_bacteria 2979100975 2979105649 400
248 iso_pu_bacteria 2984509177 2984512505 400
249 iso_pu_bacteria 2984518228 2984521134 400
250 iso_pu_bacteria 2984537506 2984540428 400
251 iso_pu_bacteria 2984601300 2984602625 400
252 iso_pu_bacteria 2989776772 2989778130 400
253 iso_pu_bacteria 650716007 650739484 400
254 iso_pu_bacteria 8003570095 8003570527 400
255 iso_pu_bacteria 8005246636 8005251373 400
256 iso_pu_bacteria 8018150411 8018152196 400
257 iso_pu_bacteria 8056875544 8056876624 400
258 3300053156 Ga0500622_0004347 Ga0500622_0004347_2865_4115 401
259 iso_pu_bacteria 2510461069 2510840293 401
260 iso_pu_bacteria 2775507049 2776912720 401
261 iso_pu_bacteria 2643221558 2643810051 402
262 3300028794 Ga0307515_10000070 Ga0307515_10000070234 403
263 iso_pu_bacteria 2821123053 2821124211 403
264 iso_pu_bacteria 2837678835 2837683161 403
265 iso_pu_bacteria 2838736955 2838741299 403
266 iso_pu_bacteria 2841840854 2841844804 403
267 iso_pu_bacteria 2842140634 2842144526 403
268 iso_pu_bacteria 2857531043 2857531790 403
269 iso_pu_bacteria 2891373044 2891374727 403
270 iso_pu_bacteria 2989349275 2989354213 403
271 iso_pu_bacteria 8045864390 8045867786 403
272 iso_pu_bacteria 8054460903 8054461852 403
273 3300003856 Ga0058692_1001670 Ga0058692_10016701 404
274 3300053161 Ga0500634_0007390 Ga0500634_0007390_2665_3879 404
275 3300053177 Ga0500636_0000004 Ga0500636_0000004_35226_36440 404
276 iso_pu_bacteria 2513237351 2514588234 404
277 iso_pu_bacteria 2643221568 2643855916 404
278 iso_pu_bacteria 2643221623 2644132864 404
279 iso_pu_bacteria 2738543024 2739306511 404
280 iso_pu_bacteria 2791355253 2793282261 404
281 iso_pu_bacteria 2837651117 2837653427 404
282 iso_pu_bacteria 2854916844 2854918272 404
283 iso_pu_bacteria 2919166419 2919167318 404
284 iso_pu_bacteria 2978969890 2978973751 404
285 iso_pu_bacteria 2984587000 2984592022 404
286 iso_pu_bacteria 2996310559 2996313262 404
287 iso_pu_bacteria 8002285264 8002287852 404
288 3300028794 Ga0307515_10000444 Ga0307515_1000044436 405
289 3300031456 Ga0307513_10142842 Ga0307513_101428422 405
290 3300046460 Ga0495638_0040030 Ga0495638_0040030_1295_2524 405
291 iso_pu_bacteria 2757320392 2757570743 405
292 iso_pu_bacteria 2765235802 2765465155 405
293 iso_pu_bacteria 2767802442 2770197301 405
294 iso_pu_bacteria 2775506902 2776271993 405
295 iso_pu_bacteria 2775506904 2776279488 405
296 iso_pu_bacteria 2839993093 2839995938 405
297 iso_pu_bacteria 2840764183 2840769626 405
298 iso_pu_bacteria 2889790730 2889795306 405
299 iso_pu_bacteria 2889914905 2889916829 405
300 iso_pu_bacteria 2894652903 2894654924 405
301 iso_pu_bacteria 2904578770 2904581324 405
302 iso_pu_bacteria 2919119836 2919122563 405
303 iso_pu_bacteria 2937843397 2937846740 405
304 iso_pu_bacteria 3002141150 3002143287 405
305 3300003187 JGI25151J46595_10034472 JGI25151J46595_100344721 406
306 3300025294 Ga0209025_1000149 Ga0209025_100014928 406
307 iso_pu_bacteria 2510917026 2511171782 406
308 iso_pu_bacteria 2516143018 2516208849 406
309 iso_pu_bacteria 2690316117 2692316856 406
310 iso_pu_bacteria 2751185821 2753460777 406
311 iso_pu_bacteria 2791355091 2792622715 406
312 iso_pu_bacteria 2791355092 2792628364 406
313 iso_pu_bacteria 2791355094 2792638374 406
314 iso_pu_bacteria 2847417321 2847418078 406
315 iso_pu_bacteria 2848992105 2848993051 406
316 iso_pu_bacteria 2855872281 2855879189 406
317 iso_pu_bacteria 2919171160 2919171490 406
318 iso_pu_bacteria 2996336353 2996340296 406
319 3300049568 Ga0501031_0035109 Ga0501031_0035109_597_1943 407
320 3300049579 Ga0501043_0061864 Ga0501043_0061864_805_2151 407
321 iso_pu_bacteria 2582581283 2585165506 407
322 iso_pu_bacteria 2643221637 2644206241 407
323 iso_pu_bacteria 2643221718 2644649888 407
324 iso_pu_bacteria 2791355082 2792584134 407
325 iso_pu_bacteria 2920760137 2920762905 407
326 iso_pu_bacteria 2989771324 2989772016 407
327 iso_pu_bacteria 3003930520 3003932630 407
328 iso_pu_bacteria 8049293176 8049293892 407
329 3300005548 Ga0070665_100046844 Ga0070665_1000468445 408
330 3300028379 Ga0268266_10051818 Ga0268266_100518182 408
331 3300053111 Ga0500572_001399 Ga0500572_001399_4229_5455 408
332 3300053177 Ga0500636_0008398 Ga0500636_0008398_199_1425 408
333 iso_pu_bacteria 2508501122 2509108485 408
334 iso_pu_bacteria 2509276019 2509374488 408
335 iso_pu_bacteria 2510065057 2510306617 408
336 iso_pu_bacteria 2511231052 2511500980 408
337 iso_pu_bacteria 2512047086 2512532396 408
338 iso_pu_bacteria 2512875026 2512972279 408
339 iso_pu_bacteria 2513237086 2513583481 408
340 iso_pu_bacteria 2513237089 2513603358 408
341 iso_pu_bacteria 2513237091 2513620765 408
342 iso_pu_bacteria 2513237140 2513881131 408
343 iso_pu_bacteria 2513237143 2513907116 408
344 iso_pu_bacteria 2513237156 2513983963 408
345 iso_pu_bacteria 2513237159 2513999527 408
346 iso_pu_bacteria 2513237160 2514004813 408
347 iso_pu_bacteria 2515154107 2515608095 408
348 iso_pu_bacteria 2516653046 2516892261 408
349 iso_pu_bacteria 2517487022 2517569056 408
350 iso_pu_bacteria 2524023207 2524451167 408
351 iso_pu_bacteria 2551306084 2551676441 408
352 iso_pu_bacteria 2551306085 2551687202 408
353 iso_pu_bacteria 2551306086 2551693856 408
354 iso_pu_bacteria 2551306087 2551703531 408
355 iso_pu_bacteria 2551306089 2551715545 408
356 iso_pu_bacteria 2551306090 2551720662 408
357 iso_pu_bacteria 2551306091 2551725390 408
358 iso_pu_bacteria 2551306092 2551738060 408
359 iso_pu_bacteria 2551306093 2551740411 408
360 iso_pu_bacteria 2558860100 2558863515 408
361 iso_pu_bacteria 2582581306 2585266208 408
362 iso_pu_bacteria 2582581865 2585387209 408
363 iso_pu_bacteria 2582581866 2585392674 408
364 iso_pu_bacteria 2599185156 2599333813 408
365 iso_pu_bacteria 2599185352 2600191898 408
366 iso_pu_bacteria 2643221557 2643807237 408
367 iso_pu_bacteria 2643221610 2644069497 408
368 iso_pu_bacteria 2643221618 2644109027 408
369 iso_pu_bacteria 2643221626 2644151549 408
370 iso_pu_bacteria 2643221655 2644311683 408
371 iso_pu_bacteria 2643221659 2644329941 408
372 iso_pu_bacteria 2643221668 2644380619 408
373 iso_pu_bacteria 2643221675 2644420651 408
374 iso_pu_bacteria 2643221680 2644454176 408
375 iso_pu_bacteria 2643221688 2644493436 408
376 iso_pu_bacteria 2643221698 2644546615 408
377 iso_pu_bacteria 2643221712 2644617482 408
378 iso_pu_bacteria 2643221726 2644689513 408
379 iso_pu_bacteria 2657244999 2657683293 408
380 iso_pu_bacteria 2802428858 2802717699 408
381 iso_pu_bacteria 2802428859 2802723373 408
382 iso_pu_bacteria 2802428860 2802731176 408
383 iso_pu_bacteria 2802428861 2802736183 408
384 iso_pu_bacteria 2802428862 2802743607 408
385 iso_pu_bacteria 2802428863 2802750681 408
386 iso_pu_bacteria 2802429268 2804751318 408
387 iso_pu_bacteria 2838074704 2838076409 408
388 iso_pu_bacteria 2842521101 2842525320 408
389 iso_pu_bacteria 2842922631 2842924749 408
390 iso_pu_bacteria 2844163670 2844168552 408
391 iso_pu_bacteria 2850079185 2850080446 408
392 iso_pu_bacteria 2855825444 2855831331 408
393 iso_pu_bacteria 2855839649 2855840456 408
394 iso_pu_bacteria 2858800743 2858800985 408
395 iso_pu_bacteria 2896384573 2896386610 408
396 iso_pu_bacteria 2913295892 2913297474 408
397 iso_pu_bacteria 2915980308 2915986179 408
398 iso_pu_bacteria 2915986958 2915990600 408
399 iso_pu_bacteria 2915993759 2915996252 408
400 iso_pu_bacteria 2916000859 2916005730 408
401 iso_pu_bacteria 2916007675 2916014161 408
402 iso_pu_bacteria 2916014648 2916016572 408
403 iso_pu_bacteria 2916021584 2916024771 408
404 iso_pu_bacteria 2916028427 2916032172 408
405 iso_pu_bacteria 2916035215 2916038173 408
406 iso_pu_bacteria 2916041962 2916047175 408
407 iso_pu_bacteria 2916048683 2916053203 408
408 iso_pu_bacteria 2916055098 2916055349 408
409 iso_pu_bacteria 2916061851 2916062830 408
410 iso_pu_bacteria 2916068649 2916074979 408
411 iso_pu_bacteria 2916076590 2916076822 408
412 iso_pu_bacteria 2920822456 2920823811 408
413 iso_pu_bacteria 2921201388 2921206429 408
414 iso_pu_bacteria 2921208531 2921214405 408
415 iso_pu_bacteria 2921237296 2921241631 408
416 iso_pu_bacteria 2921244191 2921247507 408
417 iso_pu_bacteria 2921250672 2921250961 408
418 iso_pu_bacteria 2921257292 2921259996 408
419 iso_pu_bacteria 2921263974 2921264226 408
420 iso_pu_bacteria 2921282425 2921285356 408
421 iso_pu_bacteria 2921289301 2921290120 408
422 iso_pu_bacteria 2921296804 2921304221 408
423 iso_pu_bacteria 2924144063 2924145591 408
424 iso_pu_bacteria 2924150972 2924155890 408
425 iso_pu_bacteria 2924158325 2924160582 408
426 iso_pu_bacteria 2924165586 2924168141 408
427 iso_pu_bacteria 2924172951 2924177838 408
428 iso_pu_bacteria 2924179722 2924185567 408
429 iso_pu_bacteria 2924186466 2924189522 408
430 iso_pu_bacteria 2924193448 2924198257 408
431 iso_pu_bacteria 2924200457 2924204050 408
432 iso_pu_bacteria 2924207177 2924209918 408
433 iso_pu_bacteria 2924214083 2924218281 408
434 iso_pu_bacteria 2924221636 2924223786 408
435 iso_pu_bacteria 2924228884 2924234943 408
436 iso_pu_bacteria 2936996657 2937001087 408
437 iso_pu_bacteria 2937002841 2937009505 408
438 iso_pu_bacteria 2937009748 2937010895 408
439 iso_pu_bacteria 2937016420 2937018975 408
440 iso_pu_bacteria 2937023124 2937027916 408
441 iso_pu_bacteria 2937029754 2937029860 408
442 iso_pu_bacteria 2937036028 2937036886 408
443 iso_pu_bacteria 2937042894 2937043292 408
444 iso_pu_bacteria 2937049772 2937056275 408
445 iso_pu_bacteria 2937056579 2937061289 408
446 iso_pu_bacteria 2937063883 2937064379 408
447 iso_pu_bacteria 2937071275 2937077082 408
448 iso_pu_bacteria 2937078374 2937082967 408
449 iso_pu_bacteria 2937084907 2937091245 408
450 iso_pu_bacteria 2937091812 2937095598 408
451 iso_pu_bacteria 2937098957 2937104209 408
452 iso_pu_bacteria 2937106411 2937112501 408
453 iso_pu_bacteria 2937113482 2937118309 408
454 iso_pu_bacteria 2937119839 2937121194 408
455 iso_pu_bacteria 2937126314 2937129828 408
456 iso_pu_bacteria 2941499720 2941500251 408
457 iso_pu_bacteria 2957375807 2957380019 408
458 iso_pu_bacteria 2957382221 2957385060 408
459 iso_pu_bacteria 2957388812 2957389123 408
460 iso_pu_bacteria 2957395598 2957396967 408
461 iso_pu_bacteria 2957402308 2957405439 408
462 iso_pu_bacteria 2957408893 2957413242 408
463 iso_pu_bacteria 2957415311 2957419208 408
464 iso_pu_bacteria 2957422303 2957426461 408
465 iso_pu_bacteria 2957430029 2957431081 408
466 iso_pu_bacteria 2957437181 2957442030 408
467 iso_pu_bacteria 2957443900 2957446644 408
468 iso_pu_bacteria 2957450854 2957454199 408
469 iso_pu_bacteria 2957457609 2957462441 408
470 iso_pu_bacteria 2957464669 2957467739 408
471 iso_pu_bacteria 2957471148 2957476690 408
472 iso_pu_bacteria 2957478035 2957480619 408
473 iso_pu_bacteria 2957484790 2957490196 408
474 iso_pu_bacteria 2957491536 2957496003 408
475 iso_pu_bacteria 2957498199 2957501046 408
476 iso_pu_bacteria 2957505466 2957509602 408
477 iso_pu_bacteria 2960584000 2960586653 408
478 iso_pu_bacteria 2960591022 2960595579 408
479 iso_pu_bacteria 2960597568 2960600566 408
480 iso_pu_bacteria 2960603979 2960609466 408
481 iso_pu_bacteria 2960610863 2960616795 408
482 iso_pu_bacteria 2960617483 2960617713 408
483 iso_pu_bacteria 2960624210 2960625446 408
484 iso_pu_bacteria 2960631154 2960633220 408
485 iso_pu_bacteria 2960637947 2960640217 408
486 iso_pu_bacteria 2960645483 2960648718 408
487 iso_pu_bacteria 2960652885 2960653716 408
488 iso_pu_bacteria 2960660292 2960666414 408
489 iso_pu_bacteria 2960667422 2960673934 408
490 iso_pu_bacteria 2960674078 2960678841 408
491 iso_pu_bacteria 2960680706 2960684168 408
492 iso_pu_bacteria 2960687367 2960692015 408
493 iso_pu_bacteria 2960693952 2960699309 408
494 iso_pu_bacteria 2964607997 2964613994 408
495 iso_pu_bacteria 2964615318 2964619999 408
496 iso_pu_bacteria 2964621998 2964623312 408
497 iso_pu_bacteria 2964628898 2964633107 408
498 iso_pu_bacteria 2964636051 2964641291 408
499 iso_pu_bacteria 2964643177 2964646170 408
500 iso_pu_bacteria 2964649959 2964653113 408
501 iso_pu_bacteria 2964656573 2964659289 408
502 iso_pu_bacteria 2964663802 2964665963 408
503 iso_pu_bacteria 2964670856 2964672411 408
504 iso_pu_bacteria 2964678106 2964679295 408
505 iso_pu_bacteria 2964685014 2964688117 408
506 iso_pu_bacteria 2964691889 2964695850 408
507 iso_pu_bacteria 2964698721 2964703586 408
508 iso_pu_bacteria 2964705432 2964708085 408
509 iso_pu_bacteria 2964712639 2964716308 408
510 iso_pu_bacteria 2964719344 2964726080 408
511 iso_pu_bacteria 2967664464 2967671096 408
512 iso_pu_bacteria 2967671571 2967672135 408
513 iso_pu_bacteria 2967678726 2967681052 408
514 iso_pu_bacteria 2967686174 2967686421 408
515 iso_pu_bacteria 2967693043 2967693255 408
516 iso_pu_bacteria 2967699805 2967704231 408
517 iso_pu_bacteria 2967706974 2967708678 408
518 iso_pu_bacteria 2967714385 2967716520 408
519 iso_pu_bacteria 2967721400 2967724596 408
520 iso_pu_bacteria 2967728569 2967734728 408
521 iso_pu_bacteria 2967735183 2967737571 408
522 iso_pu_bacteria 2967742019 2967745548 408
523 iso_pu_bacteria 2967748971 2967752096 408
524 iso_pu_bacteria 2967755722 2967760563 408
525 iso_pu_bacteria 2967762386 2967764440 408
526 iso_pu_bacteria 2967769361 2967770801 408
527 iso_pu_bacteria 2967775926 2967782186 408
528 iso_pu_bacteria 2970019648 2970026080 408
529 iso_pu_bacteria 2970026789 2970029107 408
530 iso_pu_bacteria 2970033650 2970037811 408
531 iso_pu_bacteria 2970040964 2970043276 408
532 iso_pu_bacteria 2970047711 2970052878 408
533 iso_pu_bacteria 2970054988 2970059598 408
534 iso_pu_bacteria 2970061556 2970063284 408
535 iso_pu_bacteria 2970068827 2970069801 408
536 iso_pu_bacteria 2970076120 2970076960 408
537 iso_pu_bacteria 2970082768 2970085639 408
538 iso_pu_bacteria 2970088815 2970094390 408
539 iso_pu_bacteria 2970095765 2970096725 408
540 iso_pu_bacteria 2970102677 2970106920 408
541 iso_pu_bacteria 2970109326 2970109809 408
542 iso_pu_bacteria 2970116247 2970117959 408
543 iso_pu_bacteria 2970122695 2970124453 408
544 iso_pu_bacteria 2970129317 2970129527 408
545 iso_pu_bacteria 2970136068 2970143140 408
546 iso_pu_bacteria 2970143518 2970144379 408
547 iso_pu_bacteria 2970149975 2970153804 408
548 iso_pu_bacteria 2970156795 2970163682 408
549 iso_pu_bacteria 2970164137 2970167513 408
550 iso_pu_bacteria 2970170962 2970171803 408
551 iso_pu_bacteria 2970177841 2970182805 408
552 iso_pu_bacteria 2970184632 2970188264 408
553 iso_pu_bacteria 2970191845 2970198314 408
554 iso_pu_bacteria 2977516862 2977518469 408
555 iso_pu_bacteria 2977523885 2977527665 408
556 iso_pu_bacteria 2977530762 2977531905 408
557 iso_pu_bacteria 2977537788 2977537998 408
558 iso_pu_bacteria 2977544691 2977544938 408
559 iso_pu_bacteria 2977551784 2977551996 408
560 iso_pu_bacteria 2977558990 2977561662 408
561 iso_pu_bacteria 2977565890 2977568991 408
562 iso_pu_bacteria 2977572785 2977578951 408
563 iso_pu_bacteria 2977579622 2977581485 408
564 iso_pu_bacteria 648276728 648736375 408
565 iso_pu_bacteria 8003992118 8003992954 408
566 iso_pu_bacteria 8003999396 8004000189 408
567 3300037471 Ga0395905_0046789 Ga0395905_0046789_1843_3126 409
568 iso_pu_bacteria 2643221607 2644046625 409
569 iso_pu_bacteria 2643221636 2644202332 409
570 iso_pu_bacteria 2643221686 2644479414 409
571 iso_pu_bacteria 2643221689 2644502453 409
572 iso_pu_bacteria 643692032 643825054 409
573 3300031711 Ga0265314_10003051 Ga0265314_100030514 410
574 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002267 412
575 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008267 412
576 3300003374 JGI25161J50226_1000380 JGI25161J50226_10003809 412
577 3300003771 Ga0055526_1001532 Ga0055526_10015321 412
578 3300003771 Ga0055526_1004557 Ga0055526_10045571 412
579 3300003771 Ga0055526_1012628 Ga0055526_10126284 412
580 3300003775 Ga0055524_1002806 Ga0055524_10028067 412
581 3300003781 Ga0055536_1000472 Ga0055536_100047226 412
582 3300004625 Ga0055543_1000971 Ga0055543_10009716 412
583 3300005262 Ga0065165_1000015 Ga0065165_1000015268 412
584 3300015690 Ga0183363_1394 Ga0183363_13942 412
585 3300025284 Ga0209130_1000007 Ga0209130_100000735 412
586 3300025292 Ga0209676_1018539 Ga0209676_10185391 412
587 3300025294 Ga0209025_1000100 Ga0209025_1000100180 412
588 3300025295 Ga0209564_1000439 Ga0209564_100043958 412
589 3300025298 Ga0209050_1001222 Ga0209050_100122221 412
590 3300025299 Ga0209256_1001410 Ga0209256_100141011 412
591 3300025299 Ga0209256_1001505 Ga0209256_100150514 412
592 3300025302 Ga0207426_1000064 Ga0207426_100006435 412
593 3300025303 Ga0209051_1017747 Ga0209051_10177472 412
594 3300025304 Ga0209257_1001514 Ga0209257_10015144 412
595 3300031548 Ga0307408_100099608 Ga0307408_1000996082 412
596 3300042531 Ga0450918_006841 Ga0450918_006841_243_1484 412

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

60

403

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.902 19 400
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8982 19 399
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8783 19 404
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.873 19 401
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8677 19 400
ID Description Score Start End Superfamily
af_Q7JWI7_52_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9485 19 198 1.20.1250.20
af_Q8T043_137_396_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9452 19 198 1.20.1250.20
af_Q5NC32_11_193_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9436 19 198 1.20.1250.20
af_F1QW16_40_223_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9387 19 198 1.20.1250.20
af_E7FGJ9_71_276_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.926 19 201 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3Q2ZJP9-F1-model_v4 Monocarboxylate transporter 6-like 0.8907 19 398 GO:0008028
GO:0016323
AF-A0A5C5TED8-F1-model_v4 MFS transporter 0.8902 3 404 GO:0016020
GO:0022857
AF-A0A508VID3-F1-model_v4 deleted 0.8879 21 407
AF-A0A661ERS6-F1-model_v4 MFS transporter 0.8867 15 408 GO:0005886
GO:0046943
AF-A0A2S8RNB3-F1-model_v4 AAHS family 3-hydroxyphenylpropionic acid transporter 0.8848 19 397 GO:0005886
GO:0046943

Feature Viewer

pLDDT pTM Quality
89.05 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map