F467604

General Info

Members Datasets Scaffolds Average Seq Length
596 337 1192 319

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0087567|Ga0501045_0087567_1139_2287
Length 382
Sequence VAREEAHLRLPAAVVAGELVDEDDRRSVAGLLVMKAGAVVRASVWHRFFAKRRPLSLHHILMGSPVRALIACFVLGFSSLVSAQAGYPNRPIRLIVTVPPGGAADFIARLVGGKVADALGQPVLVENRGGAGGTIAADAVAKAPADGYTLLQNSITTHGVGPHLYSKLPYDPVKDFAAVGGLALLPLVMAVNADLSAKTVDEVISLSKKTSLNFASSGNGGAPHMAAELFKSVTGAALTHVPYKGSGPAVADLVGGRVQIMFDAPPSLIQHIRGGKLRVLAAASAQRNRLLPEAPTFAELGYPQVAVSLWYGLLAPAGTPRPVIARLNAEVSRALQSSEVRDRLQAQGAEPMPGTPEAFAAFMREEMAKWAPVVKQAGVKLD

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
223 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
226 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0
Rhizoplane 4.7
Rhizosphere 88.42
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0087567 3300049824 Bacteria 2300
2 JGI24743J22301_10009334 3300001991 Bacteria 1736
3 JGI24738J21930_10018815 3300002075 Unclassified 1443
4 JGI24744J21845_10013371 3300002077 Unclassified 1655
5 JGI24742J22300_10008724 3300002244 Unclassified 1671
6 JGI25153J46596_10002964 3300003215 Bacteria 9616
7 JGI25153J46596_10004430 3300003215 Bacteria 7576
8 Ga0065712_10076209 3300005290 Bacteria 3710
9 Ga0070683_100007986 3300005329 Bacteria 8978
10 Ga0070683_100080356 3300005329 Bacteria 3052
11 Ga0070690_100002470 3300005330 Bacteria 9938
12 Ga0070670_100046961 3300005331 Bacteria 3715
13 Ga0070677_10030825 3300005333 Bacteria 2044
14 Ga0068869_100063712 3300005334 Unclassified 2709
15 Ga0068869_100095903 3300005334 Bacteria 2238
16 Ga0068869_100309620 3300005334 Bacteria 1278
17 Ga0070666_10021763 3300005335 Bacteria 4156
18 Ga0070680_100013168 3300005336 Bacteria 6438
19 Ga0070680_100025401 3300005336 Bacteria 4735
20 Ga0070682_100122885 3300005337 Bacteria 1745
21 Ga0068868_100005853 3300005338 Bacteria 8669
22 Ga0068868_100006058 3300005338 Bacteria 8539
23 Ga0068868_100008082 3300005338 Bacteria 7525
24 Ga0070689_100013130 3300005340 Bacteria 5986
25 Ga0070691_10001532 3300005341 Bacteria 9941
26 Ga0070691_10133705 3300005341 Unclassified 1259
27 Ga0070687_100000563 3300005343 Bacteria 12391
28 Ga0070661_100006718 3300005344 Bacteria 7931
29 Ga0070661_100052899 3300005344 Bacteria 2971
30 Ga0070668_100157882 3300005347 Unclassified 1838
31 Ga0070669_100004794 3300005353 Bacteria 9761
32 Ga0070675_100000678 3300005354 Bacteria 23632
33 Ga0070675_100042286 3300005354 Bacteria 3723
34 Ga0070671_100000403 3300005355 Bacteria 29810
35 Ga0070671_100182696 3300005355 Bacteria 1776
36 Ga0070674_100010484 3300005356 Bacteria 5606
37 Ga0070673_100005786 3300005364 Bacteria 7963
38 Ga0070659_100243602 3300005366 Unclassified 1489
39 Ga0070667_100293096 3300005367 Bacteria 1464
40 Ga0070667_100336110 3300005367 Bacteria 1365
41 Ga0070703_10051590 3300005406 Bacteria 1317
42 Ga0070714_100026265 3300005435 Bacteria 4811
43 Ga0070713_100103250 3300005436 Bacteria 2473
44 Ga0070713_100485481 3300005436 Unclassified 1164
45 Ga0070701_10000846 3300005438 Bacteria 10972
46 Ga0070705_100007263 3300005440 Bacteria 5449
47 Ga0070705_100011771 3300005440 Bacteria 4426
48 Ga0070700_100027753 3300005441 Bacteria 3360
49 Ga0070694_100004374 3300005444 Bacteria 8500
50 Ga0070694_100036957 3300005444 Bacteria 3237
51 Ga0070694_100095538 3300005444 Bacteria 2093
52 Ga0070678_100004377 3300005456 Bacteria 8000
53 Ga0070662_100048244 3300005457 Bacteria 3067
54 Ga0070681_10004036 3300005458 Bacteria 13848
55 Ga0070681_10085487 3300005458 Bacteria 3106
56 Ga0068867_100001052 3300005459 Bacteria 18822
57 Ga0068867_100027859 3300005459 Bacteria 4064
58 Ga0068867_100191118 3300005459 Unclassified 1634
59 Ga0070685_10137947 3300005466 Unclassified 1532
60 Ga0070706_100038959 3300005467 Bacteria 4387
61 Ga0070707_100066222 3300005468 Bacteria 3471
62 Ga0070698_100084696 3300005471 Bacteria 3158
63 Ga0070698_100265190 3300005471 Bacteria 1649
64 Ga0070699_100003640 3300005518 Bacteria 13637
65 Ga0070699_100019712 3300005518 Bacteria 5812
66 Ga0070699_100115561 3300005518 Bacteria 2358
67 Ga0070699_100149460 3300005518 Bacteria 2065
68 Ga0070679_100040873 3300005530 Bacteria 4614
69 Ga0070679_100211279 3300005530 Bacteria 1904
70 Ga0070679_100332290 3300005530 Bacteria 1468
71 Ga0070684_100009449 3300005535 Bacteria 7680
72 Ga0070684_100018260 3300005535 Bacteria 5776
73 Ga0070684_100337857 3300005535 Unclassified 1384
74 Ga0070697_100040276 3300005536 Bacteria 3779
75 Ga0070697_100128533 3300005536 Bacteria 2123
76 Ga0068853_100357414 3300005539 Bacteria 1360
77 Ga0070672_100004172 3300005543 Bacteria 9433
78 Ga0070672_100058929 3300005543 Bacteria 3020
79 Ga0070672_100077266 3300005543 Bacteria 2662
80 Ga0070686_100004643 3300005544 Bacteria 7575
81 Ga0070695_100013642 3300005545 Bacteria 4884
82 Ga0070696_100000286 3300005546 Bacteria 30468
83 Ga0070696_100005387 3300005546 Bacteria 8533
84 Ga0070696_100009006 3300005546 Bacteria 6682
85 Ga0070693_100000272 3300005547 Bacteria 24379
86 Ga0070693_100024057 3300005547 Bacteria 3263
87 Ga0070704_100000332 3300005549 Bacteria 21391
88 Ga0070704_100258769 3300005549 Bacteria 1433
89 Ga0068855_100056798 3300005563 Bacteria 4590
90 Ga0068855_100331863 3300005563 Bacteria 1679
91 Ga0068855_100626910 3300005563 Bacteria 1157
92 Ga0070664_100000715 3300005564 Bacteria 25421
93 Ga0068857_100147192 3300005577 Bacteria 2132
94 Ga0068854_100013961 3300005578 Bacteria 5284
95 Ga0068854_100017041 3300005578 Bacteria 4856
96 Ga0068854_100155115 3300005578 Unclassified 1769
97 Ga0068856_100123154 3300005614 Bacteria 2595
98 Ga0068856_100172592 3300005614 Bacteria 2174
99 Ga0070702_100002099 3300005615 Bacteria 8457
100 Ga0070702_100136354 3300005615 Unclassified 1557
101 Ga0068852_100012610 3300005616 Bacteria 6425
102 Ga0068852_100268956 3300005616 Unclassified 1639
103 Ga0068859_100326350 3300005617 Unclassified 1629
104 Ga0068864_100000855 3300005618 Bacteria 25703
105 Ga0068864_100007948 3300005618 Bacteria 8742
106 Ga0068866_10000268 3300005718 Bacteria 24645
107 Ga0068866_10043756 3300005718 Unclassified 2236
108 Ga0068861_100000494 3300005719 Bacteria 22919
109 Ga0068861_100003214 3300005719 Bacteria 10812
110 Ga0068861_100078036 3300005719 Bacteria 2585
111 Ga0068851_10006680 3300005834 Bacteria 5278
112 Ga0068870_10013548 3300005840 Bacteria 3835
113 Ga0068870_10048226 3300005840 Bacteria 2242
114 Ga0068863_100021690 3300005841 Bacteria 6127
115 Ga0068863_100171565 3300005841 Bacteria 2080
116 Ga0068858_100094887 3300005842 Bacteria 2779
117 Ga0068858_100163526 3300005842 Bacteria 2096
118 Ga0068860_100001071 3300005843 Bacteria 30156
119 Ga0068862_100005771 3300005844 Bacteria 10322
120 Ga0068862_100146254 3300005844 Bacteria 2101
121 Ga0081455_10003936 3300005937 Bacteria 16884
122 Ga0081455_10014656 3300005937 Bacteria 7666
123 Ga0081455_10048635 3300005937 Bacteria 3662
124 Ga0081455_10050038 3300005937 Bacteria 3597
125 Ga0081455_10180659 3300005937 Bacteria 1598
126 Ga0081540_1000026 3300005983 Bacteria 155402
127 Ga0081539_10008045 3300005985 Bacteria 9340
128 Ga0081539_10033748 3300005985 Bacteria 3109
129 Ga0070717_10159162 3300006028 Bacteria 1958
130 Ga0075365_10012874 3300006038 Bacteria 4985
131 Ga0075365_10038691 3300006038 Bacteria 3102
132 Ga0075365_10059819 3300006038 Bacteria 2540
133 Ga0075365_10181074 3300006038 Bacteria 1473
134 Ga0075368_10004530 3300006042 Bacteria 4722
135 Ga0075368_10050465 3300006042 Bacteria 1652
136 Ga0075363_100000486 3300006048 Bacteria 12590
137 Ga0075363_100045905 3300006048 Bacteria 2317
138 Ga0075364_10058077 3300006051 Bacteria 2535
139 Ga0075364_10086138 3300006051 Bacteria 2081
140 Ga0070716_100027556 3300006173 Bacteria 3054
141 Ga0070716_100271943 3300006173 Bacteria 1165
142 Ga0070712_100018198 3300006175 Bacteria 4560
143 Ga0075367_10075989 3300006178 Bacteria 2026
144 Ga0075367_10120661 3300006178 Bacteria 1615
145 Ga0075369_10013341 3300006186 Bacteria 3260
146 Ga0075369_10025096 3300006186 Bacteria 2476
147 Ga0075369_10065295 3300006186 Bacteria 1595
148 Ga0075366_10053412 3300006195 Bacteria 2400
149 Ga0097621_100002822 3300006237 Bacteria 11907
150 Ga0097621_100003412 3300006237 Bacteria 10943
151 Ga0097621_100050446 3300006237 Bacteria 3384
152 Ga0075370_10021086 3300006353 Bacteria 3568
153 Ga0068871_100002838 3300006358 Bacteria 11867
154 Ga0068871_100003826 3300006358 Bacteria 10375
155 Ga0068871_100460242 3300006358 Archaea 1142
156 Ga0075428_100011372 3300006844 Bacteria 9899
157 Ga0075428_100011770 3300006844 Bacteria 9740
158 Ga0075428_100429266 3300006844 Bacteria 1416
159 Ga0075430_100003725 3300006846 Bacteria 12810
160 Ga0075430_100026920 3300006846 Bacteria 4890
161 Ga0075430_100036267 3300006846 Bacteria 4181
162 Ga0075430_100163239 3300006846 Bacteria 1854
163 Ga0075431_100030894 3300006847 Bacteria 5517
164 Ga0075431_100044305 3300006847 Bacteria 4589
165 Ga0075431_100492529 3300006847 Bacteria 1218
166 Ga0075433_10001763 3300006852 Bacteria 16187
167 Ga0075433_10516578 3300006852 Bacteria 1051
168 Ga0075434_100000033 3300006871 Bacteria 63711
169 Ga0075434_100000318 3300006871 Bacteria 34363
170 Ga0075434_100001207 3300006871 Bacteria 21477
171 Ga0075434_100124510 3300006871 Bacteria 2595
172 Ga0075429_100000191 3300006880 Bacteria 40312
173 Ga0075429_100004031 3300006880 Bacteria 12579
174 Ga0075429_100004103 3300006880 Bacteria 12459
175 Ga0075429_100054026 3300006880 Bacteria 3495
176 Ga0068865_100005516 3300006881 Bacteria 7677
177 Ga0068865_100007719 3300006881 Bacteria 6631
178 Ga0075436_100001263 3300006914 Bacteria 17167
179 Ga0075436_100001365 3300006914 Bacteria 16615
180 Ga0075436_100018853 3300006914 Bacteria 4724
181 Ga0075436_100065802 3300006914 Bacteria 2505
182 Ga0075436_100166024 3300006914 Bacteria 1558
183 Ga0097620_100326361 3300006931 Unclassified 1629
184 Ga0075435_100000095 3300007076 Bacteria 47869
185 Ga0075435_100086020 3300007076 Bacteria 2588
186 Ga0075435_100100107 3300007076 Bacteria 2401
187 Ga0075435_100141893 3300007076 Bacteria 2016
188 Ga0075435_100377384 3300007076 Bacteria 1218
189 Ga0099794_10005841 3300007265 Bacteria 4963
190 Ga0099794_10032073 3300007265 Bacteria 2464
191 Ga0099794_10040210 3300007265 Bacteria 2222
192 Ga0099795_10008852 3300007788 Bacteria 2895
193 Ga0111539_10027400 3300009094 Bacteria 6960
194 Ga0111539_10030515 3300009094 Bacteria 6551
195 Ga0111539_10031451 3300009094 Bacteria 6446
196 Ga0111539_10056838 3300009094 Bacteria 4649
197 Ga0111539_10074451 3300009094 Bacteria 4001
198 Ga0111539_10370177 3300009094 Unclassified 1668
199 Ga0111539_10528040 3300009094 Bacteria 1375
200 Ga0105245_10000900 3300009098 Bacteria 27069
201 Ga0114129_10027395 3300009147 Bacteria 8068
202 Ga0114129_10155472 3300009147 Bacteria 3128
203 Ga0114129_10225554 3300009147 Bacteria 2526
204 Ga0114129_10258851 3300009147 Bacteria 2333
205 Ga0114129_10320129 3300009147 Bacteria 2062
206 Ga0114129_10415902 3300009147 Bacteria 1769
207 Ga0114129_10495655 3300009147 Bacteria 1596
208 Ga0114129_10557743 3300009147 Bacteria 1489
209 Ga0105243_10002495 3300009148 Bacteria 15365
210 Ga0105243_10012365 3300009148 Bacteria 6452
211 Ga0105241_10013546 3300009174 Bacteria 5976
212 Ga0105242_10000570 3300009176 Bacteria 29133
213 Ga0105248_10029884 3300009177 Bacteria 6081
214 Ga0105248_10046301 3300009177 Bacteria 4874
215 Ga0105248_10292651 3300009177 Bacteria 1834
216 Ga0105248_10590393 3300009177 Bacteria 1253
217 Ga0105237_10021363 3300009545 Bacteria 6655
218 Ga0105238_10001829 3300009551 Bacteria 21323
219 Ga0105249_10004906 3300009553 Bacteria 11546
220 Ga0105249_10011144 3300009553 Bacteria 7899
221 Ga0105239_10710452 3300010375 Bacteria 1149
222 Ga0105246_10107443 3300011119 Bacteria 2044
223 Ga0157374_10013274 3300013296 Bacteria 7187
224 Ga0157378_10013586 3300013297 Bacteria 7122
225 Ga0163162_10074780 3300013306 Bacteria 3447
226 Ga0157372_10200194 3300013307 Bacteria 2313
227 Ga0157375_10014357 3300013308 Bacteria 7062
228 Ga0157375_10224640 3300013308 Bacteria 2037
229 Ga0157380_10072009 3300014326 Bacteria 2798
230 Ga0157380_10119946 3300014326 Bacteria 2226
231 Ga0157376_10025461 3300014969 Bacteria 4660
232 Ga0157376_10049805 3300014969 Bacteria 3471
233 Ga0209758_1000351 3300025297 Bacteria 83626
234 Ga0209758_1001016 3300025297 Bacteria 37152
235 Ga0209758_1049604 3300025297 Bacteria 1480
236 Ga0207697_10102463 3300025315 Bacteria 1221
237 Ga0207656_10004859 3300025321 Bacteria 4716
238 Ga0207653_10030736 3300025885 Bacteria 1733
239 Ga0207682_10041450 3300025893 Bacteria 1879
240 Ga0207682_10075587 3300025893 Bacteria 1434
241 Ga0207642_10028763 3300025899 Bacteria 2293
242 Ga0207642_10095869 3300025899 Bacteria 1477
243 Ga0207710_10051865 3300025900 Unclassified 1843
244 Ga0207680_10012474 3300025903 Bacteria 4328
245 Ga0207647_10060267 3300025904 Bacteria 2320
246 Ga0207645_10039261 3300025907 Bacteria 3034
247 Ga0207643_10002306 3300025908 Bacteria 10379
248 Ga0207643_10007262 3300025908 Bacteria 5945
249 Ga0207654_10050354 3300025911 Bacteria 2393
250 Ga0207707_10023586 3300025912 Bacteria 5382
251 Ga0207707_10132004 3300025912 Bacteria 2184
252 Ga0207693_10184674 3300025915 Bacteria 1641
253 Ga0207660_10003686 3300025917 Bacteria 9985
254 Ga0207662_10000255 3300025918 Bacteria 24688
255 Ga0207649_10011853 3300025920 Bacteria 4822
256 Ga0207652_10063374 3300025921 Bacteria 3197
257 Ga0207650_10008372 3300025925 Bacteria 7060
258 Ga0207659_10005784 3300025926 Bacteria 7533
259 Ga0207659_10008600 3300025926 Bacteria 6349
260 Ga0207659_10017688 3300025926 Bacteria 4659
261 Ga0207687_10008703 3300025927 Bacteria 6630
262 Ga0207687_10060966 3300025927 Bacteria 2663
263 Ga0207700_10122738 3300025928 Bacteria 2109
264 Ga0207700_10194097 3300025928 Bacteria 1708
265 Ga0207644_10022367 3300025931 Bacteria 4319
266 Ga0207644_10206479 3300025931 Unclassified 1551
267 Ga0207706_10012014 3300025933 Bacteria 7889
268 Ga0207706_10090481 3300025933 Bacteria 2691
269 Ga0207686_10013086 3300025934 Bacteria 4582
270 Ga0207709_10012837 3300025935 Bacteria 4619
271 Ga0207709_10201511 3300025935 Bacteria 1422
272 Ga0207709_10214755 3300025935 Unclassified 1383
273 Ga0207670_10009101 3300025936 Bacteria 5643
274 Ga0207670_10064336 3300025936 Bacteria 2513
275 Ga0207669_10004046 3300025937 Bacteria 6417
276 Ga0207669_10131893 3300025937 Unclassified 1718
277 Ga0207704_10001889 3300025938 Bacteria 9375
278 Ga0207704_10006023 3300025938 Bacteria 5622
279 Ga0207665_10187817 3300025939 Bacteria 1500
280 Ga0207691_10000553 3300025940 Bacteria 37406
281 Ga0207711_10042867 3300025941 Bacteria 3857
282 Ga0207711_10044549 3300025941 Bacteria 3788
283 Ga0207711_10090988 3300025941 Bacteria 2683
284 Ga0207689_10007381 3300025942 Bacteria 9639
285 Ga0207689_10011317 3300025942 Bacteria 7654
286 Ga0207661_10003659 3300025944 Bacteria 10710
287 Ga0207661_10263640 3300025944 Bacteria 1536
288 Ga0207679_10008461 3300025945 Bacteria 6552
289 Ga0207667_10046208 3300025949 Bacteria 4610
290 Ga0207651_10193691 3300025960 Unclassified 1623
291 Ga0207651_10316624 3300025960 Bacteria 1303
292 Ga0207712_10050627 3300025961 Bacteria 2901
293 Ga0207712_10125394 3300025961 Bacteria 1949
294 Ga0207712_10166362 3300025961 Bacteria 1719
295 Ga0207712_10200625 3300025961 Unclassified 1582
296 Ga0207668_10189061 3300025972 Bacteria 1630
297 Ga0207640_10009859 3300025981 Bacteria 5361
298 Ga0207640_10028180 3300025981 Bacteria 3431
299 Ga0207658_10070530 3300025986 Bacteria 2644
300 Ga0207677_10003501 3300026023 Bacteria 8321
301 Ga0207677_10074232 3300026023 Bacteria 2412
302 Ga0207677_10171145 3300026023 Unclassified 1698
303 Ga0207703_10026263 3300026035 Bacteria 4582
304 Ga0207703_10315216 3300026035 Bacteria 1431
305 Ga0207639_10230104 3300026041 Bacteria 1606
306 Ga0207678_10050216 3300026067 Bacteria 3604
307 Ga0207708_10008564 3300026075 Bacteria 7568
308 Ga0207708_10104799 3300026075 Unclassified 2191
309 Ga0207702_10288799 3300026078 Unclassified 1553
310 Ga0207641_10200765 3300026088 Bacteria 1838
311 Ga0207648_10000276 3300026089 Bacteria 55713
312 Ga0207648_10042769 3300026089 Bacteria 3978
313 Ga0207676_10003972 3300026095 Bacteria 10433
314 Ga0207676_10049583 3300026095 Bacteria 3267
315 Ga0207674_10301308 3300026116 Unclassified 1552
316 Ga0207674_10426547 3300026116 Bacteria 1281
317 Ga0207675_100006484 3300026118 Bacteria 11072
318 Ga0207675_100007574 3300026118 Bacteria 10257
319 Ga0207675_100008557 3300026118 Bacteria 9626
320 Ga0207675_100467109 3300026118 Bacteria 1252
321 Ga0207683_10009572 3300026121 Bacteria 8263
322 Ga0207698_10006445 3300026142 Bacteria 7328
323 Ga0207698_10091400 3300026142 Bacteria 2491
324 Ga0207698_10513135 3300026142 Bacteria 1168
325 Ga0207428_10000726 3300027907 Bacteria 38071
326 Ga0207428_10059832 3300027907 Bacteria 3019
327 Ga0207428_10103966 3300027907 Bacteria 2192
328 Ga0268266_10097245 3300028379 Bacteria 2589
329 Ga0268264_10017841 3300028381 Bacteria 5810
330 Ga0268264_10247930 3300028381 Bacteria 1653
331 Ga0307511_10000019 3300030521 Bacteria 117947
332 Ga0307511_10010947 3300030521 Bacteria 8962
333 Ga0265332_10000812 3300031238 Bacteria 18981
334 Ga0265325_10078596 3300031241 Bacteria 1643
335 Ga0265340_10002068 3300031247 Bacteria 11503
336 Ga0265339_10000669 3300031249 Bacteria 26471
337 Ga0265339_10094900 3300031249 Bacteria 1559
338 Ga0265331_10006261 3300031250 Bacteria 7055
339 Ga0265327_10006312 3300031251 Bacteria 9532
340 Ga0265314_10031514 3300031711 Bacteria 3912
341 Ga0265342_10000856 3300031712 Bacteria 30377
342 Ga0307405_10260539 3300031731 Bacteria 1295
343 Ga0307406_10084017 3300031901 Bacteria 2125
344 Ga0307412_10126580 3300031911 Bacteria 1849
345 Ga0307414_10066108 3300032004 Bacteria 2583
346 Ga0307411_10217152 3300032005 Bacteria 1481
347 Ga0373938_0021153 3300034957 Bacteria 1317
348 Ga0373926_0002688 3300035083 Bacteria 5664
349 Ga0373929_0015766 3300035085 Bacteria 1473
350 Ga0373929_0022292 3300035085 Bacteria 1292
351 Ga0373934_0015905 3300035086 Bacteria 2858
352 Ga0373940_0046871 3300035088 Bacteria 1204
353 Ga0373949_0033982 3300035090 Bacteria 1227
354 Ga0373952_0021674 3300035092 Bacteria 1358
355 Ga0373936_0025285 3300035113 Bacteria 2322
356 Ga0373939_0002731 3300035114 Bacteria 4141
357 Ga0373939_0084887 3300035114 Bacteria 1059
358 Ga0373941_0005939 3300035115 Bacteria 2910
359 Ga0373941_0012975 3300035115 Bacteria 2192
360 Ga0373945_0003146 3300035116 Bacteria 5181
361 Ga0373945_0004289 3300035116 Bacteria 4526
362 Ga0373956_0090421 3300035119 Unclassified 1412
363 Ga0373957_0008394 3300035120 Unclassified 3343
364 Ga0373960_0014342 3300035121 Bacteria 2006
365 Ga0373943_0004208 3300035170 Bacteria 6525
366 Ga0373943_0048192 3300035170 Bacteria 2086
367 Ga0373943_0216507 3300035170 Bacteria 1065
368 Ga0373946_0019871 3300035171 Bacteria 2591
369 Ga0373955_0007789 3300035172 Unclassified 4937
370 Ga0373961_0009342 3300035241 Bacteria 2399
371 Ga0373924_0032332 3300035410 Unclassified 2108
372 Ga0373931_0038696 3300035691 Bacteria 2496
373 Ga0373931_0040452 3300035691 Bacteria 2446
374 Ga0373935_0070899 3300035692 Bacteria 2247
375 Ga0373935_0080434 3300035692 Bacteria 2117
376 Ga0373935_0189732 3300035692 Bacteria 1415
377 Ga0373927_0030096 3300035695 Bacteria 3542
378 Ga0373927_0034306 3300035695 Bacteria 3301
379 Ga0373927_0241926 3300035695 Bacteria 1186
380 Ga0373933_0010844 3300035724 Bacteria 5001
381 Ga0373947_0009079 3300035725 Bacteria 5714
382 Ga0373947_0009232 3300035725 Bacteria 5667
383 Ga0373947_0010041 3300035725 Bacteria 5434
384 Ga0373947_0097147 3300035725 Bacteria 1846
385 Ga0373947_0143622 3300035725 Bacteria 1533
386 Ga0373937_0008865 3300036401 Bacteria 8731
387 Ga0373925_0006672 3300037068 Bacteria 8467
388 Ga0373925_0013212 3300037068 Bacteria 5976
389 Ga0373925_0028674 3300037068 Bacteria 4079
390 Ga0373925_0159263 3300037068 Bacteria 1777
391 Ga0373925_0196284 3300037068 Bacteria 1603
392 Ga0395899_0059379 3300037312 Bacteria 2819
393 Ga0395900_0001544 3300037418 Bacteria 27359
394 Ga0395900_0355947 3300037418 Bacteria 1436
395 Ga0395898_0108630 3300037466 Bacteria 2660
396 Ga0395898_0153895 3300037466 Unclassified 2200
397 Ga0395905_0084323 3300037471 Bacteria 2977
398 Ga0395901_0062199 3300038443 Bacteria 3885
399 Ga0395901_0131752 3300038443 Unclassified 2627
400 Ga0436365_1202296 3300039437 Bacteria 2890
401 Ga0436365_1429691 3300039437 Bacteria 1644
402 Ga0439441_002703 3300042001 Bacteria 2525
403 Ga0450913_000161 3300042117 Bacteria 2162
404 Ga0439434_0069165 3300042435 Bacteria 1110
405 Ga0439435_0029780 3300042436 Bacteria 1476
406 Ga0450916_004176 3300042530 Bacteria 1619
407 Ga0466965_0027491 3300044683 Bacteria 2762
408 Ga0466957_0025397 3300044842 Bacteria 3511
409 Ga0451576_0001715 3300045051 Bacteria 36181
410 Ga0451576_0175914 3300045051 Bacteria 2234
411 Ga0466967_0085674 3300045976 Bacteria 2853
412 Ga0495592_0006561 3300046454 Bacteria 8670
413 Ga0495603_0002544 3300046455 Bacteria 10740
414 Ga0495603_0081454 3300046455 Bacteria 1896
415 Ga0495629_0168046 3300046459 Bacteria 1523
416 Ga0495651_0151781 3300046462 Bacteria 1669
417 Ga0495651_0211473 3300046462 Unclassified 1349
418 Ga0495580_0002354 3300046472 Bacteria 16499
419 Ga0495582_0005948 3300046473 Bacteria 6804
420 Ga0495605_0027976 3300046474 Bacteria 2915
421 Ga0495639_0010766 3300046475 Bacteria 3937
422 Ga0495639_0019927 3300046475 Bacteria 2929
423 Ga0495662_0012546 3300046476 Bacteria 4134
424 Ga0495662_0027363 3300046476 Bacteria 2755
425 Ga0495662_0146171 3300046476 Bacteria 1164
426 Ga0495584_0111959 3300046491 Bacteria 1381
427 Ga0495594_0011426 3300046499 Bacteria 4615
428 Ga0495608_0006443 3300046511 Bacteria 8335
429 Ga0495608_0012778 3300046511 Bacteria 5826
430 Ga0495616_0046790 3300046513 Bacteria 2182
431 Ga0495618_0006638 3300046514 Bacteria 7011
432 Ga0495628_0117528 3300046516 Bacteria 2042
433 Ga0495630_0001728 3300046517 Bacteria 15247
434 Ga0495630_0038696 3300046517 Bacteria 3568
435 Ga0495637_0061251 3300046520 Bacteria 1543
436 Ga0495644_0117334 3300046523 Bacteria 1011
437 Ga0495666_0020549 3300046526 Bacteria 3270
438 Ga0495666_0026411 3300046526 Bacteria 2862
439 Ga0495666_0054783 3300046526 Bacteria 1912
440 Ga0495665_0043776 3300046531 Bacteria 2380
441 Ga0495665_0131528 3300046531 Bacteria 1310
442 Ga0495640_0005587 3300046533 Bacteria 9999
443 Ga0495640_0012886 3300046533 Bacteria 6377
444 Ga0495586_0002567 3300046535 Bacteria 9824
445 Ga0495586_0011166 3300046535 Bacteria 4774
446 Ga0495586_0028388 3300046535 Bacteria 2994
447 Ga0495587_0056143 3300046536 Bacteria 2317
448 Ga0495621_0046506 3300046539 Bacteria 1540
449 Ga0495645_0152758 3300046543 Bacteria 1602
450 Ga0495667_0056892 3300046559 Unclassified 2571
451 Ga0495656_0122916 3300046615 Bacteria 1227
452 Ga0495668_0087449 3300046616 Bacteria 1709
453 Ga0495635_0254181 3300046663 Bacteria 1184
454 Ga0495659_0074229 3300046664 Bacteria 1279
455 Ga0495588_0006249 3300046674 Bacteria 5354
456 Ga0495588_0007187 3300046674 Bacteria 5053
457 Ga0495657_0005797 3300046675 Bacteria 9729
458 Ga0495599_0033235 3300046678 Bacteria 3240
459 Ga0495623_0076879 3300046679 Unclassified 2071
460 Ga0495647_0000058 3300046681 Bacteria 27582
461 Ga0495647_0017269 3300046681 Bacteria 2551
462 Ga0495658_0012479 3300046683 Bacteria 4306
463 Ga0495658_0019833 3300046683 Bacteria 3515
464 Ga0495658_0045853 3300046683 Bacteria 2455
465 Ga0495658_0172039 3300046683 Bacteria 1341
466 Ga0495669_0069244 3300046684 Bacteria 1606
467 Ga0495613_0037577 3300046689 Bacteria 3589
468 Ga0495624_0017642 3300046690 Bacteria 4786
469 Ga0495624_0021757 3300046690 Bacteria 4249
470 Ga0495624_0119936 3300046690 Bacteria 1615
471 Ga0495624_0155810 3300046690 Bacteria 1396
472 Ga0495670_0072521 3300046691 Bacteria 1744
473 Ga0495600_0034149 3300046809 Unclassified 3302
474 Ga0495604_0018716 3300047317 Bacteria 5547
475 Ga0495604_0136344 3300047317 Unclassified 1758
476 Ga0495674_0069160 3300047319 Bacteria 3054
477 Ga0495676_0005390 3300047321 Bacteria 11725
478 Ga0495676_0075192 3300047321 Bacteria 2584
479 Ga0495680_0004705 3300047322 Bacteria 12987
480 Ga0495680_0094765 3300047322 Unclassified 2233
481 Ga0495675_0051153 3300047444 Plasmid 2625
482 Ga0495684_0236197 3300047471 Bacteria 1335
483 Ga0495602_0243566 3300048088 Bacteria 1344
484 Ga0496100_0057950 3300048903 Bacteria 2540
485 Ga0496100_0080966 3300048903 Bacteria 2193
486 Ga0496100_0088744 3300048903 Bacteria 2105
487 Ga0496101_0100903 3300048904 Bacteria 2160
488 Ga0496101_0196323 3300048904 Bacteria 1559
489 Ga0496104_0000775 3300048907 Bacteria 27328
490 Ga0496104_0001327 3300048907 Bacteria 21357
491 Ga0496104_0001388 3300048907 Bacteria 20943
492 Ga0496105_0006927 3300048908 Bacteria 8730
493 Ga0496105_0050843 3300048908 Bacteria 3424
494 Ga0496106_0020742 3300048909 Bacteria 4877
495 Ga0496106_0066402 3300048909 Unclassified 2747
496 Ga0496107_0076871 3300048910 Bacteria 2432
497 Ga0496108_0020494 3300048911 Bacteria 5436
498 Ga0496109_0025531 3300048912 Bacteria 5266
499 Ga0496109_0129696 3300048912 Bacteria 2352
500 Ga0496109_0277292 3300048912 Bacteria 1580
501 Ga0496109_0470447 3300048912 Bacteria 1187
502 Ga0496110_0008245 3300048913 Bacteria 8376
503 Ga0496110_0050957 3300048913 Bacteria 3637
504 Ga0496110_0197369 3300048913 Bacteria 1828
505 Ga0496111_0017425 3300048914 Bacteria 4967
506 Ga0496111_0194545 3300048914 Unclassified 1507
507 Ga0496113_0065521 3300048916 Bacteria 2750
508 Ga0496114_0021652 3300048917 Bacteria 5232
509 Ga0496115_0013314 3300048918 Bacteria 6221
510 Ga0496115_0059102 3300048918 Bacteria 3087
511 Ga0496115_0096465 3300048918 Bacteria 2421
512 Ga0501032_0010690 3300049569 Bacteria 6606
513 Ga0501034_0121088 3300049571 Bacteria 2603
514 Ga0501036_0197957 3300049572 Bacteria 1690
515 Ga0501037_0009409 3300049573 Bacteria 7172
516 Ga0501038_0010065 3300049574 Bacteria 8658
517 Ga0501040_0003088 3300049576 Bacteria 10800
518 Ga0501041_0005947 3300049577 Bacteria 7137
519 Ga0501041_0064912 3300049577 Bacteria 2236
520 Ga0501042_0016022 3300049578 Bacteria 5142
521 Ga0501042_0526524 3300049578 Bacteria 859
522 Ga0501043_0000386 3300049579 Bacteria 39806
523 Ga0501043_0077251 3300049579 Bacteria 2616
524 Ga0501046_0000491 3300049580 Bacteria 39431
525 Ga0501046_0001179 3300049580 Bacteria 25420
526 Ga0501047_0000021 3300049581 Bacteria 254841
527 Ga0501048_0009095 3300049582 Bacteria 7477
528 Ga0501068_0005838 3300049584 Bacteria 6754
529 Ga0501070_0019933 3300049586 Bacteria 5623
530 Ga0501072_0029111 3300049588 Bacteria 4312
531 Ga0501073_0004780 3300049589 Bacteria 10164
532 Ga0501075_0129546 3300049591 Bacteria 1922
533 Ga0501080_0164832 3300049742 Bacteria 2045
534 Ga0501083_0148170 3300049744 Bacteria 1537
535 Ga0501035_0283568 3300049822 Bacteria 1399
536 Ga0501044_0000411 3300049823 Bacteria 52862
537 Ga0501045_0004535 3300049824 Bacteria 9594
538 nmdc:mga03683_9684_c1 3300050489 Bacteria 3437
539 nmdc:mga00v17_142261_c1 3300050491 Bacteria 1539
540 nmdc:mga0yw44_55814_c1 3300050492 Bacteria 2404
541 nmdc:mga0yw44_8602_c1 3300050492 Bacteria 5096
542 nmdc:mga0yw44_91123_c1 3300050492 Bacteria 1927
543 nmdc:mga0k408_145512_c1 3300050493 Bacteria 1411
544 nmdc:mga0k408_17331_c1 3300050493 Bacteria 4012
545 nmdc:mga0k408_20124_c1 3300050493 Bacteria 3735
546 nmdc:mga06z11_42449_c1 3300050494 Bacteria 2282
547 nmdc:mga07m45_8286_c2 3300050496 Bacteria 4987
548 nmdc:mga05p37_248908_c1 3300050507 Bacteria 2132
549 nmdc:mga05p37_331333_c1 3300050507 Bacteria 1798
550 nmdc:mga05p37_351125_c1 3300050507 Bacteria 1736
551 nmdc:mga05p37_351536_c1 3300050507 Bacteria 1735
552 nmdc:mga05p37_40918_c1 3300050507 Bacteria 5691
553 nmdc:mga05p37_587703_c1 3300050507 Bacteria 1260
554 nmdc:mga09592_22871_c1 3300050508 Bacteria 5157
555 nmdc:mga09592_256552_c1 3300050508 Bacteria 1516
556 nmdc:mga09592_272_c1 3300050508 Bacteria 37407
557 nmdc:mga09592_62107_c1 3300050508 Bacteria 3161
558 nmdc:mga0qj67_40253_c1 3300050509 Bacteria 3674
559 nmdc:mga0qj67_56393_c1 3300050509 Bacteria 3114
560 nmdc:mga0qj67_90618_c1 3300050509 Bacteria 2457
561 nmdc:mga06r32_103739_c1 3300050510 Bacteria 2792
562 nmdc:mga06r32_15134_c1 3300050510 Bacteria 7006
563 nmdc:mga06r32_338998_c1 3300050510 Bacteria 1488
564 nmdc:mga08y16_245273_c1 3300050511 Bacteria 1851
565 nmdc:mga08y16_29377_c1 3300050511 Bacteria 5793
566 nmdc:mga08y16_33586_c1 3300050511 Bacteria 5388
567 nmdc:mga08y16_40016_c1 3300050511 Bacteria 4916
568 nmdc:mga08y16_418836_c1 3300050511 Bacteria 1369
569 nmdc:mga0n895_159_c1 3300050512 Bacteria 41448
570 nmdc:mga0n895_189894_c1 3300050512 Bacteria 2085
571 nmdc:mga0n895_436_c1 3300050512 Bacteria 28097
572 nmdc:mga0n895_441517_c1 3300050512 Bacteria 1314
573 nmdc:mga0n895_620694_c1 3300050512 Bacteria 1082
574 nmdc:mga0n895_80639_c1 3300050512 Bacteria 3242
575 nmdc:mga0n895_8305_c1 3300050512 Bacteria 8982
576 nmdc:mga0rr50_10116_c1 3300050513 Bacteria 5969
577 nmdc:mga0rr50_127362_c1 3300050513 Bacteria 2035
578 nmdc:mga0rr50_76070_c1 3300050513 Bacteria 2576
579 nmdc:mga08x19_37558_c1 3300050514 Bacteria 3074
580 nmdc:mga08x19_54324_c1 3300050514 Bacteria 2578
581 nmdc:mga08x19_6451_c1 3300050514 Bacteria 6947
582 nmdc:mga08x19_833_c1 3300050514 Bacteria 19578
583 nmdc:mga0a205_175_c1 3300050515 Bacteria 43324
584 nmdc:mga0a205_316644_c1 3300050515 Bacteria 1431
585 nmdc:mga0a205_540403_c1 3300050515 Bacteria 1021
586 Ga0495601_0011258 3300053077 Bacteria 5345
587 Ga0495601_0133707 3300053077 Bacteria 1616
588 Ga0495612_0082234 3300053078 Bacteria 1354
589 Ga0495595_0005633 3300053084 Bacteria 5066
590 Ga0495619_0107214 3300053085 Bacteria 1906
591 Ga0500646_0003926 3300053090 Bacteria 3781
592 Ga0500583_0028138 3300053092 Bacteria 2434
593 Ga0500590_034114 3300053148 Bacteria 2635
594 Ga0500604_0000597 3300053151 Bacteria 9895
595 Ga0500616_0046553 3300053153 Bacteria 2305
596 Ga0501084_0009132 3300054114 Bacteria 8202
597 Ga0501045_0087567
598 JGI24743J22301_10009334
599 JGI24738J21930_10018815
600 JGI24744J21845_10013371
601 JGI24742J22300_10008724
602 JGI25153J46596_10002964
603 JGI25153J46596_10004430
604 Ga0065712_10076209
605 Ga0070683_100007986
606 Ga0070683_100080356
607 Ga0070690_100002470
608 Ga0070670_100046961
609 Ga0070677_10030825
610 Ga0068869_100063712
611 Ga0068869_100095903
612 Ga0068869_100309620
613 Ga0070666_10021763
614 Ga0070680_100013168
615 Ga0070680_100025401
616 Ga0070682_100122885
617 Ga0068868_100005853
618 Ga0068868_100006058
619 Ga0068868_100008082
620 Ga0070689_100013130
621 Ga0070691_10001532
622 Ga0070691_10133705
623 Ga0070687_100000563
624 Ga0070661_100006718
625 Ga0070661_100052899
626 Ga0070668_100157882
627 Ga0070669_100004794
628 Ga0070675_100000678
629 Ga0070675_100042286
630 Ga0070671_100000403
631 Ga0070671_100182696
632 Ga0070674_100010484
633 Ga0070673_100005786
634 Ga0070659_100243602
635 Ga0070667_100293096
636 Ga0070667_100336110
637 Ga0070703_10051590
638 Ga0070714_100026265
639 Ga0070713_100103250
640 Ga0070713_100485481
641 Ga0070701_10000846
642 Ga0070705_100007263
643 Ga0070705_100011771
644 Ga0070700_100027753
645 Ga0070694_100004374
646 Ga0070694_100036957
647 Ga0070694_100095538
648 Ga0070678_100004377
649 Ga0070662_100048244
650 Ga0070681_10004036
651 Ga0070681_10085487
652 Ga0068867_100001052
653 Ga0068867_100027859
654 Ga0068867_100191118
655 Ga0070685_10137947
656 Ga0070706_100038959
657 Ga0070707_100066222
658 Ga0070698_100084696
659 Ga0070698_100265190
660 Ga0070699_100003640
661 Ga0070699_100019712
662 Ga0070699_100115561
663 Ga0070699_100149460
664 Ga0070679_100040873
665 Ga0070679_100211279
666 Ga0070679_100332290
667 Ga0070684_100009449
668 Ga0070684_100018260
669 Ga0070684_100337857
670 Ga0070697_100040276
671 Ga0070697_100128533
672 Ga0068853_100357414
673 Ga0070672_100004172
674 Ga0070672_100058929
675 Ga0070672_100077266
676 Ga0070686_100004643
677 Ga0070695_100013642
678 Ga0070696_100000286
679 Ga0070696_100005387
680 Ga0070696_100009006
681 Ga0070693_100000272
682 Ga0070693_100024057
683 Ga0070704_100000332
684 Ga0070704_100258769
685 Ga0068855_100056798
686 Ga0068855_100331863
687 Ga0068855_100626910
688 Ga0070664_100000715
689 Ga0068857_100147192
690 Ga0068854_100013961
691 Ga0068854_100017041
692 Ga0068854_100155115
693 Ga0068856_100123154
694 Ga0068856_100172592
695 Ga0070702_100002099
696 Ga0070702_100136354
697 Ga0068852_100012610
698 Ga0068852_100268956
699 Ga0068859_100326350
700 Ga0068864_100000855
701 Ga0068864_100007948
702 Ga0068866_10000268
703 Ga0068866_10043756
704 Ga0068861_100000494
705 Ga0068861_100003214
706 Ga0068861_100078036
707 Ga0068851_10006680
708 Ga0068870_10013548
709 Ga0068870_10048226
710 Ga0068863_100021690
711 Ga0068863_100171565
712 Ga0068858_100094887
713 Ga0068858_100163526
714 Ga0068860_100001071
715 Ga0068862_100005771
716 Ga0068862_100146254
717 Ga0081455_10003936
718 Ga0081455_10014656
719 Ga0081455_10048635
720 Ga0081455_10050038
721 Ga0081455_10180659
722 Ga0081540_1000026
723 Ga0081539_10008045
724 Ga0081539_10033748
725 Ga0070717_10159162
726 Ga0075365_10012874
727 Ga0075365_10038691
728 Ga0075365_10059819
729 Ga0075365_10181074
730 Ga0075368_10004530
731 Ga0075368_10050465
732 Ga0075363_100000486
733 Ga0075363_100045905
734 Ga0075364_10058077
735 Ga0075364_10086138
736 Ga0070716_100027556
737 Ga0070716_100271943
738 Ga0070712_100018198
739 Ga0075367_10075989
740 Ga0075367_10120661
741 Ga0075369_10013341
742 Ga0075369_10025096
743 Ga0075369_10065295
744 Ga0075366_10053412
745 Ga0097621_100002822
746 Ga0097621_100003412
747 Ga0097621_100050446
748 Ga0075370_10021086
749 Ga0068871_100002838
750 Ga0068871_100003826
751 Ga0068871_100460242
752 Ga0075428_100011372
753 Ga0075428_100011770
754 Ga0075428_100429266
755 Ga0075430_100003725
756 Ga0075430_100026920
757 Ga0075430_100036267
758 Ga0075430_100163239
759 Ga0075431_100030894
760 Ga0075431_100044305
761 Ga0075431_100492529
762 Ga0075433_10001763
763 Ga0075433_10516578
764 Ga0075434_100000033
765 Ga0075434_100000318
766 Ga0075434_100001207
767 Ga0075434_100124510
768 Ga0075429_100000191
769 Ga0075429_100004031
770 Ga0075429_100004103
771 Ga0075429_100054026
772 Ga0068865_100005516
773 Ga0068865_100007719
774 Ga0075436_100001263
775 Ga0075436_100001365
776 Ga0075436_100018853
777 Ga0075436_100065802
778 Ga0075436_100166024
779 Ga0097620_100326361
780 Ga0075435_100000095
781 Ga0075435_100086020
782 Ga0075435_100100107
783 Ga0075435_100141893
784 Ga0075435_100377384
785 Ga0099794_10005841
786 Ga0099794_10032073
787 Ga0099794_10040210
788 Ga0099795_10008852
789 Ga0111539_10027400
790 Ga0111539_10030515
791 Ga0111539_10031451
792 Ga0111539_10056838
793 Ga0111539_10074451
794 Ga0111539_10370177
795 Ga0111539_10528040
796 Ga0105245_10000900
797 Ga0114129_10027395
798 Ga0114129_10155472
799 Ga0114129_10225554
800 Ga0114129_10258851
801 Ga0114129_10320129
802 Ga0114129_10415902
803 Ga0114129_10495655
804 Ga0114129_10557743
805 Ga0105243_10002495
806 Ga0105243_10012365
807 Ga0105241_10013546
808 Ga0105242_10000570
809 Ga0105248_10029884
810 Ga0105248_10046301
811 Ga0105248_10292651
812 Ga0105248_10590393
813 Ga0105237_10021363
814 Ga0105238_10001829
815 Ga0105249_10004906
816 Ga0105249_10011144
817 Ga0105239_10710452
818 Ga0105246_10107443
819 Ga0157374_10013274
820 Ga0157378_10013586
821 Ga0163162_10074780
822 Ga0157372_10200194
823 Ga0157375_10014357
824 Ga0157375_10224640
825 Ga0157380_10072009
826 Ga0157380_10119946
827 Ga0157376_10025461
828 Ga0157376_10049805
829 Ga0209758_1000351
830 Ga0209758_1001016
831 Ga0209758_1049604
832 Ga0207697_10102463
833 Ga0207656_10004859
834 Ga0207653_10030736
835 Ga0207682_10041450
836 Ga0207682_10075587
837 Ga0207642_10028763
838 Ga0207642_10095869
839 Ga0207710_10051865
840 Ga0207680_10012474
841 Ga0207647_10060267
842 Ga0207645_10039261
843 Ga0207643_10002306
844 Ga0207643_10007262
845 Ga0207654_10050354
846 Ga0207707_10023586
847 Ga0207707_10132004
848 Ga0207693_10184674
849 Ga0207660_10003686
850 Ga0207662_10000255
851 Ga0207649_10011853
852 Ga0207652_10063374
853 Ga0207650_10008372
854 Ga0207659_10005784
855 Ga0207659_10008600
856 Ga0207659_10017688
857 Ga0207687_10008703
858 Ga0207687_10060966
859 Ga0207700_10122738
860 Ga0207700_10194097
861 Ga0207644_10022367
862 Ga0207644_10206479
863 Ga0207706_10012014
864 Ga0207706_10090481
865 Ga0207686_10013086
866 Ga0207709_10012837
867 Ga0207709_10201511
868 Ga0207709_10214755
869 Ga0207670_10009101
870 Ga0207670_10064336
871 Ga0207669_10004046
872 Ga0207669_10131893
873 Ga0207704_10001889
874 Ga0207704_10006023
875 Ga0207665_10187817
876 Ga0207691_10000553
877 Ga0207711_10042867
878 Ga0207711_10044549
879 Ga0207711_10090988
880 Ga0207689_10007381
881 Ga0207689_10011317
882 Ga0207661_10003659
883 Ga0207661_10263640
884 Ga0207679_10008461
885 Ga0207667_10046208
886 Ga0207651_10193691
887 Ga0207651_10316624
888 Ga0207712_10050627
889 Ga0207712_10125394
890 Ga0207712_10166362
891 Ga0207712_10200625
892 Ga0207668_10189061
893 Ga0207640_10009859
894 Ga0207640_10028180
895 Ga0207658_10070530
896 Ga0207677_10003501
897 Ga0207677_10074232
898 Ga0207677_10171145
899 Ga0207703_10026263
900 Ga0207703_10315216
901 Ga0207639_10230104
902 Ga0207678_10050216
903 Ga0207708_10008564
904 Ga0207708_10104799
905 Ga0207702_10288799
906 Ga0207641_10200765
907 Ga0207648_10000276
908 Ga0207648_10042769
909 Ga0207676_10003972
910 Ga0207676_10049583
911 Ga0207674_10301308
912 Ga0207674_10426547
913 Ga0207675_100006484
914 Ga0207675_100007574
915 Ga0207675_100008557
916 Ga0207675_100467109
917 Ga0207683_10009572
918 Ga0207698_10006445
919 Ga0207698_10091400
920 Ga0207698_10513135
921 Ga0207428_10000726
922 Ga0207428_10059832
923 Ga0207428_10103966
924 Ga0268266_10097245
925 Ga0268264_10017841
926 Ga0268264_10247930
927 Ga0307511_10000019
928 Ga0307511_10010947
929 Ga0265332_10000812
930 Ga0265325_10078596
931 Ga0265340_10002068
932 Ga0265339_10000669
933 Ga0265339_10094900
934 Ga0265331_10006261
935 Ga0265327_10006312
936 Ga0265314_10031514
937 Ga0265342_10000856
938 Ga0307405_10260539
939 Ga0307406_10084017
940 Ga0307412_10126580
941 Ga0307414_10066108
942 Ga0307411_10217152
943 Ga0373938_0021153
944 Ga0373926_0002688
945 Ga0373929_0015766
946 Ga0373929_0022292
947 Ga0373934_0015905
948 Ga0373940_0046871
949 Ga0373949_0033982
950 Ga0373952_0021674
951 Ga0373936_0025285
952 Ga0373939_0002731
953 Ga0373939_0084887
954 Ga0373941_0005939
955 Ga0373941_0012975
956 Ga0373945_0003146
957 Ga0373945_0004289
958 Ga0373956_0090421
959 Ga0373957_0008394
960 Ga0373960_0014342
961 Ga0373943_0004208
962 Ga0373943_0048192
963 Ga0373943_0216507
964 Ga0373946_0019871
965 Ga0373955_0007789
966 Ga0373961_0009342
967 Ga0373924_0032332
968 Ga0373931_0038696
969 Ga0373931_0040452
970 Ga0373935_0070899
971 Ga0373935_0080434
972 Ga0373935_0189732
973 Ga0373927_0030096
974 Ga0373927_0034306
975 Ga0373927_0241926
976 Ga0373933_0010844
977 Ga0373947_0009079
978 Ga0373947_0009232
979 Ga0373947_0010041
980 Ga0373947_0097147
981 Ga0373947_0143622
982 Ga0373937_0008865
983 Ga0373925_0006672
984 Ga0373925_0013212
985 Ga0373925_0028674
986 Ga0373925_0159263
987 Ga0373925_0196284
988 Ga0395899_0059379
989 Ga0395900_0001544
990 Ga0395900_0355947
991 Ga0395898_0108630
992 Ga0395898_0153895
993 Ga0395905_0084323
994 Ga0395901_0062199
995 Ga0395901_0131752
996 Ga0436365_1202296
997 Ga0436365_1429691
998 Ga0439441_002703
999 Ga0450913_000161
1000 Ga0439434_0069165
1001 Ga0439435_0029780
1002 Ga0450916_004176
1003 Ga0466965_0027491
1004 Ga0466957_0025397
1005 Ga0451576_0001715
1006 Ga0451576_0175914
1007 Ga0466967_0085674
1008 Ga0495592_0006561
1009 Ga0495603_0002544
1010 Ga0495603_0081454
1011 Ga0495629_0168046
1012 Ga0495651_0151781
1013 Ga0495651_0211473
1014 Ga0495580_0002354
1015 Ga0495582_0005948
1016 Ga0495605_0027976
1017 Ga0495639_0010766
1018 Ga0495639_0019927
1019 Ga0495662_0012546
1020 Ga0495662_0027363
1021 Ga0495662_0146171
1022 Ga0495584_0111959
1023 Ga0495594_0011426
1024 Ga0495608_0006443
1025 Ga0495608_0012778
1026 Ga0495616_0046790
1027 Ga0495618_0006638
1028 Ga0495628_0117528
1029 Ga0495630_0001728
1030 Ga0495630_0038696
1031 Ga0495637_0061251
1032 Ga0495644_0117334
1033 Ga0495666_0020549
1034 Ga0495666_0026411
1035 Ga0495666_0054783
1036 Ga0495665_0043776
1037 Ga0495665_0131528
1038 Ga0495640_0005587
1039 Ga0495640_0012886
1040 Ga0495586_0002567
1041 Ga0495586_0011166
1042 Ga0495586_0028388
1043 Ga0495587_0056143
1044 Ga0495621_0046506
1045 Ga0495645_0152758
1046 Ga0495667_0056892
1047 Ga0495656_0122916
1048 Ga0495668_0087449
1049 Ga0495635_0254181
1050 Ga0495659_0074229
1051 Ga0495588_0006249
1052 Ga0495588_0007187
1053 Ga0495657_0005797
1054 Ga0495599_0033235
1055 Ga0495623_0076879
1056 Ga0495647_0000058
1057 Ga0495647_0017269
1058 Ga0495658_0012479
1059 Ga0495658_0019833
1060 Ga0495658_0045853
1061 Ga0495658_0172039
1062 Ga0495669_0069244
1063 Ga0495613_0037577
1064 Ga0495624_0017642
1065 Ga0495624_0021757
1066 Ga0495624_0119936
1067 Ga0495624_0155810
1068 Ga0495670_0072521
1069 Ga0495600_0034149
1070 Ga0495604_0018716
1071 Ga0495604_0136344
1072 Ga0495674_0069160
1073 Ga0495676_0005390
1074 Ga0495676_0075192
1075 Ga0495680_0004705
1076 Ga0495680_0094765
1077 Ga0495675_0051153
1078 Ga0495684_0236197
1079 Ga0495602_0243566
1080 Ga0496100_0057950
1081 Ga0496100_0080966
1082 Ga0496100_0088744
1083 Ga0496101_0100903
1084 Ga0496101_0196323
1085 Ga0496104_0000775
1086 Ga0496104_0001327
1087 Ga0496104_0001388
1088 Ga0496105_0006927
1089 Ga0496105_0050843
1090 Ga0496106_0020742
1091 Ga0496106_0066402
1092 Ga0496107_0076871
1093 Ga0496108_0020494
1094 Ga0496109_0025531
1095 Ga0496109_0129696
1096 Ga0496109_0277292
1097 Ga0496109_0470447
1098 Ga0496110_0008245
1099 Ga0496110_0050957
1100 Ga0496110_0197369
1101 Ga0496111_0017425
1102 Ga0496111_0194545
1103 Ga0496113_0065521
1104 Ga0496114_0021652
1105 Ga0496115_0013314
1106 Ga0496115_0059102
1107 Ga0496115_0096465
1108 Ga0501032_0010690
1109 Ga0501034_0121088
1110 Ga0501036_0197957
1111 Ga0501037_0009409
1112 Ga0501038_0010065
1113 Ga0501040_0003088
1114 Ga0501041_0005947
1115 Ga0501041_0064912
1116 Ga0501042_0016022
1117 Ga0501042_0526524
1118 Ga0501043_0000386
1119 Ga0501043_0077251
1120 Ga0501046_0000491
1121 Ga0501046_0001179
1122 Ga0501047_0000021
1123 Ga0501048_0009095
1124 Ga0501068_0005838
1125 Ga0501070_0019933
1126 Ga0501072_0029111
1127 Ga0501073_0004780
1128 Ga0501075_0129546
1129 Ga0501080_0164832
1130 Ga0501083_0148170
1131 Ga0501035_0283568
1132 Ga0501044_0000411
1133 Ga0501045_0004535
1134 nmdc:mga03683_9684_c1
1135 nmdc:mga00v17_142261_c1
1136 nmdc:mga0yw44_55814_c1
1137 nmdc:mga0yw44_8602_c1
1138 nmdc:mga0yw44_91123_c1
1139 nmdc:mga0k408_145512_c1
1140 nmdc:mga0k408_17331_c1
1141 nmdc:mga0k408_20124_c1
1142 nmdc:mga06z11_42449_c1
1143 nmdc:mga07m45_8286_c2
1144 nmdc:mga05p37_248908_c1
1145 nmdc:mga05p37_331333_c1
1146 nmdc:mga05p37_351125_c1
1147 nmdc:mga05p37_351536_c1
1148 nmdc:mga05p37_40918_c1
1149 nmdc:mga05p37_587703_c1
1150 nmdc:mga09592_22871_c1
1151 nmdc:mga09592_256552_c1
1152 nmdc:mga09592_272_c1
1153 nmdc:mga09592_62107_c1
1154 nmdc:mga0qj67_40253_c1
1155 nmdc:mga0qj67_56393_c1
1156 nmdc:mga0qj67_90618_c1
1157 nmdc:mga06r32_103739_c1
1158 nmdc:mga06r32_15134_c1
1159 nmdc:mga06r32_338998_c1
1160 nmdc:mga08y16_245273_c1
1161 nmdc:mga08y16_29377_c1
1162 nmdc:mga08y16_33586_c1
1163 nmdc:mga08y16_40016_c1
1164 nmdc:mga08y16_418836_c1
1165 nmdc:mga0n895_159_c1
1166 nmdc:mga0n895_189894_c1
1167 nmdc:mga0n895_436_c1
1168 nmdc:mga0n895_441517_c1
1169 nmdc:mga0n895_620694_c1
1170 nmdc:mga0n895_80639_c1
1171 nmdc:mga0n895_8305_c1
1172 nmdc:mga0rr50_10116_c1
1173 nmdc:mga0rr50_127362_c1
1174 nmdc:mga0rr50_76070_c1
1175 nmdc:mga08x19_37558_c1
1176 nmdc:mga08x19_54324_c1
1177 nmdc:mga08x19_6451_c1
1178 nmdc:mga08x19_833_c1
1179 nmdc:mga0a205_175_c1
1180 nmdc:mga0a205_316644_c1
1181 nmdc:mga0a205_540403_c1
1182 Ga0495601_0011258
1183 Ga0495601_0133707
1184 Ga0495612_0082234
1185 Ga0495595_0005633
1186 Ga0495619_0107214
1187 Ga0500646_0003926
1188 Ga0500583_0028138
1189 Ga0500590_034114
1190 Ga0500604_0000597
1191 Ga0500616_0046553
1192 Ga0501084_0009132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

107

379

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9712 14 304
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9709 9 304
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9648 8 306
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9598 9 298
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9585 8 306
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9558 108 226 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.948 108 231 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9479 8 304 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9408 108 231 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9394 109 226 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q1HI92-F1-model_v4 NADH:flavin oxidoreductase 0.9831 9 304 GO:0009056
GO:0010181
GO:0016491
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9827 17 304
AF-A0A4Q7NH98-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9824 9 306
AF-A0A5C8CF86-F1-model_v4 deleted 0.982 19 304
AF-A0A537BUX9-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9788 9 306

Map