F467626

General Info

Members Datasets Scaffolds Average Seq Length
597 372 506 462

Family's Representative Sequence

Representative Sequence 3300003756|Ga0055533_1000460|Ga0055533_10004601
Length 542
Sequence MTDARINLDEFANRRASSDSESDLLVTTVRMWCAFSQFNTNCNVPRAGSHRSEDVHPCASVLRGYDRHGLQLALYVGHPPMSSIHPTIFKAYDIRGIVGKTVDAETARLIGRAFGSAARAKGESAVVIGRDGRLSGPELLAALADGLRASGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDYNGFKMVLAGQAIYGDQIQALRTRIGQGDFTEGAGYYVQVDIRQQYIDRIISDVKLSRPMKIAVDCGNGVAGAFAPELFRAMGCEVTELFCEVDGXFPNHHPDPAHVENLQXLVRTLQTTDCELGLAFDGDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRNPGGEIIFDVKCTGKLAPFIREHGGKATMWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEIVSRLADPSATLNALPNSHCTPELQLKCAEGESFDLLDKIKANATFAGAKEVNRIDGVRVEYEDGFGLARPSNTTPVVVMRFEADNDAAMARIQSEFRRVILAEKPDAQLPF

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
12 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
13 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
14 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
15 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
16 2519103095 Burkholderia sp. KJ006 Isolate Nodule
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
19 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
20 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
21 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
22 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
23 2643221664 Massilia sp. Root418 Isolate Unclassified
24 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
25 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
26 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
27 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
28 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
29 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
30 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
31 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
32 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
33 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
34 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
35 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
36 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
37 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
38 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
39 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
40 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
41 2818991450 Burkholderia sp. 604 Isolate Unclassified
42 2818991452 Burkholderia cepacia 561 Isolate Unclassified
43 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
44 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
45 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
46 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
47 2842711865 Duganella sp. R-73148 Isolate Unclassified
48 2855730933 Achromobacter sp. HZ28 Isolate Nodule
49 2855767633 Achromobacter sp. HZ34 Isolate Nodule
50 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
51 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
52 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
53 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
54 2857553236 Duganella sp. R-74557 Isolate Unclassified
55 2857558681 Duganella sp. R-74565 Isolate Unclassified
56 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
57 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
58 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
59 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
60 2904424332 Duganella sp. 1411 Isolate Rhizosphere
61 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
62 2919476304 Duganella sp. 3397 Isolate Unclassified
63 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
64 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
65 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
66 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
67 2928163908 Burkholderia sp. 567 Isolate Unclassified
68 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
69 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
70 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
71 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
72 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
73 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
74 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
75 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
76 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
77 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
78 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
79 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
80 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
81 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
82 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
83 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
84 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
85 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
86 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
87 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
88 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
89 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
90 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
91 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
94 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
95 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
96 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
97 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
98 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
99 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
100 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
101 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
102 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
103 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
104 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
105 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
106 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
107 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
108 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
109 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
110 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
111 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
112 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
113 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
114 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
115 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
125 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
126 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
127 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
155 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
169 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
219 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
225 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
243 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
301 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
312 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
318 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
336 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
341 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
347 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
356 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 639633007 Azoarcus olearius BH72 Isolate Unclassified
360 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
361 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
362 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
363 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
364 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
365 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
366 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
367 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
368 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
369 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
370 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
371 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
372 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.25
Metatranscriptomes 0.5
Isolates 15.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.39
Nodule 4.02
Rhizoplane 4.02
Rhizosphere 67
Stem 0
Stem Tuber 0
Unclassified 14.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10028436 3300001990 Bacteria 1758
2 JGI24738J21930_10002378 3300002075 Bacteria 4949
3 JGI25156J39149_1000337 3300002705 Bacteria 30825
4 JGI25156J39149_1000568 3300002705 Bacteria 21085
5 JGI25156J39149_1000917 3300002705 Bacteria 14389
6 JGI25154J39366_1000190 3300002738 Bacteria 45605
7 JGI25151J46595_10000841 3300003187 Bacteria 24478
8 JGI25165J46597_1001162 3300003214 Bacteria 16252
9 Ga0055533_1000124 3300003756 Bacteria 87900
10 Ga0055533_1000460 3300003756 Bacteria 15414
11 Ga0055533_1000956 3300003756 Bacteria 8498
12 Ga0055532_1000001 3300003758 Bacteria 1119836
13 Ga0055532_1002673 3300003758 Bacteria 3511
14 Ga0055527_1000014 3300003760 Bacteria 289449
15 Ga0055535_1000001 3300003761 Bacteria 1119836
16 Ga0055542_1000001 3300003762 Bacteria 1119836
17 Ga0055529_1000001 3300003763 Bacteria 826680
18 Ga0055529_1001481 3300003763 Bacteria 6992
19 Ga0055526_1000111 3300003771 Bacteria 71834
20 Ga0055526_1002108 3300003771 Bacteria 13650
21 Ga0055524_1000196 3300003775 Bacteria 66415
22 Ga0055536_1000022 3300003781 Bacteria 198244
23 Ga0055534_1000270 3300003784 Bacteria 35440
24 Ga0055534_1001156 3300003784 Bacteria 11141
25 Ga0055534_1001272 3300003784 Bacteria 10264
26 Ga0065165_1000791 3300005262 Bacteria 42372
27 Ga0070658_10007669 3300005327 Bacteria 8698
28 Ga0070658_10026186 3300005327 Bacteria 4679
29 Ga0070676_10064579 3300005328 Bacteria 2183
30 Ga0070683_100015845 3300005329 Bacteria 6630
31 Ga0070690_100012158 3300005330 Bacteria 5060
32 Ga0070670_100006044 3300005331 Bacteria 10237
33 Ga0070670_100006402 3300005331 Bacteria 9965
34 Ga0070670_100055027 3300005331 Bacteria 3415
35 Ga0068869_100000941 3300005334 Bacteria 16837
36 Ga0068869_100001855 3300005334 Bacteria 12701
37 Ga0070666_10013183 3300005335 Bacteria 5239
38 Ga0068868_100007389 3300005338 Bacteria 7825
39 Ga0070660_100000008 3300005339 Bacteria 155650
40 Ga0070660_100049661 3300005339 Bacteria 3225
41 Ga0070661_100002328 3300005344 Bacteria 13044
42 Ga0070661_100018424 3300005344 Bacteria 4962
43 Ga0070661_100099874 3300005344 Bacteria 2157
44 Ga0070675_100016834 3300005354 Bacteria 5805
45 Ga0070675_100040882 3300005354 Bacteria 3787
46 Ga0070671_100012870 3300005355 Bacteria 6746
47 Ga0070671_100018269 3300005355 Bacteria 5695
48 Ga0070673_100014894 3300005364 Bacteria 5441
49 Ga0070673_100068418 3300005364 Bacteria 2843
50 Ga0070659_100000729 3300005366 Bacteria 23848
51 Ga0070659_100080811 3300005366 Bacteria 2595
52 Ga0070659_100107786 3300005366 Bacteria 2247
53 Ga0070667_100003833 3300005367 Bacteria 12775
54 Ga0070667_100159659 3300005367 Bacteria 1985
55 Ga0070709_10001157 3300005434 Bacteria 14471
56 Ga0070710_10009779 3300005437 Bacteria 4699
57 Ga0070708_100000125 3300005445 Bacteria 52016
58 Ga0070663_100001124 3300005455 Bacteria 14729
59 Ga0070678_100006242 3300005456 Bacteria 6974
60 Ga0070681_10000413 3300005458 Bacteria 34680
61 Ga0068867_100005612 3300005459 Bacteria 8889
62 Ga0068867_100014149 3300005459 Bacteria 5651
63 Ga0068867_100245685 3300005459 Bacteria 1453
64 Ga0070679_100003879 3300005530 Bacteria 13740
65 Ga0070679_100019673 3300005530 Bacteria 6570
66 Ga0070684_100314155 3300005535 Bacteria 1439
67 Ga0070672_100004932 3300005543 Bacteria 8784
68 Ga0070665_100010975 3300005548 Bacteria 9162
69 Ga0070704_100231198 3300005549 Bacteria 1508
70 Ga0068855_100014208 3300005563 Bacteria 9591
71 Ga0068855_100029324 3300005563 Bacteria 6580
72 Ga0068855_100074562 3300005563 Bacteria 3940
73 Ga0070664_100015585 3300005564 Bacteria 6219
74 Ga0070664_100116376 3300005564 Bacteria 2338
75 Ga0068859_100004344 3300005617 Bacteria 14458
76 Ga0068859_100043558 3300005617 Bacteria 4511
77 Ga0068864_100026306 3300005618 Bacteria 4907
78 Ga0068861_100000216 3300005719 Bacteria 30988
79 Ga0068861_100098864 3300005719 Bacteria 2317
80 Ga0068851_10032305 3300005834 Bacteria 2604
81 Ga0068870_10002112 3300005840 Bacteria 8222
82 Ga0068863_100012923 3300005841 Bacteria 8051
83 Ga0068863_100026740 3300005841 Bacteria 5502
84 Ga0068863_100077569 3300005841 Bacteria 3144
85 Ga0068858_100002185 3300005842 Bacteria 19807
86 Ga0068858_100032968 3300005842 Bacteria 4810
87 Ga0068860_100004954 3300005843 Bacteria 13573
88 Ga0068862_100002123 3300005844 Bacteria 17861
89 Ga0075366_10084727 3300006195 Bacteria 1895
90 Ga0097621_100008935 3300006237 Bacteria 7244
91 Ga0097621_100090246 3300006237 Bacteria 2564
92 Ga0097620_100004344 3300006931 Bacteria 14458
93 Ga0097620_100043559 3300006931 Bacteria 4511
94 Ga0099826_10000016 3300006948 Bacteria 210934
95 Ga0105251_10000405 3300009011 Bacteria 42135
96 Ga0105251_10001416 3300009011 Bacteria 20666
97 Ga0105240_10018939 3300009093 Bacteria 9218
98 Ga0105240_10035383 3300009093 Bacteria 6436
99 Ga0105240_10206112 3300009093 Bacteria 2301
100 Ga0111539_10036219 3300009094 Bacteria 5967
101 Ga0105237_10064744 3300009545 Bacteria 3651
102 Ga0105238_10029632 3300009551 Bacteria 5574
103 Ga0105249_10198787 3300009553 Bacteria 1961
104 Ga0105239_10006669 3300010375 Bacteria 13342
105 Ga0105239_10233932 3300010375 Bacteria 2062
106 Ga0157373_10013708 3300013100 Bacteria 5942
107 Ga0157373_10033545 3300013100 Bacteria 3693
108 Ga0157370_10002443 3300013104 Bacteria 22408
109 Ga0157370_10005421 3300013104 Bacteria 14310
110 Ga0157370_10005978 3300013104 Bacteria 13542
111 Ga0157370_10008752 3300013104 Bacteria 10884
112 Ga0157370_10162085 3300013104 Bacteria 2080
113 Ga0157369_10000138 3300013105 Bacteria 102776
114 Ga0157369_10014085 3300013105 Bacteria 9037
115 Ga0157369_10114611 3300013105 Bacteria 2862
116 Ga0157374_10000102 3300013296 Bacteria 78555
117 Ga0157374_10054480 3300013296 Bacteria 3731
118 Ga0157374_10108496 3300013296 Bacteria 2668
119 Ga0157378_10076823 3300013297 Bacteria 3010
120 Ga0157378_10187934 3300013297 Bacteria 1947
121 Ga0163162_10051114 3300013306 Bacteria 4146
122 Ga0157372_10000110 3300013307 Bacteria 86374
123 Ga0157372_10129853 3300013307 Bacteria 2898
124 Ga0157372_10150389 3300013307 Bacteria 2687
125 Ga0157375_10034775 3300013308 Bacteria 4803
126 Ga0163163_10006597 3300014325 Bacteria 10166
127 Ga0163163_10277062 3300014325 Bacteria 1729
128 Ga0157379_10000044 3300014968 Bacteria 75399
129 Ga0157379_10006079 3300014968 Bacteria 10395
130 Ga0182006_1000392 3300015261 Bacteria 35983
131 Ga0182007_10000044 3300015262 Bacteria 106301
132 Ga0182007_10002194 3300015262 Bacteria 9913
133 Ga0182007_10002938 3300015262 Bacteria 8276
134 Ga0182005_1000032 3300015265 Bacteria 188517
135 Ga0183361_10018 3300016635 Bacteria 133279
136 Ga0197907_10105477 3300020069 Bacteria 1876
137 Ga0206354_11066516 3300020081 Bacteria 1966
138 Ga0213872_10007875 3300021361 Bacteria 5200
139 Ga0213876_10050204 3300021384 Bacteria 2204
140 Ga0224712_10003832 3300022467 Bacteria 3971
141 Ga0209784_100600 3300025224 Bacteria 11831
142 Ga0209566_100200 3300025225 Bacteria 61991
143 Ga0209674_100005 3300025226 Bacteria 1708125
144 Ga0209674_100150 3300025226 Bacteria 96511
145 Ga0209674_100237 3300025226 Bacteria 47803
146 Ga0209674_101104 3300025226 Bacteria 7979
147 Ga0209672_100001 3300025228 Bacteria 2828210
148 Ga0209672_100532 3300025228 Bacteria 20804
149 Ga0209147_100001 3300025229 Bacteria 2384371
150 Ga0209147_100378 3300025229 Bacteria 30960
151 Ga0209563_100794 3300025230 Bacteria 9503
152 Ga0207427_103643 3300025231 Bacteria 3085
153 Ga0209258_100001 3300025242 Bacteria 2384269
154 Ga0209646_1000075 3300025246 Bacteria 221755
155 Ga0209148_1000003 3300025254 Bacteria 2384288
156 Ga0209148_1000043 3300025254 Bacteria 461531
157 Ga0209759_1000228 3300025256 Bacteria 84202
158 Ga0209759_1000275 3300025256 Bacteria 72571
159 Ga0209759_1000879 3300025256 Bacteria 22944
160 Ga0209759_1001195 3300025256 Bacteria 16189
161 Ga0209759_1002243 3300025256 Bacteria 8800
162 Ga0209759_1002513 3300025256 Bacteria 7995
163 Ga0209233_1000016 3300025261 Bacteria 907830
164 Ga0209565_1000368 3300025263 Bacteria 38635
165 Ga0209565_1005164 3300025263 Bacteria 3838
166 Ga0209455_1000001 3300025272 Bacteria 2384278
167 Ga0209130_1007352 3300025284 Bacteria 3411
168 Ga0209675_1000070 3300025291 Bacteria 169161
169 Ga0209675_1000383 3300025291 Bacteria 36811
170 Ga0209675_1000389 3300025291 Bacteria 36614
171 Ga0209676_1000012 3300025292 Bacteria 841431
172 Ga0209025_1000124 3300025294 Bacteria 201973
173 Ga0209025_1000504 3300025294 Bacteria 75030
174 Ga0209025_1000788 3300025294 Bacteria 51988
175 Ga0209025_1001088 3300025294 Bacteria 39306
176 Ga0209025_1017948 3300025294 Bacteria 4051
177 Ga0209564_1000006 3300025295 Bacteria 1100927
178 Ga0209564_1000350 3300025295 Bacteria 86762
179 Ga0209564_1000380 3300025295 Bacteria 81287
180 Ga0209564_1000497 3300025295 Bacteria 64942
181 Ga0209256_1000059 3300025299 Bacteria 272170
182 Ga0209256_1000842 3300025299 Bacteria 38479
183 Ga0207426_1000305 3300025302 Bacteria 96172
184 Ga0209051_1004630 3300025303 Bacteria 8377
185 Ga0209051_1019161 3300025303 Bacteria 2998
186 Ga0207697_10004914 3300025315 Bacteria 6300
187 Ga0207713_1001376 3300025735 Bacteria 19744
188 Ga0207682_10037324 3300025893 Bacteria 1968
189 Ga0207647_10000214 3300025904 Bacteria 47271
190 Ga0207647_10011603 3300025904 Bacteria 6171
191 Ga0207647_10025243 3300025904 Bacteria 3908
192 Ga0207699_10061523 3300025906 Bacteria 2259
193 Ga0207645_10007275 3300025907 Bacteria 7829
194 Ga0207643_10015015 3300025908 Bacteria 4213
195 Ga0207705_10011384 3300025909 Bacteria 6441
196 Ga0207705_10016417 3300025909 Bacteria 5307
197 Ga0207705_10067174 3300025909 Bacteria 2594
198 Ga0207707_10003209 3300025912 Bacteria 14520
199 Ga0207671_10006819 3300025914 Bacteria 10090
200 Ga0207671_10058846 3300025914 Bacteria 2849
201 Ga0207657_10000018 3300025919 Bacteria 172140
202 Ga0207657_10013915 3300025919 Bacteria 7872
203 Ga0207649_10031429 3300025920 Bacteria 3155
204 Ga0207652_10039036 3300025921 Bacteria 4028
205 Ga0207681_10121885 3300025923 Bacteria 1913
206 Ga0207694_10062186 3300025924 Bacteria 2907
207 Ga0207650_10005000 3300025925 Bacteria 9056
208 Ga0207650_10076039 3300025925 Bacteria 2536
209 Ga0207659_10038111 3300025926 Bacteria 3341
210 Ga0207644_10007835 3300025931 Bacteria 6977
211 Ga0207644_10031728 3300025931 Bacteria 3683
212 Ga0207690_10000006 3300025932 Bacteria 433880
213 Ga0207690_10020114 3300025932 Bacteria 4120
214 Ga0207669_10005389 3300025937 Bacteria 5736
215 Ga0207669_10009058 3300025937 Bacteria 4716
216 Ga0207691_10001229 3300025940 Bacteria 25531
217 Ga0207691_10041561 3300025940 Bacteria 4244
218 Ga0207691_10116517 3300025940 Bacteria 2371
219 Ga0207689_10002193 3300025942 Bacteria 18314
220 Ga0207689_10002241 3300025942 Bacteria 18109
221 Ga0207679_10061329 3300025945 Bacteria 2799
222 Ga0207667_10000427 3300025949 Bacteria 56780
223 Ga0207651_10008322 3300025960 Bacteria 5596
224 Ga0207651_10022147 3300025960 Bacteria 3878
225 Ga0207668_10010999 3300025972 Bacteria 5488
226 Ga0207668_10033022 3300025972 Bacteria 3426
227 Ga0207640_10009199 3300025981 Bacteria 5522
228 Ga0207658_10001631 3300025986 Bacteria 17206
229 Ga0207658_10004585 3300025986 Bacteria 9593
230 Ga0207658_10008086 3300025986 Bacteria 7164
231 Ga0207658_10093471 3300025986 Bacteria 2338
232 Ga0207677_10137926 3300026023 Bacteria 1863
233 Ga0207703_10001245 3300026035 Bacteria 23856
234 Ga0207678_10000110 3300026067 Bacteria 67527
235 Ga0207678_10255420 3300026067 Bacteria 1501
236 Ga0207648_10000885 3300026089 Bacteria 33754
237 Ga0207674_10029280 3300026116 Bacteria 5799
238 Ga0207675_100000672 3300026118 Bacteria 33681
239 Ga0207675_100031843 3300026118 Bacteria 4913
240 Ga0207675_100052151 3300026118 Bacteria 3817
241 Ga0207683_10001347 3300026121 Bacteria 22165
242 Ga0207683_10005836 3300026121 Bacteria 10556
243 Ga0207698_10008605 3300026142 Bacteria 6466
244 Ga0207698_10067021 3300026142 Bacteria 2829
245 Ga0209282_1000064 3300027666 Bacteria 91973
246 Ga0209974_10022346 3300027876 Bacteria 2095
247 Ga0207428_10023424 3300027907 Bacteria 5192
248 Ga0268266_10021579 3300028379 Bacteria 5485
249 Ga0268265_10002148 3300028380 Bacteria 15266
250 Ga0268265_10068297 3300028380 Bacteria 2755
251 Ga0268265_10100368 3300028380 Bacteria 2336
252 Ga0268264_10001103 3300028381 Bacteria 26672
253 Ga0268264_10010915 3300028381 Bacteria 7506
254 Ga0265338_10000110 3300028800 Bacteria 152188
255 Ga0265330_10016511 3300031235 Bacteria 3405
256 Ga0265327_10000295 3300031251 Bacteria 96706
257 Ga0307405_10013096 3300031731 Bacteria 4415
258 Ga0307413_10020648 3300031824 Bacteria 3509
259 Ga0307410_10042294 3300031852 Bacteria 3011
260 Ga0307412_10000005 3300031911 Bacteria 526194
261 Ga0307412_10078267 3300031911 Bacteria 2277
262 Ga0307416_100036132 3300032002 Bacteria 3785
263 Ga0307415_100018206 3300032126 Bacteria 4235
264 Ga0373941_0023471 3300035115 Bacteria 1762
265 Ga0316582_0001945 3300036647 Bacteria 9436
266 Ga0316584_0017192 3300036712 Bacteria 5195
267 Ga0395899_0000008 3300037312 Bacteria 567572
268 Ga0395900_0002152 3300037418 Bacteria 22040
269 Ga0395900_0063136 3300037418 Bacteria 3807
270 Ga0395898_0000072 3300037466 Bacteria 249505
271 Ga0395898_0007569 3300037466 Bacteria 11528
272 Ga0395905_0000012 3300037471 Bacteria 420861
273 Ga0395901_0000003 3300038443 Bacteria 701538
274 Ga0395901_0000154 3300038443 Bacteria 89750
275 Ga0395901_0030143 3300038443 Bacteria 5588
276 Ga0436361_0215157 3300039447 Bacteria 166868
277 Ga0436361_0653615 3300039447 Bacteria 11602
278 Ga0436361_0720947 3300039447 Bacteria 11429
279 Ga0439448_0005240 3300042005 Bacteria 3692
280 Ga0450904_000533 3300042139 Bacteria 7241
281 Ga0451577_0116638 3300042876 Bacteria 2392
282 Ga0453683_0009774 3300044673 Bacteria 6396
283 Ga0453683_0013014 3300044673 Bacteria 5439
284 Ga0466966_0000008 3300044684 Bacteria 155597
285 Ga0466961_0000028 3300044693 Bacteria 86793
286 Ga0466961_0025766 3300044693 Bacteria 3780
287 Ga0453684_0001452 3300044712 Bacteria 67372
288 Ga0453684_0003292 3300044712 Bacteria 36816
289 Ga0453684_0059857 3300044712 Bacteria 4905
290 Ga0453684_0085184 3300044712 Bacteria 3927
291 Ga0466968_0000016 3300044735 Bacteria 50013
292 Ga0451576_0000335 3300045051 Bacteria 113806
293 Ga0451576_0016196 3300045051 Bacteria 8236
294 Ga0451576_0040985 3300045051 Bacteria 4896
295 Ga0466958_0038185 3300045836 Bacteria 2881
296 Ga0495627_000016 3300046453 Bacteria 318947
297 Ga0495592_0008737 3300046454 Bacteria 7605
298 Ga0495603_0035874 3300046455 Bacteria 2977
299 Ga0495603_0053825 3300046455 Bacteria 2387
300 Ga0495591_001099 3300046458 Bacteria 18000
301 Ga0495629_0000099 3300046459 Bacteria 75956
302 Ga0495629_0001848 3300046459 Bacteria 16586
303 Ga0495629_0007335 3300046459 Bacteria 8126
304 Ga0495629_0016933 3300046459 Bacteria 5230
305 Ga0495638_0004081 3300046460 Bacteria 11185
306 Ga0495638_0014717 3300046460 Bacteria 5276
307 Ga0495651_0008059 3300046462 Bacteria 8078
308 Ga0495653_0003639 3300046463 Bacteria 12432
309 Ga0495653_0006523 3300046463 Bacteria 9574
310 Ga0495653_0018658 3300046463 Bacteria 5632
311 Ga0495653_0025481 3300046463 Bacteria 4752
312 Ga0495653_0162930 3300046463 Bacteria 1546
313 Ga0495650_0002455 3300046471 Bacteria 14954
314 Ga0495650_0003189 3300046471 Bacteria 12218
315 Ga0495650_0007872 3300046471 Bacteria 6329
316 Ga0495650_0015323 3300046471 Bacteria 3936
317 Ga0495650_0036830 3300046471 Bacteria 2136
318 Ga0495580_0006624 3300046472 Bacteria 9409
319 Ga0495580_0009216 3300046472 Bacteria 7778
320 Ga0495580_0049822 3300046472 Bacteria 2962
321 Ga0495580_0134456 3300046472 Bacteria 1714
322 Ga0495605_0002569 3300046474 Bacteria 11163
323 Ga0495605_0005175 3300046474 Bacteria 7598
324 Ga0495664_0000349 3300046477 Bacteria 22440
325 Ga0495664_0033708 3300046477 Bacteria 3011
326 Ga0495664_0041390 3300046477 Bacteria 2726
327 Ga0495664_0054077 3300046477 Bacteria 2387
328 Ga0495584_0000022 3300046491 Bacteria 128471
329 Ga0495585_0012983 3300046492 Bacteria 4892
330 Ga0495585_0026189 3300046492 Bacteria 3332
331 Ga0495596_0000048 3300046500 Bacteria 88427
332 Ga0495596_0001254 3300046500 Bacteria 14780
333 Ga0495607_0001625 3300046501 Bacteria 19476
334 Ga0495583_0003132 3300046506 Bacteria 13051
335 Ga0495606_0000690 3300046507 Bacteria 52411
336 Ga0495606_0001324 3300046507 Bacteria 33820
337 Ga0495606_0009012 3300046507 Bacteria 8529
338 Ga0495606_0020913 3300046507 Bacteria 4806
339 Ga0495608_0017474 3300046511 Bacteria 4961
340 Ga0495610_0004942 3300046512 Bacteria 9664
341 Ga0495616_0001671 3300046513 Bacteria 15156
342 Ga0495618_0007880 3300046514 Bacteria 6446
343 Ga0495618_0015383 3300046514 Bacteria 4669
344 Ga0495628_0016162 3300046516 Bacteria 6226
345 Ga0495630_0014647 3300046517 Bacteria 5716
346 Ga0495648_0020738 3300046524 Bacteria 4573
347 Ga0495648_0026735 3300046524 Bacteria 3878
348 Ga0495648_0050272 3300046524 Bacteria 2548
349 Ga0495666_0003464 3300046526 Bacteria 7966
350 Ga0495666_0004621 3300046526 Bacteria 6963
351 Ga0495666_0011094 3300046526 Bacteria 4495
352 Ga0495652_0040394 3300046529 Bacteria 4032
353 Ga0495654_0061314 3300046530 Bacteria 1806
354 Ga0495640_0002986 3300046533 Bacteria 13619
355 Ga0495640_0048205 3300046533 Bacteria 2945
356 Ga0495609_0000263 3300046538 Bacteria 49427
357 Ga0495645_0001683 3300046543 Bacteria 15021
358 Ga0495622_0000880 3300046557 Bacteria 16384
359 Ga0495622_0018803 3300046557 Bacteria 3218
360 Ga0495633_0001345 3300046558 Bacteria 19254
361 Ga0495667_0032052 3300046559 Bacteria 3524
362 Ga0495634_0004092 3300046642 Bacteria 11550
363 Ga0495634_0009265 3300046642 Bacteria 7268
364 Ga0495625_0007904 3300046660 Bacteria 9150
365 Ga0495625_0081073 3300046660 Bacteria 2259
366 Ga0495625_0082058 3300046660 Bacteria 2243
367 Ga0495635_0002165 3300046663 Bacteria 13343
368 Ga0495635_0012758 3300046663 Bacteria 5888
369 Ga0495635_0018948 3300046663 Bacteria 4803
370 Ga0495635_0028210 3300046663 Bacteria 3901
371 Ga0495661_0001337 3300046665 Bacteria 20907
372 Ga0495661_0011631 3300046665 Bacteria 5966
373 Ga0495588_0051671 3300046674 Bacteria 2117
374 Ga0495657_0050263 3300046675 Bacteria 2803
375 Ga0495599_0016168 3300046678 Bacteria 4631
376 Ga0495623_0008796 3300046679 Bacteria 6552
377 Ga0495646_0001798 3300046680 Bacteria 12872
378 Ga0495613_0028123 3300046689 Bacteria 4183
379 Ga0495613_0037701 3300046689 Bacteria 3583
380 Ga0495624_0010339 3300046690 Bacteria 6427
381 Ga0495624_0019421 3300046690 Bacteria 4536
382 Ga0495624_0034551 3300046690 Bacteria 3269
383 Ga0495624_0077654 3300046690 Bacteria 2059
384 Ga0495670_0008646 3300046691 Bacteria 5010
385 Ga0495671_0000298 3300046692 Bacteria 41706
386 Ga0495671_0006874 3300046692 Bacteria 6529
387 Ga0495649_0003994 3300046694 Bacteria 9723
388 Ga0495649_0019811 3300046694 Bacteria 3778
389 Ga0495649_0092725 3300046694 Bacteria 1608
390 Ga0495589_0000928 3300046794 Bacteria 18001
391 Ga0495589_0010014 3300046794 Bacteria 4926
392 Ga0495589_0049716 3300046794 Bacteria 2075
393 Ga0495600_0001945 3300046809 Bacteria 11595
394 Ga0495581_0018968 3300047315 Bacteria 3992
395 Ga0495604_0006905 3300047317 Bacteria 9000
396 Ga0495604_0007838 3300047317 Bacteria 8453
397 Ga0495604_0011785 3300047317 Bacteria 6951
398 Ga0495674_0079395 3300047319 Bacteria 2818
399 Ga0495674_0132611 3300047319 Bacteria 2098
400 Ga0495672_0007240 3300047320 Bacteria 8370
401 Ga0495676_0005874 3300047321 Bacteria 11265
402 Ga0495676_0020180 3300047321 Bacteria 5854
403 Ga0495680_0052605 3300047322 Bacteria 3174
404 Ga0495683_0002027 3300047323 Bacteria 12553
405 Ga0495683_0018507 3300047323 Bacteria 3600
406 Ga0495683_0067460 3300047323 Bacteria 1761
407 Ga0495687_000104 3300047443 Bacteria 128704
408 Ga0495687_011819 3300047443 Bacteria 4662
409 Ga0495687_023572 3300047443 Bacteria 2938
410 Ga0495675_0001679 3300047444 Bacteria 13286
411 Ga0495675_0006213 3300047444 Bacteria 7305
412 Ga0495675_0023657 3300047444 Bacteria 3915
413 Ga0495679_000062 3300047446 Bacteria 107181
414 Ga0495673_0000027 3300047469 Bacteria 475440
415 Ga0495673_0027555 3300047469 Bacteria 2702
416 Ga0495684_0031865 3300047471 Bacteria 4049
417 Ga0495684_0183711 3300047471 Bacteria 1549
418 Ga0495686_0000468 3300047472 Bacteria 60235
419 Ga0495593_0002141 3300047673 Bacteria 11792
420 Ga0495593_0003580 3300047673 Bacteria 9281
421 Ga0495593_0007871 3300047673 Bacteria 6205
422 Ga0495593_0023731 3300047673 Bacteria 3405
423 Ga0495602_0000856 3300048088 Bacteria 29354
424 Ga0495602_0010590 3300048088 Bacteria 9565
425 Ga0495602_0076492 3300048088 Bacteria 2835
426 Ga0495614_0024723 3300048089 Bacteria 2592
427 Ga0495614_0033440 3300048089 Bacteria 2212
428 Ga0495614_0033967 3300048089 Bacteria 2193
429 Ga0495626_0016822 3300048091 Bacteria 3707
430 Ga0496100_0068740 3300048903 Bacteria 2357
431 Ga0496100_0104330 3300048903 Bacteria 1958
432 Ga0496101_0080148 3300048904 Bacteria 2411
433 Ga0496102_0056983 3300048905 Bacteria 3566
434 Ga0496102_0144172 3300048905 Bacteria 2234
435 Ga0496102_0153891 3300048905 Bacteria 2161
436 Ga0496102_0174515 3300048905 Bacteria 2023
437 Ga0496103_0001568 3300048906 Bacteria 15119
438 Ga0496103_0030441 3300048906 Bacteria 3284
439 Ga0496106_0126753 3300048909 Bacteria 1999
440 Ga0496107_0104139 3300048910 Bacteria 2082
441 Ga0496109_0004776 3300048912 Bacteria 11319
442 Ga0496109_0018574 3300048912 Bacteria 6109
443 Ga0496110_0024587 3300048913 Bacteria 5135
444 Ga0496111_0015944 3300048914 Bacteria 5169
445 Ga0496111_0054961 3300048914 Bacteria 2879
446 Ga0496113_0121274 3300048916 Bacteria 2044
447 Ga0496114_0001384 3300048917 Bacteria 18374
448 Ga0496114_0006019 3300048917 Bacteria 9547
449 Ga0496114_0043426 3300048917 Bacteria 3727
450 Ga0496116_0032435 3300048919 Bacteria 3722
451 Ga0496117_0000010 3300048920 Bacteria 611954
452 Ga0496117_0016090 3300048920 Bacteria 6331
453 Ga0496117_0036972 3300048920 Bacteria 3644
454 Ga0496117_0051740 3300048920 Bacteria 2900
455 Ga0496117_0129063 3300048920 Bacteria 1536
456 Ga0496118_0000009 3300048921 Bacteria 611954
457 Ga0496118_0004252 3300048921 Bacteria 17141
458 Ga0496118_0013496 3300048921 Bacteria 7721
459 Ga0496118_0022383 3300048921 Bacteria 5526
460 Ga0496118_0024054 3300048921 Bacteria 5269
461 Ga0496118_0061389 3300048921 Bacteria 2784
462 Ga0496119_0057709 3300048922 Bacteria 2344
463 Ga0496121_0000437 3300048924 Bacteria 82376
464 Ga0496121_0009543 3300048924 Bacteria 11117
465 Ga0496121_0010408 3300048924 Bacteria 10498
466 Ga0496121_0015396 3300048924 Bacteria 8015
467 Ga0496121_0047186 3300048924 Bacteria 3678
468 Ga0496121_0093773 3300048924 Bacteria 2336
469 Ga0496121_0110339 3300048924 Bacteria 2099
470 Ga0496122_0001209 3300048925 Bacteria 43970
471 Ga0496122_0002400 3300048925 Bacteria 26732
472 Ga0496122_0072037 3300048925 Bacteria 2459
473 Ga0496123_0001776 3300048926 Bacteria 28416
474 Ga0496123_0004021 3300048926 Bacteria 15891
475 Ga0496124_0000013 3300048927 Bacteria 484884
476 Ga0496124_0027531 3300048927 Bacteria 5101
477 Ga0496124_0080401 3300048927 Bacteria 2682
478 Ga0496125_0093438 3300048928 Bacteria 2244
479 Ga0496126_0000034 3300048929 Bacteria 362440
480 Ga0496126_0000882 3300048929 Bacteria 52767
481 Ga0496126_0006636 3300048929 Bacteria 12879
482 Ga0496126_0034868 3300048929 Bacteria 4720
483 Ga0496126_0110212 3300048929 Bacteria 2398
484 Ga0495678_000001 3300049459 Bacteria 1060340
485 Ga0495682_0003555 3300049460 Bacteria 6891
486 Ga0501034_0000169 3300049571 Bacteria 122591
487 Ga0501034_0010247 3300049571 Bacteria 9777
488 Ga0501034_0015509 3300049571 Bacteria 7828
489 Ga0501047_0028759 3300049581 Bacteria 5360
490 Ga0501072_0008451 3300049588 Bacteria 7812
491 Ga0501072_0021840 3300049588 Bacteria 4964
492 Ga0501073_0012851 3300049589 Bacteria 6103
493 Ga0501209_000101 3300049656 Bacteria 8706
494 Ga0501249_002239 3300049679 Bacteria 3926
495 Ga0501080_0009862 3300049742 Bacteria 8726
496 Ga0501269_000182 3300049766 Bacteria 19267
497 Ga0501035_0006947 3300049822 Bacteria 10570
498 nmdc:mga00v17_11910_c1 3300050491 Bacteria 4788
499 nmdc:mga09592_43378_c1 3300050508 Bacteria 3786
500 nmdc:mga08y16_26660_c1 3300050511 Bacteria 6090
501 nmdc:mga08y16_99292_c1 3300050511 Bacteria 3031
502 nmdc:mga0n895_200504_c1 3300050512 Bacteria 2026
503 Ga0500590_028942 3300053148 Bacteria 2874
504 Ga0500622_0000001 3300053156 Bacteria 657715
505 Ga0501084_0083146 3300054114 Bacteria 2687
506 Ga0501082_0181401 3300060353 Bacteria 1831

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0017192 Ga0316584_0017192_3422_4513 360
2 iso_pu_bacteria 2857558681 2857561195 428
3 3300028380 Ga0268265_10068297 Ga0268265_100682972 435
4 3300036647 Ga0316582_0001945 Ga0316582_0001945_6980_8296 435
5 3300005328 Ga0070676_10064579 Ga0070676_100645792 437
6 3300005354 Ga0070675_100040882 Ga0070675_1000408823 437
7 3300025940 Ga0207691_10041561 Ga0207691_100415613 437
8 3300025972 Ga0207668_10010999 Ga0207668_100109992 437
9 3300005841 Ga0068863_100077569 Ga0068863_1000775692 439
10 iso_pu_bacteria 2816332286 2817456680 439
11 3300049571 Ga0501034_0010247 Ga0501034_0010247_7844_9244 443
12 3300048925 Ga0496122_0072037 Ga0496122_0072037_185_1582 444
13 3300048927 Ga0496124_0000013 Ga0496124_0000013_43861_45258 444
14 3300049656 Ga0501209_000101 Ga0501209_000101_3401_4789 444
15 3300006195 Ga0075366_10084727 Ga0075366_100847272 449
16 iso_pu_bacteria 2842711865 2842711919 450
17 3300050491 nmdc:mga00v17_11910_c1 nmdc:mga00v17_11910_c1_2200_3597 452
18 iso_pu_bacteria 2998344455 2998347186 452
19 iso_pu_bacteria 2643221664 2644356238 453
20 iso_pu_bacteria 2857547612 2857548070 453
21 iso_pu_bacteria 2857553236 2857555731 453
22 iso_pu_bacteria 2904424332 2904429085 453
23 iso_pu_bacteria 2919476304 2919479222 453
24 iso_pu_bacteria 2932410948 2932412660 453
25 iso_pu_bacteria 2932416698 2932420175 453
26 3300015262 Ga0182007_10002194 Ga0182007_100021945 454
27 iso_pu_bacteria 2600255292 2601670585 454
28 iso_pu_bacteria 8040167225 8040173276 454
29 3300003771 Ga0055526_1000111 Ga0055526_100011157 455
30 3300005549 Ga0070704_100231198 Ga0070704_1002311981 455
31 3300009093 Ga0105240_10206112 Ga0105240_102061122 455
32 3300013104 Ga0157370_10002443 Ga0157370_1000244323 455
33 3300015262 Ga0182007_10000044 Ga0182007_1000004459 455
34 3300015265 Ga0182005_1000032 Ga0182005_100003243 455
35 3300021361 Ga0213872_10007875 Ga0213872_100078755 455
36 3300025295 Ga0209564_1000006 Ga0209564_1000006450 455
37 3300039447 Ga0436361_0215157 Ga0436361_0215157_50046_51419 455
38 3300039447 Ga0436361_0653615 Ga0436361_0653615_6575_7957 455
39 3300039447 Ga0436361_0720947 Ga0436361_0720947_6401_7783 455
40 3300044712 Ga0453684_0001452 Ga0453684_0001452_52550_53923 455
41 3300045051 Ga0451576_0016196 Ga0451576_0016196_3812_5185 455
42 3300046453 Ga0495627_000016 Ga0495627_000016_266910_268292 455
43 3300046460 Ga0495638_0014717 Ga0495638_0014717_1044_2474 455
44 3300046463 Ga0495653_0006523 Ga0495653_0006523_7646_9028 455
45 3300046491 Ga0495584_0000022 Ga0495584_0000022_49813_51195 455
46 3300046492 Ga0495585_0012983 Ga0495585_0012983_2721_4151 455
47 3300046501 Ga0495607_0001625 Ga0495607_0001625_7297_8679 455
48 3300046507 Ga0495606_0000690 Ga0495606_0000690_23855_25237 455
49 3300046507 Ga0495606_0001324 Ga0495606_0001324_24820_26202 455
50 3300046507 Ga0495606_0009012 Ga0495606_0009012_5270_6652 455
51 3300046538 Ga0495609_0000263 Ga0495609_0000263_36154_37536 455
52 3300046558 Ga0495633_0001345 Ga0495633_0001345_13528_14910 455
53 3300046660 Ga0495625_0007904 Ga0495625_0007904_3244_4626 455
54 3300046660 Ga0495625_0082058 Ga0495625_0082058_131_1594 455
55 3300046663 Ga0495635_0002165 Ga0495635_0002165_501_1883 455
56 3300046694 Ga0495649_0003994 Ga0495649_0003994_4853_6235 455
57 3300046694 Ga0495649_0092725 Ga0495649_0092725_117_1496 455
58 3300047317 Ga0495604_0011785 Ga0495604_0011785_5268_6650 455
59 3300047444 Ga0495675_0006213 Ga0495675_0006213_243_1625 455
60 3300047469 Ga0495673_0000027 Ga0495673_0000027_291611_292993 455
61 3300047673 Ga0495593_0002141 Ga0495593_0002141_5335_6717 455
62 3300048906 Ga0496103_0001568 Ga0496103_0001568_5003_6385 455
63 3300048914 Ga0496111_0015944 Ga0496111_0015944_2512_3894 455
64 3300048919 Ga0496116_0032435 Ga0496116_0032435_844_2226 455
65 3300048920 Ga0496117_0000010 Ga0496117_0000010_43640_45022 455
66 3300048920 Ga0496117_0129063 Ga0496117_0129063_12_1454 455
67 3300048921 Ga0496118_0000009 Ga0496118_0000009_566933_568315 455
68 3300048924 Ga0496121_0010408 Ga0496121_0010408_3508_4890 455
69 3300048924 Ga0496121_0015396 Ga0496121_0015396_4992_6374 455
70 3300048925 Ga0496122_0002400 Ga0496122_0002400_15505_16887 455
71 3300048926 Ga0496123_0004021 Ga0496123_0004021_9974_11356 455
72 3300048927 Ga0496124_0080401 Ga0496124_0080401_910_2292 455
73 3300048928 Ga0496125_0093438 Ga0496125_0093438_278_1660 455
74 3300048929 Ga0496126_0034868 Ga0496126_0034868_1902_3284 455
75 3300049459 Ga0495678_000001 Ga0495678_000001_685331_686713 455
76 3300049460 Ga0495682_0003555 Ga0495682_0003555_3087_4517 455
77 3300049679 Ga0501249_002239 Ga0501249_002239_474_1856 455
78 3300049766 Ga0501269_000182 Ga0501269_000182_2332_3714 455
79 3300005327 Ga0070658_10007669 Ga0070658_100076698 456
80 3300005329 Ga0070683_100015845 Ga0070683_1000158452 456
81 3300005330 Ga0070690_100012158 Ga0070690_1000121583 456
82 3300005331 Ga0070670_100006044 Ga0070670_1000060447 456
83 3300005331 Ga0070670_100006402 Ga0070670_1000064027 456
84 3300005331 Ga0070670_100055027 Ga0070670_1000550272 456
85 3300005334 Ga0068869_100000941 Ga0068869_10000094111 456
86 3300005334 Ga0068869_100001855 Ga0068869_1000018552 456
87 3300005335 Ga0070666_10013183 Ga0070666_100131833 456
88 3300005338 Ga0068868_100007389 Ga0068868_1000073896 456
89 3300005344 Ga0070661_100002328 Ga0070661_1000023289 456
90 3300005344 Ga0070661_100018424 Ga0070661_1000184242 456
91 3300005354 Ga0070675_100016834 Ga0070675_1000168345 456
92 3300005355 Ga0070671_100012870 Ga0070671_1000128702 456
93 3300005355 Ga0070671_100018269 Ga0070671_1000182692 456
94 3300005364 Ga0070673_100014894 Ga0070673_1000148944 456
95 3300005364 Ga0070673_100068418 Ga0070673_1000684182 456
96 3300005366 Ga0070659_100080811 Ga0070659_1000808112 456
97 3300005366 Ga0070659_100107786 Ga0070659_1001077863 456
98 3300005367 Ga0070667_100003833 Ga0070667_1000038339 456
99 3300005434 Ga0070709_10001157 Ga0070709_100011575 456
100 3300005437 Ga0070710_10009779 Ga0070710_100097792 456
101 3300005445 Ga0070708_100000125 Ga0070708_1000001257 456
102 3300005456 Ga0070678_100006242 Ga0070678_1000062424 456
103 3300005458 Ga0070681_10000413 Ga0070681_1000041328 456
104 3300005459 Ga0068867_100005612 Ga0068867_1000056124 456
105 3300005459 Ga0068867_100014149 Ga0068867_1000141494 456
106 3300005459 Ga0068867_100245685 Ga0068867_1002456851 456
107 3300005530 Ga0070679_100003879 Ga0070679_1000038793 456
108 3300005530 Ga0070679_100019673 Ga0070679_1000196732 456
109 3300005535 Ga0070684_100314155 Ga0070684_1003141551 456
110 3300005543 Ga0070672_100004932 Ga0070672_1000049325 456
111 3300005548 Ga0070665_100010975 Ga0070665_1000109754 456
112 3300005563 Ga0068855_100029324 Ga0068855_1000293245 456
113 3300005564 Ga0070664_100015585 Ga0070664_1000155854 456
114 3300005617 Ga0068859_100004344 Ga0068859_10000434415 456
115 3300005617 Ga0068859_100043558 Ga0068859_1000435584 456
116 3300005618 Ga0068864_100026306 Ga0068864_1000263063 456
117 3300005719 Ga0068861_100000216 Ga0068861_10000021616 456
118 3300005719 Ga0068861_100098864 Ga0068861_1000988642 456
119 3300005834 Ga0068851_10032305 Ga0068851_100323052 456
120 3300005840 Ga0068870_10002112 Ga0068870_100021122 456
121 3300005841 Ga0068863_100012923 Ga0068863_1000129234 456
122 3300005841 Ga0068863_100026740 Ga0068863_1000267402 456
123 3300005842 Ga0068858_100002185 Ga0068858_1000021852 456
124 3300005842 Ga0068858_100032968 Ga0068858_1000329684 456
125 3300005843 Ga0068860_100004954 Ga0068860_10000495410 456
126 3300005844 Ga0068862_100002123 Ga0068862_1000021232 456
127 3300006237 Ga0097621_100008935 Ga0097621_1000089355 456
128 3300006237 Ga0097621_100090246 Ga0097621_1000902462 456
129 3300006931 Ga0097620_100004344 Ga0097620_10000434415 456
130 3300006931 Ga0097620_100043559 Ga0097620_1000435592 456
131 3300009094 Ga0111539_10036219 Ga0111539_100362193 456
132 3300009551 Ga0105238_10029632 Ga0105238_100296325 456
133 3300009553 Ga0105249_10198787 Ga0105249_101987872 456
134 3300010375 Ga0105239_10233932 Ga0105239_102339322 456
135 3300013100 Ga0157373_10013708 Ga0157373_100137082 456
136 3300013104 Ga0157370_10005978 Ga0157370_100059789 456
137 3300013105 Ga0157369_10114611 Ga0157369_101146112 456
138 3300013296 Ga0157374_10108496 Ga0157374_101084962 456
139 3300013297 Ga0157378_10076823 Ga0157378_100768233 456
140 3300013297 Ga0157378_10187934 Ga0157378_101879341 456
141 3300013307 Ga0157372_10129853 Ga0157372_101298532 456
142 3300014325 Ga0163163_10006597 Ga0163163_100065974 456
143 3300014325 Ga0163163_10277062 Ga0163163_102770622 456
144 3300014968 Ga0157379_10000044 Ga0157379_1000004436 456
145 3300014968 Ga0157379_10006079 Ga0157379_100060794 456
146 3300021384 Ga0213876_10050204 Ga0213876_100502042 456
147 3300025315 Ga0207697_10004914 Ga0207697_100049143 456
148 3300025893 Ga0207682_10037324 Ga0207682_100373242 456
149 3300025906 Ga0207699_10061523 Ga0207699_100615231 456
150 3300025907 Ga0207645_10007275 Ga0207645_100072754 456
151 3300025908 Ga0207643_10015015 Ga0207643_100150153 456
152 3300025909 Ga0207705_10067174 Ga0207705_100671742 456
153 3300025912 Ga0207707_10003209 Ga0207707_100032095 456
154 3300025921 Ga0207652_10039036 Ga0207652_100390364 456
155 3300025923 Ga0207681_10121885 Ga0207681_101218852 456
156 3300025925 Ga0207650_10005000 Ga0207650_100050007 456
157 3300025925 Ga0207650_10076039 Ga0207650_100760393 456
158 3300025926 Ga0207659_10038111 Ga0207659_100381114 456
159 3300025931 Ga0207644_10007835 Ga0207644_100078354 456
160 3300025931 Ga0207644_10031728 Ga0207644_100317282 456
161 3300025932 Ga0207690_10020114 Ga0207690_100201142 456
162 3300025937 Ga0207669_10005389 Ga0207669_100053894 456
163 3300025937 Ga0207669_10009058 Ga0207669_100090582 456
164 3300025940 Ga0207691_10001229 Ga0207691_100012294 456
165 3300025940 Ga0207691_10116517 Ga0207691_101165172 456
166 3300025942 Ga0207689_10002193 Ga0207689_100021937 456
167 3300025942 Ga0207689_10002241 Ga0207689_100022414 456
168 3300025945 Ga0207679_10061329 Ga0207679_100613292 456
169 3300025960 Ga0207651_10008322 Ga0207651_100083222 456
170 3300025960 Ga0207651_10022147 Ga0207651_100221473 456
171 3300025972 Ga0207668_10033022 Ga0207668_100330222 456
172 3300025981 Ga0207640_10009199 Ga0207640_100091993 456
173 3300025986 Ga0207658_10001631 Ga0207658_1000163114 456
174 3300025986 Ga0207658_10004585 Ga0207658_100045854 456
175 3300025986 Ga0207658_10008086 Ga0207658_100080865 456
176 3300026023 Ga0207677_10137926 Ga0207677_101379262 456
177 3300026035 Ga0207703_10001245 Ga0207703_1000124510 456
178 3300026067 Ga0207678_10255420 Ga0207678_102554201 456
179 3300026089 Ga0207648_10000885 Ga0207648_100008854 456
180 3300026116 Ga0207674_10029280 Ga0207674_100292803 456
181 3300026118 Ga0207675_100000672 Ga0207675_10000067218 456
182 3300026118 Ga0207675_100031843 Ga0207675_1000318433 456
183 3300026118 Ga0207675_100052151 Ga0207675_1000521513 456
184 3300026121 Ga0207683_10001347 Ga0207683_1000134720 456
185 3300026121 Ga0207683_10005836 Ga0207683_100058361 456
186 3300026142 Ga0207698_10067021 Ga0207698_100670212 456
187 3300027876 Ga0209974_10022346 Ga0209974_100223462 456
188 3300027907 Ga0207428_10023424 Ga0207428_100234243 456
189 3300028379 Ga0268266_10021579 Ga0268266_100215792 456
190 3300028380 Ga0268265_10002148 Ga0268265_1000214811 456
191 3300028380 Ga0268265_10100368 Ga0268265_101003682 456
192 3300028381 Ga0268264_10001103 Ga0268264_1000110317 456
193 3300028381 Ga0268264_10010915 Ga0268264_100109154 456
194 3300031235 Ga0265330_10016511 Ga0265330_100165113 456
195 3300031251 Ga0265327_10000295 Ga0265327_1000029547 456
196 3300031824 Ga0307413_10020648 Ga0307413_100206482 456
197 3300031852 Ga0307410_10042294 Ga0307410_100422942 456
198 3300032126 Ga0307415_100018206 Ga0307415_1000182064 456
199 3300035115 Ga0373941_0023471 Ga0373941_0023471_62_1435 456
200 3300038443 Ga0395901_0030143 Ga0395901_0030143_3393_4769 456
201 3300042139 Ga0450904_000533 Ga0450904_000533_3985_5370 456
202 3300042876 Ga0451577_0116638 Ga0451577_0116638_570_1958 456
203 3300044673 Ga0453683_0009774 Ga0453683_0009774_3199_4575 456
204 3300044673 Ga0453683_0013014 Ga0453683_0013014_2626_4002 456
205 3300044712 Ga0453684_0003292 Ga0453684_0003292_11920_13308 456
206 3300044712 Ga0453684_0059857 Ga0453684_0059857_709_2097 456
207 3300044712 Ga0453684_0085184 Ga0453684_0085184_2316_3776 456
208 3300045051 Ga0451576_0000335 Ga0451576_0000335_81951_83333 456
209 3300045051 Ga0451576_0040985 Ga0451576_0040985_3327_4703 456
210 3300045836 Ga0466958_0038185 Ga0466958_0038185_369_1745 456
211 3300048905 Ga0496102_0056983 Ga0496102_0056983_617_1993 456
212 3300048912 Ga0496109_0004776 Ga0496109_0004776_7486_8913 456
213 3300048912 Ga0496109_0018574 Ga0496109_0018574_4348_5724 456
214 3300048917 Ga0496114_0001384 Ga0496114_0001384_8248_9624 456
215 3300048917 Ga0496114_0043426 Ga0496114_0043426_275_1702 456
216 3300048929 Ga0496126_0110212 Ga0496126_0110212_789_2177 456
217 3300049571 Ga0501034_0015509 Ga0501034_0015509_799_2172 456
218 3300049581 Ga0501047_0028759 Ga0501047_0028759_1034_2431 456
219 3300049588 Ga0501072_0008451 Ga0501072_0008451_6098_7477 456
220 3300049588 Ga0501072_0021840 Ga0501072_0021840_2875_4248 456
221 3300049589 Ga0501073_0012851 Ga0501073_0012851_689_2062 456
222 3300049742 Ga0501080_0009862 Ga0501080_0009862_36_1409 456
223 3300049822 Ga0501035_0006947 Ga0501035_0006947_8198_9595 456
224 3300050508 nmdc:mga09592_43378_c1 nmdc:mga09592_43378_c1_1132_2505 456
225 3300050511 nmdc:mga08y16_26660_c1 nmdc:mga08y16_26660_c1_3982_5385 456
226 3300050511 nmdc:mga08y16_99292_c1 nmdc:mga08y16_99292_c1_1595_2971 456
227 3300050512 nmdc:mga0n895_200504_c1 nmdc:mga0n895_200504_c1_479_1852 456
228 3300053156 Ga0500622_0000001 Ga0500622_0000001_13391_14791 456
229 3300054114 Ga0501084_0083146 Ga0501084_0083146_212_1585 456
230 3300060353 Ga0501082_0181401 Ga0501082_0181401_150_1523 456
231 iso_pu_bacteria 2855730933 2855733215 456
232 iso_pu_bacteria 2855767633 2855771967 456
233 iso_pu_bacteria 2857542790 2857543021 456
234 iso_pu_bacteria 2881412998 2881416028 456
235 iso_pu_bacteria 639633007 639787934 456
236 iso_pu_bacteria 2513237150 2513954557 457
237 iso_pu_bacteria 2513237165 2514041162 457
238 iso_pu_bacteria 2834641062 2834641356 457
239 iso_pu_bacteria 2858688981 2858691336 457
240 iso_pu_bacteria 644736347 644748683 457
241 iso_pu_bacteria 8003400568 8003400970 457
242 iso_pu_bacteria 2599185178 2599445821 458
243 3300044735 Ga0466968_0000016 Ga0466968_0000016_899_2290 459
244 3300002705 JGI25156J39149_1000917 JGI25156J39149_100091713 460
245 3300002738 JGI25154J39366_1000190 JGI25154J39366_10001905 460
246 3300003187 JGI25151J46595_10000841 JGI25151J46595_100008415 460
247 3300003756 Ga0055533_1000460 Ga0055533_10004601 460
248 3300003771 Ga0055526_1002108 Ga0055526_100210811 460
249 3300003775 Ga0055524_1000196 Ga0055524_10001968 460
250 3300003781 Ga0055536_1000022 Ga0055536_100002272 460
251 3300003784 Ga0055534_1000270 Ga0055534_10002702 460
252 3300003784 Ga0055534_1001156 Ga0055534_10011563 460
253 3300003784 Ga0055534_1001272 Ga0055534_10012726 460
254 3300006948 Ga0099826_10000016 Ga0099826_1000001679 460
255 3300013307 Ga0157372_10000110 Ga0157372_1000011025 460
256 3300015261 Ga0182006_1000392 Ga0182006_100039210 460
257 3300025224 Ga0209784_100600 Ga0209784_1006003 460
258 3300025225 Ga0209566_100200 Ga0209566_10020032 460
259 3300025226 Ga0209674_100237 Ga0209674_10023736 460
260 3300025226 Ga0209674_101104 Ga0209674_1011045 460
261 3300025246 Ga0209646_1000075 Ga0209646_100007518 460
262 3300025254 Ga0209148_1000043 Ga0209148_1000043166 460
263 3300025256 Ga0209759_1001195 Ga0209759_10011953 460
264 3300025256 Ga0209759_1002513 Ga0209759_10025137 460
265 3300025263 Ga0209565_1000368 Ga0209565_10003688 460
266 3300025263 Ga0209565_1005164 Ga0209565_10051641 460
267 3300025291 Ga0209675_1000070 Ga0209675_100007033 460
268 3300025291 Ga0209675_1000383 Ga0209675_10003832 460
269 3300025291 Ga0209675_1000389 Ga0209675_10003892 460
270 3300025292 Ga0209676_1000012 Ga0209676_1000012604 460
271 3300025294 Ga0209025_1000124 Ga0209025_1000124108 460
272 3300025294 Ga0209025_1000504 Ga0209025_100050417 460
273 3300025294 Ga0209025_1000788 Ga0209025_10007888 460
274 3300025294 Ga0209025_1001088 Ga0209025_100108836 460
275 3300025294 Ga0209025_1017948 Ga0209025_10179482 460
276 3300025295 Ga0209564_1000350 Ga0209564_100035040 460
277 3300025295 Ga0209564_1000380 Ga0209564_100038033 460
278 3300025295 Ga0209564_1000497 Ga0209564_10004978 460
279 3300025299 Ga0209256_1000059 Ga0209256_1000059184 460
280 3300025299 Ga0209256_1000842 Ga0209256_100084229 460
281 3300025303 Ga0209051_1004630 Ga0209051_10046302 460
282 3300025303 Ga0209051_1019161 Ga0209051_10191613 460
283 3300027666 Ga0209282_1000064 Ga0209282_100006432 460
284 3300028800 Ga0265338_10000110 Ga0265338_1000011084 460
285 3300037418 Ga0395900_0002152 Ga0395900_0002152_14874_16262 460
286 3300044693 Ga0466961_0000028 Ga0466961_0000028_19508_20896 460
287 3300046500 Ga0495596_0000048 Ga0495596_0000048_52267_53652 460
288 3300046513 Ga0495616_0001671 Ga0495616_0001671_6135_7520 460
289 3300046692 Ga0495671_0000298 Ga0495671_0000298_15581_16966 460
290 3300046694 Ga0495649_0019811 Ga0495649_0019811_128_1513 460
291 3300047320 Ga0495672_0007240 Ga0495672_0007240_5287_6672 460
292 3300048924 Ga0496121_0009543 Ga0496121_0009543_811_2196 460
293 3300048925 Ga0496122_0001209 Ga0496122_0001209_32779_34164 460
294 3300048926 Ga0496123_0001776 Ga0496123_0001776_10661_12046 460
295 3300049571 Ga0501034_0000169 Ga0501034_0000169_93023_94408 460
296 3300053148 Ga0500590_028942 Ga0500590_028942_913_2295 460
297 iso_pu_bacteria 2501025501 2501071209 460
298 iso_pu_bacteria 2501025502 2501078639 460
299 iso_pu_bacteria 2501025504 2501414089 460
300 iso_pu_bacteria 2508501125 2509127464 460
301 iso_pu_bacteria 2510065045 2510250139 460
302 iso_pu_bacteria 2510917013 2511089287 460
303 iso_pu_bacteria 2510917014 2511094654 460
304 iso_pu_bacteria 2510917015 2511104358 460
305 iso_pu_bacteria 2513237082 2513557327 460
306 iso_pu_bacteria 2513237083 2513565556 460
307 iso_pu_bacteria 2513237151 2513962168 460
308 iso_pu_bacteria 2513237166 2514046484 460
309 iso_pu_bacteria 2515154189 2516024518 460
310 iso_pu_bacteria 2519103095 2519458025 460
311 iso_pu_bacteria 2526164713 2527076829 460
312 iso_pu_bacteria 2562617112 2563062156 460
313 iso_pu_bacteria 2599185239 2599739320 460
314 iso_pu_bacteria 2600255067 2600812628 460
315 iso_pu_bacteria 2711768613 2713477995 460
316 iso_pu_bacteria 2718217991 2719639297 460
317 iso_pu_bacteria 2721755763 2723876494 460
318 iso_pu_bacteria 2738541296 2738819920 460
319 iso_pu_bacteria 2738541298 2738832400 460
320 iso_pu_bacteria 2738541306 2738873927 460
321 iso_pu_bacteria 2738543002 2739185557 460
322 iso_pu_bacteria 2738543008 2739220525 460
323 iso_pu_bacteria 2744054900 2746092044 460
324 iso_pu_bacteria 2744054901 2746093637 460
325 iso_pu_bacteria 2751185846 2753566000 460
326 iso_pu_bacteria 2808606384 2808972176 460
327 iso_pu_bacteria 2808606390 2809006906 460
328 iso_pu_bacteria 2808606391 2809014044 460
329 iso_pu_bacteria 2816332253 2817260189 460
330 iso_pu_bacteria 2816332256 2817277856 460
331 iso_pu_bacteria 2818991450 2819621043 460
332 iso_pu_bacteria 2818991452 2819632703 460
333 iso_pu_bacteria 2842324504 2842331171 460
334 iso_pu_bacteria 2842348783 2842355510 460
335 iso_pu_bacteria 2842454564 2842457891 460
336 iso_pu_bacteria 2856287931 2856291587 460
337 iso_pu_bacteria 2857357740 2857364645 460
338 iso_pu_bacteria 2883087390 2883093850 460
339 iso_pu_bacteria 2900634093 2900636046 460
340 iso_pu_bacteria 2904483920 2904484150 460
341 iso_pu_bacteria 2919527303 2919530092 460
342 iso_pu_bacteria 2928108538 2928109846 460
343 iso_pu_bacteria 2928135762 2928136699 460
344 iso_pu_bacteria 2928157003 2928159706 460
345 iso_pu_bacteria 2928163908 2928164240 460
346 iso_pu_bacteria 2928503688 2928508921 460
347 iso_pu_bacteria 2945934425 2945935715 460
348 iso_pu_bacteria 2981990288 2981994147 460
349 iso_pu_bacteria 2990703756 2990710372 460
350 iso_pu_bacteria 641736151 642422895 460
351 iso_pu_bacteria 641736154 642415770 460
352 iso_pu_bacteria 642555112 642594058 460
353 iso_pu_bacteria 642555113 642620480 460
354 iso_pu_bacteria 8003955200 8003961832 460
355 iso_pu_bacteria 8018845410 8018849958 460
356 iso_pu_bacteria 8021120328 8021122593 460
357 iso_pu_bacteria 8039098773 8039099329 460
358 iso_pu_bacteria 8055266321 8055266533 460
359 iso_pu_bacteria 8055301274 8055305060 460
360 3300001990 JGI24737J22298_10028436 JGI24737J22298_100284362 464
361 3300002075 JGI24738J21930_10002378 JGI24738J21930_100023784 464
362 3300002705 JGI25156J39149_1000337 JGI25156J39149_100033725 464
363 3300002705 JGI25156J39149_1000568 JGI25156J39149_100056817 464
364 3300003214 JGI25165J46597_1001162 JGI25165J46597_10011628 464
365 3300003756 Ga0055533_1000124 Ga0055533_100012454 464
366 3300003756 Ga0055533_1000956 Ga0055533_10009563 464
367 3300003758 Ga0055532_1000001 Ga0055532_1000001774 464
368 3300003758 Ga0055532_1002673 Ga0055532_10026732 464
369 3300003760 Ga0055527_1000014 Ga0055527_1000014240 464
370 3300003761 Ga0055535_1000001 Ga0055535_1000001231 464
371 3300003762 Ga0055542_1000001 Ga0055542_1000001773 464
372 3300003763 Ga0055529_1000001 Ga0055529_1000001231 464
373 3300003763 Ga0055529_1001481 Ga0055529_10014815 464
374 3300005262 Ga0065165_1000791 Ga0065165_100079139 464
375 3300005327 Ga0070658_10026186 Ga0070658_100261863 464
376 3300005339 Ga0070660_100000008 Ga0070660_10000000890 464
377 3300005339 Ga0070660_100049661 Ga0070660_1000496612 464
378 3300005344 Ga0070661_100099874 Ga0070661_1000998742 464
379 3300005366 Ga0070659_100000729 Ga0070659_10000072917 464
380 3300005367 Ga0070667_100159659 Ga0070667_1001596592 464
381 3300005455 Ga0070663_100001124 Ga0070663_1000011248 464
382 3300005563 Ga0068855_100014208 Ga0068855_1000142087 464
383 3300005563 Ga0068855_100074562 Ga0068855_1000745623 464
384 3300005564 Ga0070664_100116376 Ga0070664_1001163763 464
385 3300009011 Ga0105251_10000405 Ga0105251_1000040523 464
386 3300009011 Ga0105251_10001416 Ga0105251_100014161 464
387 3300009093 Ga0105240_10018939 Ga0105240_100189393 464
388 3300009093 Ga0105240_10035383 Ga0105240_100353836 464
389 3300009545 Ga0105237_10064744 Ga0105237_100647442 464
390 3300010375 Ga0105239_10006669 Ga0105239_100066697 464
391 3300013100 Ga0157373_10033545 Ga0157373_100335452 464
392 3300013104 Ga0157370_10005421 Ga0157370_1000542113 464
393 3300013104 Ga0157370_10008752 Ga0157370_100087522 464
394 3300013104 Ga0157370_10162085 Ga0157370_101620852 464
395 3300013105 Ga0157369_10000138 Ga0157369_1000013878 464
396 3300013105 Ga0157369_10014085 Ga0157369_100140858 464
397 3300013296 Ga0157374_10000102 Ga0157374_1000010265 464
398 3300013296 Ga0157374_10054480 Ga0157374_100544801 464
399 3300013306 Ga0163162_10051114 Ga0163162_100511142 464
400 3300013307 Ga0157372_10150389 Ga0157372_101503893 464
401 3300013308 Ga0157375_10034775 Ga0157375_100347754 464
402 3300015262 Ga0182007_10002938 Ga0182007_100029386 464
403 3300016635 Ga0183361_10018 Ga0183361_10018114 464
404 3300020069 Ga0197907_10105477 Ga0197907_101054772 464
405 3300020081 Ga0206354_11066516 Ga0206354_110665162 464
406 3300022467 Ga0224712_10003832 Ga0224712_100038323 464
407 3300025226 Ga0209674_100005 Ga0209674_1000051202 464
408 3300025226 Ga0209674_100150 Ga0209674_10015051 464
409 3300025228 Ga0209672_100001 Ga0209672_1000011603 464
410 3300025228 Ga0209672_100532 Ga0209672_1005327 464
411 3300025229 Ga0209147_100001 Ga0209147_1000011603 464
412 3300025229 Ga0209147_100378 Ga0209147_10037825 464
413 3300025230 Ga0209563_100794 Ga0209563_1007947 464
414 3300025231 Ga0207427_103643 Ga0207427_1036432 464
415 3300025242 Ga0209258_100001 Ga0209258_1000011603 464
416 3300025254 Ga0209148_1000003 Ga0209148_10000031603 464
417 3300025256 Ga0209759_1000228 Ga0209759_100022846 464
418 3300025256 Ga0209759_1000275 Ga0209759_100027531 464
419 3300025256 Ga0209759_1000879 Ga0209759_10008793 464
420 3300025256 Ga0209759_1002243 Ga0209759_10022433 464
421 3300025261 Ga0209233_1000016 Ga0209233_1000016565 464
422 3300025272 Ga0209455_1000001 Ga0209455_10000011603 464
423 3300025284 Ga0209130_1007352 Ga0209130_10073521 464
424 3300025302 Ga0207426_1000305 Ga0207426_10003052 464
425 3300025735 Ga0207713_1001376 Ga0207713_100137615 464
426 3300025904 Ga0207647_10000214 Ga0207647_100002142 464
427 3300025904 Ga0207647_10011603 Ga0207647_100116035 464
428 3300025904 Ga0207647_10025243 Ga0207647_100252433 464
429 3300025909 Ga0207705_10011384 Ga0207705_100113844 464
430 3300025909 Ga0207705_10016417 Ga0207705_100164173 464
431 3300025914 Ga0207671_10006819 Ga0207671_100068197 464
432 3300025914 Ga0207671_10058846 Ga0207671_100588462 464
433 3300025919 Ga0207657_10000018 Ga0207657_1000001838 464
434 3300025919 Ga0207657_10013915 Ga0207657_100139158 464
435 3300025920 Ga0207649_10031429 Ga0207649_100314293 464
436 3300025924 Ga0207694_10062186 Ga0207694_100621862 464
437 3300025932 Ga0207690_10000006 Ga0207690_1000000690 464
438 3300025949 Ga0207667_10000427 Ga0207667_100004272 464
439 3300025986 Ga0207658_10093471 Ga0207658_100934712 464
440 3300026067 Ga0207678_10000110 Ga0207678_1000011042 464
441 3300026142 Ga0207698_10008605 Ga0207698_100086054 464
442 3300031731 Ga0307405_10013096 Ga0307405_100130962 464
443 3300031911 Ga0307412_10000005 Ga0307412_1000000538 464
444 3300031911 Ga0307412_10078267 Ga0307412_100782671 464
445 3300032002 Ga0307416_100036132 Ga0307416_1000361322 464
446 3300037312 Ga0395899_0000008 Ga0395899_0000008_88597_89991 464
447 3300037418 Ga0395900_0063136 Ga0395900_0063136_1548_2942 464
448 3300037466 Ga0395898_0000072 Ga0395898_0000072_125906_127300 464
449 3300037466 Ga0395898_0007569 Ga0395898_0007569_8632_10026 464
450 3300037471 Ga0395905_0000012 Ga0395905_0000012_336875_338269 464
451 3300038443 Ga0395901_0000003 Ga0395901_0000003_256295_257689 464
452 3300038443 Ga0395901_0000154 Ga0395901_0000154_16009_17403 464
453 3300042005 Ga0439448_0005240 Ga0439448_0005240_1322_2716 464
454 3300044684 Ga0466966_0000008 Ga0466966_0000008_25770_27164 464
455 3300044693 Ga0466961_0025766 Ga0466961_0025766_2322_3722 464
456 3300046454 Ga0495592_0008737 Ga0495592_0008737_6023_7417 464
457 3300046455 Ga0495603_0035874 Ga0495603_0035874_808_2202 464
458 3300046455 Ga0495603_0053825 Ga0495603_0053825_422_1816 464
459 3300046458 Ga0495591_001099 Ga0495591_001099_12828_14222 464
460 3300046459 Ga0495629_0000099 Ga0495629_0000099_40507_41901 464
461 3300046459 Ga0495629_0001848 Ga0495629_0001848_8032_9438 464
462 3300046459 Ga0495629_0007335 Ga0495629_0007335_3593_4987 464
463 3300046459 Ga0495629_0016933 Ga0495629_0016933_1619_3013 464
464 3300046460 Ga0495638_0004081 Ga0495638_0004081_2615_4021 464
465 3300046462 Ga0495651_0008059 Ga0495651_0008059_4248_5642 464
466 3300046463 Ga0495653_0003639 Ga0495653_0003639_3369_4763 464
467 3300046463 Ga0495653_0018658 Ga0495653_0018658_4160_5554 464
468 3300046463 Ga0495653_0025481 Ga0495653_0025481_86_1480 464
469 3300046463 Ga0495653_0162930 Ga0495653_0162930_23_1417 464
470 3300046471 Ga0495650_0002455 Ga0495650_0002455_13448_14842 464
471 3300046471 Ga0495650_0003189 Ga0495650_0003189_2621_4015 464
472 3300046471 Ga0495650_0007872 Ga0495650_0007872_419_1825 464
473 3300046471 Ga0495650_0015323 Ga0495650_0015323_59_1453 464
474 3300046471 Ga0495650_0036830 Ga0495650_0036830_255_1649 464
475 3300046472 Ga0495580_0006624 Ga0495580_0006624_4819_6213 464
476 3300046472 Ga0495580_0009216 Ga0495580_0009216_3770_5164 464
477 3300046472 Ga0495580_0049822 Ga0495580_0049822_394_1788 464
478 3300046472 Ga0495580_0134456 Ga0495580_0134456_295_1689 464
479 3300046474 Ga0495605_0002569 Ga0495605_0002569_4439_5845 464
480 3300046474 Ga0495605_0005175 Ga0495605_0005175_6014_7408 464
481 3300046477 Ga0495664_0000349 Ga0495664_0000349_6484_7878 464
482 3300046477 Ga0495664_0033708 Ga0495664_0033708_1430_2845 464
483 3300046477 Ga0495664_0041390 Ga0495664_0041390_1244_2638 464
484 3300046477 Ga0495664_0054077 Ga0495664_0054077_361_1755 464
485 3300046492 Ga0495585_0026189 Ga0495585_0026189_868_2274 464
486 3300046500 Ga0495596_0001254 Ga0495596_0001254_8605_9999 464
487 3300046506 Ga0495583_0003132 Ga0495583_0003132_8949_10343 464
488 3300046507 Ga0495606_0020913 Ga0495606_0020913_645_2039 464
489 3300046511 Ga0495608_0017474 Ga0495608_0017474_3533_4927 464
490 3300046512 Ga0495610_0004942 Ga0495610_0004942_4107_5501 464
491 3300046514 Ga0495618_0007880 Ga0495618_0007880_4216_5610 464
492 3300046514 Ga0495618_0015383 Ga0495618_0015383_2405_3799 464
493 3300046516 Ga0495628_0016162 Ga0495628_0016162_2616_4010 464
494 3300046517 Ga0495630_0014647 Ga0495630_0014647_4241_5635 464
495 3300046524 Ga0495648_0020738 Ga0495648_0020738_770_2164 464
496 3300046524 Ga0495648_0026735 Ga0495648_0026735_769_2163 464
497 3300046524 Ga0495648_0050272 Ga0495648_0050272_374_1768 464
498 3300046526 Ga0495666_0003464 Ga0495666_0003464_4180_5574 464
499 3300046526 Ga0495666_0004621 Ga0495666_0004621_1076_2470 464
500 3300046526 Ga0495666_0011094 Ga0495666_0011094_2370_3764 464
501 3300046529 Ga0495652_0040394 Ga0495652_0040394_394_1788 464
502 3300046530 Ga0495654_0061314 Ga0495654_0061314_184_1590 464
503 3300046533 Ga0495640_0002986 Ga0495640_0002986_6468_7862 464
504 3300046533 Ga0495640_0048205 Ga0495640_0048205_317_1711 464
505 3300046543 Ga0495645_0001683 Ga0495645_0001683_3135_4529 464
506 3300046557 Ga0495622_0000880 Ga0495622_0000880_7152_8546 464
507 3300046557 Ga0495622_0018803 Ga0495622_0018803_1034_2428 464
508 3300046559 Ga0495667_0032052 Ga0495667_0032052_95_1501 464
509 3300046642 Ga0495634_0004092 Ga0495634_0004092_3465_4859 464
510 3300046642 Ga0495634_0009265 Ga0495634_0009265_130_1524 464
511 3300046660 Ga0495625_0081073 Ga0495625_0081073_62_1456 464
512 3300046663 Ga0495635_0012758 Ga0495635_0012758_962_2356 464
513 3300046663 Ga0495635_0018948 Ga0495635_0018948_691_2085 464
514 3300046663 Ga0495635_0028210 Ga0495635_0028210_320_1714 464
515 3300046665 Ga0495661_0001337 Ga0495661_0001337_14413_15807 464
516 3300046665 Ga0495661_0011631 Ga0495661_0011631_4404_5798 464
517 3300046674 Ga0495588_0051671 Ga0495588_0051671_45_1451 464
518 3300046675 Ga0495657_0050263 Ga0495657_0050263_381_1775 464
519 3300046678 Ga0495599_0016168 Ga0495599_0016168_2809_4203 464
520 3300046679 Ga0495623_0008796 Ga0495623_0008796_1697_3091 464
521 3300046680 Ga0495646_0001798 Ga0495646_0001798_10462_11856 464
522 3300046689 Ga0495613_0028123 Ga0495613_0028123_1074_2468 464
523 3300046689 Ga0495613_0037701 Ga0495613_0037701_1004_2398 464
524 3300046690 Ga0495624_0010339 Ga0495624_0010339_3672_5066 464
525 3300046690 Ga0495624_0019421 Ga0495624_0019421_2346_3740 464
526 3300046690 Ga0495624_0034551 Ga0495624_0034551_940_2334 464
527 3300046690 Ga0495624_0077654 Ga0495624_0077654_361_1755 464
528 3300046691 Ga0495670_0008646 Ga0495670_0008646_1501_2907 464
529 3300046692 Ga0495671_0006874 Ga0495671_0006874_738_2132 464
530 3300046794 Ga0495589_0000928 Ga0495589_0000928_14391_15785 464
531 3300046794 Ga0495589_0010014 Ga0495589_0010014_3083_4489 464
532 3300046794 Ga0495589_0049716 Ga0495589_0049716_85_1479 464
533 3300046809 Ga0495600_0001945 Ga0495600_0001945_6052_7446 464
534 3300047315 Ga0495581_0018968 Ga0495581_0018968_1336_2742 464
535 3300047317 Ga0495604_0006905 Ga0495604_0006905_5891_7285 464
536 3300047317 Ga0495604_0007838 Ga0495604_0007838_6485_7879 464
537 3300047319 Ga0495674_0079395 Ga0495674_0079395_1242_2657 464
538 3300047319 Ga0495674_0132611 Ga0495674_0132611_541_1935 464
539 3300047321 Ga0495676_0005874 Ga0495676_0005874_6567_7961 464
540 3300047321 Ga0495676_0020180 Ga0495676_0020180_190_1584 464
541 3300047322 Ga0495680_0052605 Ga0495680_0052605_774_2168 464
542 3300047323 Ga0495683_0002027 Ga0495683_0002027_10968_12368 464
543 3300047323 Ga0495683_0018507 Ga0495683_0018507_887_2281 464
544 3300047323 Ga0495683_0067460 Ga0495683_0067460_332_1726 464
545 3300047443 Ga0495687_000104 Ga0495687_000104_66276_67676 464
546 3300047443 Ga0495687_011819 Ga0495687_011819_355_1749 464
547 3300047443 Ga0495687_023572 Ga0495687_023572_1084_2478 464
548 3300047444 Ga0495675_0001679 Ga0495675_0001679_5632_7026 464
549 3300047444 Ga0495675_0023657 Ga0495675_0023657_2287_3681 464
550 3300047446 Ga0495679_000062 Ga0495679_000062_43455_44849 464
551 3300047469 Ga0495673_0027555 Ga0495673_0027555_503_1897 464
552 3300047471 Ga0495684_0031865 Ga0495684_0031865_233_1627 464
553 3300047471 Ga0495684_0183711 Ga0495684_0183711_65_1459 464
554 3300047472 Ga0495686_0000468 Ga0495686_0000468_58594_60009 464
555 3300047673 Ga0495593_0003580 Ga0495593_0003580_6305_7699 464
556 3300047673 Ga0495593_0007871 Ga0495593_0007871_3975_5369 464
557 3300047673 Ga0495593_0023731 Ga0495593_0023731_1013_2407 464
558 3300048088 Ga0495602_0000856 Ga0495602_0000856_8380_9774 464
559 3300048088 Ga0495602_0010590 Ga0495602_0010590_6339_7733 464
560 3300048088 Ga0495602_0076492 Ga0495602_0076492_699_2093 464
561 3300048089 Ga0495614_0024723 Ga0495614_0024723_91_1485 464
562 3300048089 Ga0495614_0033440 Ga0495614_0033440_138_1532 464
563 3300048089 Ga0495614_0033967 Ga0495614_0033967_776_2170 464
564 3300048091 Ga0495626_0016822 Ga0495626_0016822_165_1559 464
565 3300048903 Ga0496100_0068740 Ga0496100_0068740_128_1534 464
566 3300048903 Ga0496100_0104330 Ga0496100_0104330_374_1774 464
567 3300048904 Ga0496101_0080148 Ga0496101_0080148_815_2215 464
568 3300048905 Ga0496102_0144172 Ga0496102_0144172_112_1506 464
569 3300048905 Ga0496102_0153891 Ga0496102_0153891_657_2057 464
570 3300048905 Ga0496102_0174515 Ga0496102_0174515_545_1939 464
571 3300048906 Ga0496103_0030441 Ga0496103_0030441_1020_2414 464
572 3300048909 Ga0496106_0126753 Ga0496106_0126753_436_1836 464
573 3300048910 Ga0496107_0104139 Ga0496107_0104139_48_1454 464
574 3300048913 Ga0496110_0024587 Ga0496110_0024587_3538_4938 464
575 3300048914 Ga0496111_0054961 Ga0496111_0054961_931_2331 464
576 3300048916 Ga0496113_0121274 Ga0496113_0121274_465_1865 464
577 3300048917 Ga0496114_0006019 Ga0496114_0006019_7257_8663 464
578 3300048920 Ga0496117_0016090 Ga0496117_0016090_327_1721 464
579 3300048920 Ga0496117_0036972 Ga0496117_0036972_826_2220 464
580 3300048920 Ga0496117_0051740 Ga0496117_0051740_420_1814 464
581 3300048921 Ga0496118_0004252 Ga0496118_0004252_2720_4114 464
582 3300048921 Ga0496118_0013496 Ga0496118_0013496_4342_5736 464
583 3300048921 Ga0496118_0022383 Ga0496118_0022383_3598_4992 464
584 3300048921 Ga0496118_0024054 Ga0496118_0024054_2820_4214 464
585 3300048921 Ga0496118_0061389 Ga0496118_0061389_1022_2416 464
586 3300048922 Ga0496119_0057709 Ga0496119_0057709_460_1854 464
587 3300048924 Ga0496121_0000437 Ga0496121_0000437_78186_79580 464
588 3300048924 Ga0496121_0047186 Ga0496121_0047186_262_1656 464
589 3300048924 Ga0496121_0093773 Ga0496121_0093773_761_2161 464
590 3300048924 Ga0496121_0110339 Ga0496121_0110339_648_2042 464
591 3300048927 Ga0496124_0027531 Ga0496124_0027531_3146_4546 464
592 3300048929 Ga0496126_0000034 Ga0496126_0000034_48133_49548 464
593 3300048929 Ga0496126_0000882 Ga0496126_0000882_13673_15067 464
594 3300048929 Ga0496126_0006636 Ga0496126_0006636_2863_4257 464
595 iso_pu_bacteria 2519103095 2519463197 464
596 iso_pu_bacteria 2816332253 2817263425 464
597 iso_pu_bacteria 2816332256 2817276801 464

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

236

334

0.97

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

86

224

0.93

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

338

449

0.89

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

453

530

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p5g-assembly1.cif.gz_X enzyme-ligand complex of p. aeruginosa pmm/pgm 0.9809 5 464
2fkm-assembly1.cif.gz_X pmm/pgm s108d mutant with alpha-d-glucose 1,6-bisphosphate bound 0.979 3 464
3uw2-assembly1.cif.gz_A x-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis 0.9774 1 464
2fkm-assembly1.cif.gz_X pmm/pgm s108d mutant with alpha-d-glucose 1,6-bisphosphate bound 0.9769 3 464
3uw2-assembly1.cif.gz_A x-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis 0.9753 1 464
ID Description Score Start End Superfamily
1p5dX04 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9853 371 464 3.30.310.50
1k35A01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9772 5 155 3.40.120.10
1p5dX04 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9749 371 464 3.30.310.50
3rsmA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.971 20 155 3.40.120.10
1k35A03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9687 253 369 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A011P127-F1-model_v4 Phosphomannomutase/phosphoglucomutase (EC 5.4.2.2) 0.9969 267 464 GO:0004614
GO:0005975
AF-A0A6H3H9M6-F1-model_v4 deleted 0.9958 1 154
AF-F0G1Q5-F1-model_v4 Phosphomannomutase 0.9947 1 194 GO:0005975
GO:0016868
AF-A0A2N2S6X9-F1-model_v4 Phosphomannomutase/phosphoglucomutase (EC 5.4.2.2, EC 5.4.2.8) 0.9923 323 464 GO:0004614
GO:0004615
GO:0005975
AF-A0A7V8MXU0-F1-model_v4 deleted 0.9917 1 418

Feature Viewer

pLDDT pTM Quality
94.27 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map