F467626
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 597 | 372 | 506 | 462 |
Family's Representative Sequence
| Representative Sequence | 3300003756|Ga0055533_1000460|Ga0055533_10004601 |
| Length | 542 |
| Sequence | MTDARINLDEFANRRASSDSESDLLVTTVRMWCAFSQFNTNCNVPRAGSHRSEDVHPCASVLRGYDRHGLQLALYVGHPPMSSIHPTIFKAYDIRGIVGKTVDAETARLIGRAFGSAARAKGESAVVIGRDGRLSGPELLAALADGLRASGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDYNGFKMVLAGQAIYGDQIQALRTRIGQGDFTEGAGYYVQVDIRQQYIDRIISDVKLSRPMKIAVDCGNGVAGAFAPELFRAMGCEVTELFCEVDGXFPNHHPDPAHVENLQXLVRTLQTTDCELGLAFDGDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRNPGGEIIFDVKCTGKLAPFIREHGGKATMWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEIVSRLADPSATLNALPNSHCTPELQLKCAEGESFDLLDKIKANATFAGAKEVNRIDGVRVEYEDGFGLARPSNTTPVVVMRFEADNDAAMARIQSEFRRVILAEKPDAQLPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 10 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 11 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 12 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 13 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 14 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 15 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 16 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 17 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 18 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 19 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 20 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 21 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 22 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 23 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 24 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 25 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 26 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 27 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 28 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 29 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 30 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 31 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 32 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 33 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 34 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 35 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 36 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 37 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 38 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 39 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 40 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 41 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 42 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 43 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 44 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 45 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 46 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 47 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 48 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 49 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 50 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 51 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 52 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 53 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 54 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 55 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 56 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 57 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 58 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 59 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 60 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 61 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 62 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 63 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 64 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 65 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 66 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 67 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 68 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 69 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 70 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 71 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 72 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 73 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 74 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 75 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 76 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 77 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 78 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 79 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 80 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 81 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 83 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 89 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 91 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 92 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 98 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 100 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 114 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 122 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 123 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 124 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 125 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 126 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 127 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 128 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 129 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 130 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 131 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 134 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 155 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 158 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 159 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 243 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 332 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 333 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 336 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 347 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 356 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 357 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 360 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 361 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 362 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 363 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 364 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 365 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 366 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 367 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 368 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 369 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 370 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 371 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 372 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.25 |
| Metatranscriptomes | 0.5 |
| Isolates | 15.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.39 |
| Nodule | 4.02 |
| Rhizoplane | 4.02 |
| Rhizosphere | 67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10028436 | 3300001990 | Bacteria | 1758 |
| 2 | JGI24738J21930_10002378 | 3300002075 | Bacteria | 4949 |
| 3 | JGI25156J39149_1000337 | 3300002705 | Bacteria | 30825 |
| 4 | JGI25156J39149_1000568 | 3300002705 | Bacteria | 21085 |
| 5 | JGI25156J39149_1000917 | 3300002705 | Bacteria | 14389 |
| 6 | JGI25154J39366_1000190 | 3300002738 | Bacteria | 45605 |
| 7 | JGI25151J46595_10000841 | 3300003187 | Bacteria | 24478 |
| 8 | JGI25165J46597_1001162 | 3300003214 | Bacteria | 16252 |
| 9 | Ga0055533_1000124 | 3300003756 | Bacteria | 87900 |
| 10 | Ga0055533_1000460 | 3300003756 | Bacteria | 15414 |
| 11 | Ga0055533_1000956 | 3300003756 | Bacteria | 8498 |
| 12 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 13 | Ga0055532_1002673 | 3300003758 | Bacteria | 3511 |
| 14 | Ga0055527_1000014 | 3300003760 | Bacteria | 289449 |
| 15 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 16 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 17 | Ga0055529_1000001 | 3300003763 | Bacteria | 826680 |
| 18 | Ga0055529_1001481 | 3300003763 | Bacteria | 6992 |
| 19 | Ga0055526_1000111 | 3300003771 | Bacteria | 71834 |
| 20 | Ga0055526_1002108 | 3300003771 | Bacteria | 13650 |
| 21 | Ga0055524_1000196 | 3300003775 | Bacteria | 66415 |
| 22 | Ga0055536_1000022 | 3300003781 | Bacteria | 198244 |
| 23 | Ga0055534_1000270 | 3300003784 | Bacteria | 35440 |
| 24 | Ga0055534_1001156 | 3300003784 | Bacteria | 11141 |
| 25 | Ga0055534_1001272 | 3300003784 | Bacteria | 10264 |
| 26 | Ga0065165_1000791 | 3300005262 | Bacteria | 42372 |
| 27 | Ga0070658_10007669 | 3300005327 | Bacteria | 8698 |
| 28 | Ga0070658_10026186 | 3300005327 | Bacteria | 4679 |
| 29 | Ga0070676_10064579 | 3300005328 | Bacteria | 2183 |
| 30 | Ga0070683_100015845 | 3300005329 | Bacteria | 6630 |
| 31 | Ga0070690_100012158 | 3300005330 | Bacteria | 5060 |
| 32 | Ga0070670_100006044 | 3300005331 | Bacteria | 10237 |
| 33 | Ga0070670_100006402 | 3300005331 | Bacteria | 9965 |
| 34 | Ga0070670_100055027 | 3300005331 | Bacteria | 3415 |
| 35 | Ga0068869_100000941 | 3300005334 | Bacteria | 16837 |
| 36 | Ga0068869_100001855 | 3300005334 | Bacteria | 12701 |
| 37 | Ga0070666_10013183 | 3300005335 | Bacteria | 5239 |
| 38 | Ga0068868_100007389 | 3300005338 | Bacteria | 7825 |
| 39 | Ga0070660_100000008 | 3300005339 | Bacteria | 155650 |
| 40 | Ga0070660_100049661 | 3300005339 | Bacteria | 3225 |
| 41 | Ga0070661_100002328 | 3300005344 | Bacteria | 13044 |
| 42 | Ga0070661_100018424 | 3300005344 | Bacteria | 4962 |
| 43 | Ga0070661_100099874 | 3300005344 | Bacteria | 2157 |
| 44 | Ga0070675_100016834 | 3300005354 | Bacteria | 5805 |
| 45 | Ga0070675_100040882 | 3300005354 | Bacteria | 3787 |
| 46 | Ga0070671_100012870 | 3300005355 | Bacteria | 6746 |
| 47 | Ga0070671_100018269 | 3300005355 | Bacteria | 5695 |
| 48 | Ga0070673_100014894 | 3300005364 | Bacteria | 5441 |
| 49 | Ga0070673_100068418 | 3300005364 | Bacteria | 2843 |
| 50 | Ga0070659_100000729 | 3300005366 | Bacteria | 23848 |
| 51 | Ga0070659_100080811 | 3300005366 | Bacteria | 2595 |
| 52 | Ga0070659_100107786 | 3300005366 | Bacteria | 2247 |
| 53 | Ga0070667_100003833 | 3300005367 | Bacteria | 12775 |
| 54 | Ga0070667_100159659 | 3300005367 | Bacteria | 1985 |
| 55 | Ga0070709_10001157 | 3300005434 | Bacteria | 14471 |
| 56 | Ga0070710_10009779 | 3300005437 | Bacteria | 4699 |
| 57 | Ga0070708_100000125 | 3300005445 | Bacteria | 52016 |
| 58 | Ga0070663_100001124 | 3300005455 | Bacteria | 14729 |
| 59 | Ga0070678_100006242 | 3300005456 | Bacteria | 6974 |
| 60 | Ga0070681_10000413 | 3300005458 | Bacteria | 34680 |
| 61 | Ga0068867_100005612 | 3300005459 | Bacteria | 8889 |
| 62 | Ga0068867_100014149 | 3300005459 | Bacteria | 5651 |
| 63 | Ga0068867_100245685 | 3300005459 | Bacteria | 1453 |
| 64 | Ga0070679_100003879 | 3300005530 | Bacteria | 13740 |
| 65 | Ga0070679_100019673 | 3300005530 | Bacteria | 6570 |
| 66 | Ga0070684_100314155 | 3300005535 | Bacteria | 1439 |
| 67 | Ga0070672_100004932 | 3300005543 | Bacteria | 8784 |
| 68 | Ga0070665_100010975 | 3300005548 | Bacteria | 9162 |
| 69 | Ga0070704_100231198 | 3300005549 | Bacteria | 1508 |
| 70 | Ga0068855_100014208 | 3300005563 | Bacteria | 9591 |
| 71 | Ga0068855_100029324 | 3300005563 | Bacteria | 6580 |
| 72 | Ga0068855_100074562 | 3300005563 | Bacteria | 3940 |
| 73 | Ga0070664_100015585 | 3300005564 | Bacteria | 6219 |
| 74 | Ga0070664_100116376 | 3300005564 | Bacteria | 2338 |
| 75 | Ga0068859_100004344 | 3300005617 | Bacteria | 14458 |
| 76 | Ga0068859_100043558 | 3300005617 | Bacteria | 4511 |
| 77 | Ga0068864_100026306 | 3300005618 | Bacteria | 4907 |
| 78 | Ga0068861_100000216 | 3300005719 | Bacteria | 30988 |
| 79 | Ga0068861_100098864 | 3300005719 | Bacteria | 2317 |
| 80 | Ga0068851_10032305 | 3300005834 | Bacteria | 2604 |
| 81 | Ga0068870_10002112 | 3300005840 | Bacteria | 8222 |
| 82 | Ga0068863_100012923 | 3300005841 | Bacteria | 8051 |
| 83 | Ga0068863_100026740 | 3300005841 | Bacteria | 5502 |
| 84 | Ga0068863_100077569 | 3300005841 | Bacteria | 3144 |
| 85 | Ga0068858_100002185 | 3300005842 | Bacteria | 19807 |
| 86 | Ga0068858_100032968 | 3300005842 | Bacteria | 4810 |
| 87 | Ga0068860_100004954 | 3300005843 | Bacteria | 13573 |
| 88 | Ga0068862_100002123 | 3300005844 | Bacteria | 17861 |
| 89 | Ga0075366_10084727 | 3300006195 | Bacteria | 1895 |
| 90 | Ga0097621_100008935 | 3300006237 | Bacteria | 7244 |
| 91 | Ga0097621_100090246 | 3300006237 | Bacteria | 2564 |
| 92 | Ga0097620_100004344 | 3300006931 | Bacteria | 14458 |
| 93 | Ga0097620_100043559 | 3300006931 | Bacteria | 4511 |
| 94 | Ga0099826_10000016 | 3300006948 | Bacteria | 210934 |
| 95 | Ga0105251_10000405 | 3300009011 | Bacteria | 42135 |
| 96 | Ga0105251_10001416 | 3300009011 | Bacteria | 20666 |
| 97 | Ga0105240_10018939 | 3300009093 | Bacteria | 9218 |
| 98 | Ga0105240_10035383 | 3300009093 | Bacteria | 6436 |
| 99 | Ga0105240_10206112 | 3300009093 | Bacteria | 2301 |
| 100 | Ga0111539_10036219 | 3300009094 | Bacteria | 5967 |
| 101 | Ga0105237_10064744 | 3300009545 | Bacteria | 3651 |
| 102 | Ga0105238_10029632 | 3300009551 | Bacteria | 5574 |
| 103 | Ga0105249_10198787 | 3300009553 | Bacteria | 1961 |
| 104 | Ga0105239_10006669 | 3300010375 | Bacteria | 13342 |
| 105 | Ga0105239_10233932 | 3300010375 | Bacteria | 2062 |
| 106 | Ga0157373_10013708 | 3300013100 | Bacteria | 5942 |
| 107 | Ga0157373_10033545 | 3300013100 | Bacteria | 3693 |
| 108 | Ga0157370_10002443 | 3300013104 | Bacteria | 22408 |
| 109 | Ga0157370_10005421 | 3300013104 | Bacteria | 14310 |
| 110 | Ga0157370_10005978 | 3300013104 | Bacteria | 13542 |
| 111 | Ga0157370_10008752 | 3300013104 | Bacteria | 10884 |
| 112 | Ga0157370_10162085 | 3300013104 | Bacteria | 2080 |
| 113 | Ga0157369_10000138 | 3300013105 | Bacteria | 102776 |
| 114 | Ga0157369_10014085 | 3300013105 | Bacteria | 9037 |
| 115 | Ga0157369_10114611 | 3300013105 | Bacteria | 2862 |
| 116 | Ga0157374_10000102 | 3300013296 | Bacteria | 78555 |
| 117 | Ga0157374_10054480 | 3300013296 | Bacteria | 3731 |
| 118 | Ga0157374_10108496 | 3300013296 | Bacteria | 2668 |
| 119 | Ga0157378_10076823 | 3300013297 | Bacteria | 3010 |
| 120 | Ga0157378_10187934 | 3300013297 | Bacteria | 1947 |
| 121 | Ga0163162_10051114 | 3300013306 | Bacteria | 4146 |
| 122 | Ga0157372_10000110 | 3300013307 | Bacteria | 86374 |
| 123 | Ga0157372_10129853 | 3300013307 | Bacteria | 2898 |
| 124 | Ga0157372_10150389 | 3300013307 | Bacteria | 2687 |
| 125 | Ga0157375_10034775 | 3300013308 | Bacteria | 4803 |
| 126 | Ga0163163_10006597 | 3300014325 | Bacteria | 10166 |
| 127 | Ga0163163_10277062 | 3300014325 | Bacteria | 1729 |
| 128 | Ga0157379_10000044 | 3300014968 | Bacteria | 75399 |
| 129 | Ga0157379_10006079 | 3300014968 | Bacteria | 10395 |
| 130 | Ga0182006_1000392 | 3300015261 | Bacteria | 35983 |
| 131 | Ga0182007_10000044 | 3300015262 | Bacteria | 106301 |
| 132 | Ga0182007_10002194 | 3300015262 | Bacteria | 9913 |
| 133 | Ga0182007_10002938 | 3300015262 | Bacteria | 8276 |
| 134 | Ga0182005_1000032 | 3300015265 | Bacteria | 188517 |
| 135 | Ga0183361_10018 | 3300016635 | Bacteria | 133279 |
| 136 | Ga0197907_10105477 | 3300020069 | Bacteria | 1876 |
| 137 | Ga0206354_11066516 | 3300020081 | Bacteria | 1966 |
| 138 | Ga0213872_10007875 | 3300021361 | Bacteria | 5200 |
| 139 | Ga0213876_10050204 | 3300021384 | Bacteria | 2204 |
| 140 | Ga0224712_10003832 | 3300022467 | Bacteria | 3971 |
| 141 | Ga0209784_100600 | 3300025224 | Bacteria | 11831 |
| 142 | Ga0209566_100200 | 3300025225 | Bacteria | 61991 |
| 143 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 144 | Ga0209674_100150 | 3300025226 | Bacteria | 96511 |
| 145 | Ga0209674_100237 | 3300025226 | Bacteria | 47803 |
| 146 | Ga0209674_101104 | 3300025226 | Bacteria | 7979 |
| 147 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 148 | Ga0209672_100532 | 3300025228 | Bacteria | 20804 |
| 149 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 150 | Ga0209147_100378 | 3300025229 | Bacteria | 30960 |
| 151 | Ga0209563_100794 | 3300025230 | Bacteria | 9503 |
| 152 | Ga0207427_103643 | 3300025231 | Bacteria | 3085 |
| 153 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 154 | Ga0209646_1000075 | 3300025246 | Bacteria | 221755 |
| 155 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 156 | Ga0209148_1000043 | 3300025254 | Bacteria | 461531 |
| 157 | Ga0209759_1000228 | 3300025256 | Bacteria | 84202 |
| 158 | Ga0209759_1000275 | 3300025256 | Bacteria | 72571 |
| 159 | Ga0209759_1000879 | 3300025256 | Bacteria | 22944 |
| 160 | Ga0209759_1001195 | 3300025256 | Bacteria | 16189 |
| 161 | Ga0209759_1002243 | 3300025256 | Bacteria | 8800 |
| 162 | Ga0209759_1002513 | 3300025256 | Bacteria | 7995 |
| 163 | Ga0209233_1000016 | 3300025261 | Bacteria | 907830 |
| 164 | Ga0209565_1000368 | 3300025263 | Bacteria | 38635 |
| 165 | Ga0209565_1005164 | 3300025263 | Bacteria | 3838 |
| 166 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 167 | Ga0209130_1007352 | 3300025284 | Bacteria | 3411 |
| 168 | Ga0209675_1000070 | 3300025291 | Bacteria | 169161 |
| 169 | Ga0209675_1000383 | 3300025291 | Bacteria | 36811 |
| 170 | Ga0209675_1000389 | 3300025291 | Bacteria | 36614 |
| 171 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 172 | Ga0209025_1000124 | 3300025294 | Bacteria | 201973 |
| 173 | Ga0209025_1000504 | 3300025294 | Bacteria | 75030 |
| 174 | Ga0209025_1000788 | 3300025294 | Bacteria | 51988 |
| 175 | Ga0209025_1001088 | 3300025294 | Bacteria | 39306 |
| 176 | Ga0209025_1017948 | 3300025294 | Bacteria | 4051 |
| 177 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 178 | Ga0209564_1000350 | 3300025295 | Bacteria | 86762 |
| 179 | Ga0209564_1000380 | 3300025295 | Bacteria | 81287 |
| 180 | Ga0209564_1000497 | 3300025295 | Bacteria | 64942 |
| 181 | Ga0209256_1000059 | 3300025299 | Bacteria | 272170 |
| 182 | Ga0209256_1000842 | 3300025299 | Bacteria | 38479 |
| 183 | Ga0207426_1000305 | 3300025302 | Bacteria | 96172 |
| 184 | Ga0209051_1004630 | 3300025303 | Bacteria | 8377 |
| 185 | Ga0209051_1019161 | 3300025303 | Bacteria | 2998 |
| 186 | Ga0207697_10004914 | 3300025315 | Bacteria | 6300 |
| 187 | Ga0207713_1001376 | 3300025735 | Bacteria | 19744 |
| 188 | Ga0207682_10037324 | 3300025893 | Bacteria | 1968 |
| 189 | Ga0207647_10000214 | 3300025904 | Bacteria | 47271 |
| 190 | Ga0207647_10011603 | 3300025904 | Bacteria | 6171 |
| 191 | Ga0207647_10025243 | 3300025904 | Bacteria | 3908 |
| 192 | Ga0207699_10061523 | 3300025906 | Bacteria | 2259 |
| 193 | Ga0207645_10007275 | 3300025907 | Bacteria | 7829 |
| 194 | Ga0207643_10015015 | 3300025908 | Bacteria | 4213 |
| 195 | Ga0207705_10011384 | 3300025909 | Bacteria | 6441 |
| 196 | Ga0207705_10016417 | 3300025909 | Bacteria | 5307 |
| 197 | Ga0207705_10067174 | 3300025909 | Bacteria | 2594 |
| 198 | Ga0207707_10003209 | 3300025912 | Bacteria | 14520 |
| 199 | Ga0207671_10006819 | 3300025914 | Bacteria | 10090 |
| 200 | Ga0207671_10058846 | 3300025914 | Bacteria | 2849 |
| 201 | Ga0207657_10000018 | 3300025919 | Bacteria | 172140 |
| 202 | Ga0207657_10013915 | 3300025919 | Bacteria | 7872 |
| 203 | Ga0207649_10031429 | 3300025920 | Bacteria | 3155 |
| 204 | Ga0207652_10039036 | 3300025921 | Bacteria | 4028 |
| 205 | Ga0207681_10121885 | 3300025923 | Bacteria | 1913 |
| 206 | Ga0207694_10062186 | 3300025924 | Bacteria | 2907 |
| 207 | Ga0207650_10005000 | 3300025925 | Bacteria | 9056 |
| 208 | Ga0207650_10076039 | 3300025925 | Bacteria | 2536 |
| 209 | Ga0207659_10038111 | 3300025926 | Bacteria | 3341 |
| 210 | Ga0207644_10007835 | 3300025931 | Bacteria | 6977 |
| 211 | Ga0207644_10031728 | 3300025931 | Bacteria | 3683 |
| 212 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 213 | Ga0207690_10020114 | 3300025932 | Bacteria | 4120 |
| 214 | Ga0207669_10005389 | 3300025937 | Bacteria | 5736 |
| 215 | Ga0207669_10009058 | 3300025937 | Bacteria | 4716 |
| 216 | Ga0207691_10001229 | 3300025940 | Bacteria | 25531 |
| 217 | Ga0207691_10041561 | 3300025940 | Bacteria | 4244 |
| 218 | Ga0207691_10116517 | 3300025940 | Bacteria | 2371 |
| 219 | Ga0207689_10002193 | 3300025942 | Bacteria | 18314 |
| 220 | Ga0207689_10002241 | 3300025942 | Bacteria | 18109 |
| 221 | Ga0207679_10061329 | 3300025945 | Bacteria | 2799 |
| 222 | Ga0207667_10000427 | 3300025949 | Bacteria | 56780 |
| 223 | Ga0207651_10008322 | 3300025960 | Bacteria | 5596 |
| 224 | Ga0207651_10022147 | 3300025960 | Bacteria | 3878 |
| 225 | Ga0207668_10010999 | 3300025972 | Bacteria | 5488 |
| 226 | Ga0207668_10033022 | 3300025972 | Bacteria | 3426 |
| 227 | Ga0207640_10009199 | 3300025981 | Bacteria | 5522 |
| 228 | Ga0207658_10001631 | 3300025986 | Bacteria | 17206 |
| 229 | Ga0207658_10004585 | 3300025986 | Bacteria | 9593 |
| 230 | Ga0207658_10008086 | 3300025986 | Bacteria | 7164 |
| 231 | Ga0207658_10093471 | 3300025986 | Bacteria | 2338 |
| 232 | Ga0207677_10137926 | 3300026023 | Bacteria | 1863 |
| 233 | Ga0207703_10001245 | 3300026035 | Bacteria | 23856 |
| 234 | Ga0207678_10000110 | 3300026067 | Bacteria | 67527 |
| 235 | Ga0207678_10255420 | 3300026067 | Bacteria | 1501 |
| 236 | Ga0207648_10000885 | 3300026089 | Bacteria | 33754 |
| 237 | Ga0207674_10029280 | 3300026116 | Bacteria | 5799 |
| 238 | Ga0207675_100000672 | 3300026118 | Bacteria | 33681 |
| 239 | Ga0207675_100031843 | 3300026118 | Bacteria | 4913 |
| 240 | Ga0207675_100052151 | 3300026118 | Bacteria | 3817 |
| 241 | Ga0207683_10001347 | 3300026121 | Bacteria | 22165 |
| 242 | Ga0207683_10005836 | 3300026121 | Bacteria | 10556 |
| 243 | Ga0207698_10008605 | 3300026142 | Bacteria | 6466 |
| 244 | Ga0207698_10067021 | 3300026142 | Bacteria | 2829 |
| 245 | Ga0209282_1000064 | 3300027666 | Bacteria | 91973 |
| 246 | Ga0209974_10022346 | 3300027876 | Bacteria | 2095 |
| 247 | Ga0207428_10023424 | 3300027907 | Bacteria | 5192 |
| 248 | Ga0268266_10021579 | 3300028379 | Bacteria | 5485 |
| 249 | Ga0268265_10002148 | 3300028380 | Bacteria | 15266 |
| 250 | Ga0268265_10068297 | 3300028380 | Bacteria | 2755 |
| 251 | Ga0268265_10100368 | 3300028380 | Bacteria | 2336 |
| 252 | Ga0268264_10001103 | 3300028381 | Bacteria | 26672 |
| 253 | Ga0268264_10010915 | 3300028381 | Bacteria | 7506 |
| 254 | Ga0265338_10000110 | 3300028800 | Bacteria | 152188 |
| 255 | Ga0265330_10016511 | 3300031235 | Bacteria | 3405 |
| 256 | Ga0265327_10000295 | 3300031251 | Bacteria | 96706 |
| 257 | Ga0307405_10013096 | 3300031731 | Bacteria | 4415 |
| 258 | Ga0307413_10020648 | 3300031824 | Bacteria | 3509 |
| 259 | Ga0307410_10042294 | 3300031852 | Bacteria | 3011 |
| 260 | Ga0307412_10000005 | 3300031911 | Bacteria | 526194 |
| 261 | Ga0307412_10078267 | 3300031911 | Bacteria | 2277 |
| 262 | Ga0307416_100036132 | 3300032002 | Bacteria | 3785 |
| 263 | Ga0307415_100018206 | 3300032126 | Bacteria | 4235 |
| 264 | Ga0373941_0023471 | 3300035115 | Bacteria | 1762 |
| 265 | Ga0316582_0001945 | 3300036647 | Bacteria | 9436 |
| 266 | Ga0316584_0017192 | 3300036712 | Bacteria | 5195 |
| 267 | Ga0395899_0000008 | 3300037312 | Bacteria | 567572 |
| 268 | Ga0395900_0002152 | 3300037418 | Bacteria | 22040 |
| 269 | Ga0395900_0063136 | 3300037418 | Bacteria | 3807 |
| 270 | Ga0395898_0000072 | 3300037466 | Bacteria | 249505 |
| 271 | Ga0395898_0007569 | 3300037466 | Bacteria | 11528 |
| 272 | Ga0395905_0000012 | 3300037471 | Bacteria | 420861 |
| 273 | Ga0395901_0000003 | 3300038443 | Bacteria | 701538 |
| 274 | Ga0395901_0000154 | 3300038443 | Bacteria | 89750 |
| 275 | Ga0395901_0030143 | 3300038443 | Bacteria | 5588 |
| 276 | Ga0436361_0215157 | 3300039447 | Bacteria | 166868 |
| 277 | Ga0436361_0653615 | 3300039447 | Bacteria | 11602 |
| 278 | Ga0436361_0720947 | 3300039447 | Bacteria | 11429 |
| 279 | Ga0439448_0005240 | 3300042005 | Bacteria | 3692 |
| 280 | Ga0450904_000533 | 3300042139 | Bacteria | 7241 |
| 281 | Ga0451577_0116638 | 3300042876 | Bacteria | 2392 |
| 282 | Ga0453683_0009774 | 3300044673 | Bacteria | 6396 |
| 283 | Ga0453683_0013014 | 3300044673 | Bacteria | 5439 |
| 284 | Ga0466966_0000008 | 3300044684 | Bacteria | 155597 |
| 285 | Ga0466961_0000028 | 3300044693 | Bacteria | 86793 |
| 286 | Ga0466961_0025766 | 3300044693 | Bacteria | 3780 |
| 287 | Ga0453684_0001452 | 3300044712 | Bacteria | 67372 |
| 288 | Ga0453684_0003292 | 3300044712 | Bacteria | 36816 |
| 289 | Ga0453684_0059857 | 3300044712 | Bacteria | 4905 |
| 290 | Ga0453684_0085184 | 3300044712 | Bacteria | 3927 |
| 291 | Ga0466968_0000016 | 3300044735 | Bacteria | 50013 |
| 292 | Ga0451576_0000335 | 3300045051 | Bacteria | 113806 |
| 293 | Ga0451576_0016196 | 3300045051 | Bacteria | 8236 |
| 294 | Ga0451576_0040985 | 3300045051 | Bacteria | 4896 |
| 295 | Ga0466958_0038185 | 3300045836 | Bacteria | 2881 |
| 296 | Ga0495627_000016 | 3300046453 | Bacteria | 318947 |
| 297 | Ga0495592_0008737 | 3300046454 | Bacteria | 7605 |
| 298 | Ga0495603_0035874 | 3300046455 | Bacteria | 2977 |
| 299 | Ga0495603_0053825 | 3300046455 | Bacteria | 2387 |
| 300 | Ga0495591_001099 | 3300046458 | Bacteria | 18000 |
| 301 | Ga0495629_0000099 | 3300046459 | Bacteria | 75956 |
| 302 | Ga0495629_0001848 | 3300046459 | Bacteria | 16586 |
| 303 | Ga0495629_0007335 | 3300046459 | Bacteria | 8126 |
| 304 | Ga0495629_0016933 | 3300046459 | Bacteria | 5230 |
| 305 | Ga0495638_0004081 | 3300046460 | Bacteria | 11185 |
| 306 | Ga0495638_0014717 | 3300046460 | Bacteria | 5276 |
| 307 | Ga0495651_0008059 | 3300046462 | Bacteria | 8078 |
| 308 | Ga0495653_0003639 | 3300046463 | Bacteria | 12432 |
| 309 | Ga0495653_0006523 | 3300046463 | Bacteria | 9574 |
| 310 | Ga0495653_0018658 | 3300046463 | Bacteria | 5632 |
| 311 | Ga0495653_0025481 | 3300046463 | Bacteria | 4752 |
| 312 | Ga0495653_0162930 | 3300046463 | Bacteria | 1546 |
| 313 | Ga0495650_0002455 | 3300046471 | Bacteria | 14954 |
| 314 | Ga0495650_0003189 | 3300046471 | Bacteria | 12218 |
| 315 | Ga0495650_0007872 | 3300046471 | Bacteria | 6329 |
| 316 | Ga0495650_0015323 | 3300046471 | Bacteria | 3936 |
| 317 | Ga0495650_0036830 | 3300046471 | Bacteria | 2136 |
| 318 | Ga0495580_0006624 | 3300046472 | Bacteria | 9409 |
| 319 | Ga0495580_0009216 | 3300046472 | Bacteria | 7778 |
| 320 | Ga0495580_0049822 | 3300046472 | Bacteria | 2962 |
| 321 | Ga0495580_0134456 | 3300046472 | Bacteria | 1714 |
| 322 | Ga0495605_0002569 | 3300046474 | Bacteria | 11163 |
| 323 | Ga0495605_0005175 | 3300046474 | Bacteria | 7598 |
| 324 | Ga0495664_0000349 | 3300046477 | Bacteria | 22440 |
| 325 | Ga0495664_0033708 | 3300046477 | Bacteria | 3011 |
| 326 | Ga0495664_0041390 | 3300046477 | Bacteria | 2726 |
| 327 | Ga0495664_0054077 | 3300046477 | Bacteria | 2387 |
| 328 | Ga0495584_0000022 | 3300046491 | Bacteria | 128471 |
| 329 | Ga0495585_0012983 | 3300046492 | Bacteria | 4892 |
| 330 | Ga0495585_0026189 | 3300046492 | Bacteria | 3332 |
| 331 | Ga0495596_0000048 | 3300046500 | Bacteria | 88427 |
| 332 | Ga0495596_0001254 | 3300046500 | Bacteria | 14780 |
| 333 | Ga0495607_0001625 | 3300046501 | Bacteria | 19476 |
| 334 | Ga0495583_0003132 | 3300046506 | Bacteria | 13051 |
| 335 | Ga0495606_0000690 | 3300046507 | Bacteria | 52411 |
| 336 | Ga0495606_0001324 | 3300046507 | Bacteria | 33820 |
| 337 | Ga0495606_0009012 | 3300046507 | Bacteria | 8529 |
| 338 | Ga0495606_0020913 | 3300046507 | Bacteria | 4806 |
| 339 | Ga0495608_0017474 | 3300046511 | Bacteria | 4961 |
| 340 | Ga0495610_0004942 | 3300046512 | Bacteria | 9664 |
| 341 | Ga0495616_0001671 | 3300046513 | Bacteria | 15156 |
| 342 | Ga0495618_0007880 | 3300046514 | Bacteria | 6446 |
| 343 | Ga0495618_0015383 | 3300046514 | Bacteria | 4669 |
| 344 | Ga0495628_0016162 | 3300046516 | Bacteria | 6226 |
| 345 | Ga0495630_0014647 | 3300046517 | Bacteria | 5716 |
| 346 | Ga0495648_0020738 | 3300046524 | Bacteria | 4573 |
| 347 | Ga0495648_0026735 | 3300046524 | Bacteria | 3878 |
| 348 | Ga0495648_0050272 | 3300046524 | Bacteria | 2548 |
| 349 | Ga0495666_0003464 | 3300046526 | Bacteria | 7966 |
| 350 | Ga0495666_0004621 | 3300046526 | Bacteria | 6963 |
| 351 | Ga0495666_0011094 | 3300046526 | Bacteria | 4495 |
| 352 | Ga0495652_0040394 | 3300046529 | Bacteria | 4032 |
| 353 | Ga0495654_0061314 | 3300046530 | Bacteria | 1806 |
| 354 | Ga0495640_0002986 | 3300046533 | Bacteria | 13619 |
| 355 | Ga0495640_0048205 | 3300046533 | Bacteria | 2945 |
| 356 | Ga0495609_0000263 | 3300046538 | Bacteria | 49427 |
| 357 | Ga0495645_0001683 | 3300046543 | Bacteria | 15021 |
| 358 | Ga0495622_0000880 | 3300046557 | Bacteria | 16384 |
| 359 | Ga0495622_0018803 | 3300046557 | Bacteria | 3218 |
| 360 | Ga0495633_0001345 | 3300046558 | Bacteria | 19254 |
| 361 | Ga0495667_0032052 | 3300046559 | Bacteria | 3524 |
| 362 | Ga0495634_0004092 | 3300046642 | Bacteria | 11550 |
| 363 | Ga0495634_0009265 | 3300046642 | Bacteria | 7268 |
| 364 | Ga0495625_0007904 | 3300046660 | Bacteria | 9150 |
| 365 | Ga0495625_0081073 | 3300046660 | Bacteria | 2259 |
| 366 | Ga0495625_0082058 | 3300046660 | Bacteria | 2243 |
| 367 | Ga0495635_0002165 | 3300046663 | Bacteria | 13343 |
| 368 | Ga0495635_0012758 | 3300046663 | Bacteria | 5888 |
| 369 | Ga0495635_0018948 | 3300046663 | Bacteria | 4803 |
| 370 | Ga0495635_0028210 | 3300046663 | Bacteria | 3901 |
| 371 | Ga0495661_0001337 | 3300046665 | Bacteria | 20907 |
| 372 | Ga0495661_0011631 | 3300046665 | Bacteria | 5966 |
| 373 | Ga0495588_0051671 | 3300046674 | Bacteria | 2117 |
| 374 | Ga0495657_0050263 | 3300046675 | Bacteria | 2803 |
| 375 | Ga0495599_0016168 | 3300046678 | Bacteria | 4631 |
| 376 | Ga0495623_0008796 | 3300046679 | Bacteria | 6552 |
| 377 | Ga0495646_0001798 | 3300046680 | Bacteria | 12872 |
| 378 | Ga0495613_0028123 | 3300046689 | Bacteria | 4183 |
| 379 | Ga0495613_0037701 | 3300046689 | Bacteria | 3583 |
| 380 | Ga0495624_0010339 | 3300046690 | Bacteria | 6427 |
| 381 | Ga0495624_0019421 | 3300046690 | Bacteria | 4536 |
| 382 | Ga0495624_0034551 | 3300046690 | Bacteria | 3269 |
| 383 | Ga0495624_0077654 | 3300046690 | Bacteria | 2059 |
| 384 | Ga0495670_0008646 | 3300046691 | Bacteria | 5010 |
| 385 | Ga0495671_0000298 | 3300046692 | Bacteria | 41706 |
| 386 | Ga0495671_0006874 | 3300046692 | Bacteria | 6529 |
| 387 | Ga0495649_0003994 | 3300046694 | Bacteria | 9723 |
| 388 | Ga0495649_0019811 | 3300046694 | Bacteria | 3778 |
| 389 | Ga0495649_0092725 | 3300046694 | Bacteria | 1608 |
| 390 | Ga0495589_0000928 | 3300046794 | Bacteria | 18001 |
| 391 | Ga0495589_0010014 | 3300046794 | Bacteria | 4926 |
| 392 | Ga0495589_0049716 | 3300046794 | Bacteria | 2075 |
| 393 | Ga0495600_0001945 | 3300046809 | Bacteria | 11595 |
| 394 | Ga0495581_0018968 | 3300047315 | Bacteria | 3992 |
| 395 | Ga0495604_0006905 | 3300047317 | Bacteria | 9000 |
| 396 | Ga0495604_0007838 | 3300047317 | Bacteria | 8453 |
| 397 | Ga0495604_0011785 | 3300047317 | Bacteria | 6951 |
| 398 | Ga0495674_0079395 | 3300047319 | Bacteria | 2818 |
| 399 | Ga0495674_0132611 | 3300047319 | Bacteria | 2098 |
| 400 | Ga0495672_0007240 | 3300047320 | Bacteria | 8370 |
| 401 | Ga0495676_0005874 | 3300047321 | Bacteria | 11265 |
| 402 | Ga0495676_0020180 | 3300047321 | Bacteria | 5854 |
| 403 | Ga0495680_0052605 | 3300047322 | Bacteria | 3174 |
| 404 | Ga0495683_0002027 | 3300047323 | Bacteria | 12553 |
| 405 | Ga0495683_0018507 | 3300047323 | Bacteria | 3600 |
| 406 | Ga0495683_0067460 | 3300047323 | Bacteria | 1761 |
| 407 | Ga0495687_000104 | 3300047443 | Bacteria | 128704 |
| 408 | Ga0495687_011819 | 3300047443 | Bacteria | 4662 |
| 409 | Ga0495687_023572 | 3300047443 | Bacteria | 2938 |
| 410 | Ga0495675_0001679 | 3300047444 | Bacteria | 13286 |
| 411 | Ga0495675_0006213 | 3300047444 | Bacteria | 7305 |
| 412 | Ga0495675_0023657 | 3300047444 | Bacteria | 3915 |
| 413 | Ga0495679_000062 | 3300047446 | Bacteria | 107181 |
| 414 | Ga0495673_0000027 | 3300047469 | Bacteria | 475440 |
| 415 | Ga0495673_0027555 | 3300047469 | Bacteria | 2702 |
| 416 | Ga0495684_0031865 | 3300047471 | Bacteria | 4049 |
| 417 | Ga0495684_0183711 | 3300047471 | Bacteria | 1549 |
| 418 | Ga0495686_0000468 | 3300047472 | Bacteria | 60235 |
| 419 | Ga0495593_0002141 | 3300047673 | Bacteria | 11792 |
| 420 | Ga0495593_0003580 | 3300047673 | Bacteria | 9281 |
| 421 | Ga0495593_0007871 | 3300047673 | Bacteria | 6205 |
| 422 | Ga0495593_0023731 | 3300047673 | Bacteria | 3405 |
| 423 | Ga0495602_0000856 | 3300048088 | Bacteria | 29354 |
| 424 | Ga0495602_0010590 | 3300048088 | Bacteria | 9565 |
| 425 | Ga0495602_0076492 | 3300048088 | Bacteria | 2835 |
| 426 | Ga0495614_0024723 | 3300048089 | Bacteria | 2592 |
| 427 | Ga0495614_0033440 | 3300048089 | Bacteria | 2212 |
| 428 | Ga0495614_0033967 | 3300048089 | Bacteria | 2193 |
| 429 | Ga0495626_0016822 | 3300048091 | Bacteria | 3707 |
| 430 | Ga0496100_0068740 | 3300048903 | Bacteria | 2357 |
| 431 | Ga0496100_0104330 | 3300048903 | Bacteria | 1958 |
| 432 | Ga0496101_0080148 | 3300048904 | Bacteria | 2411 |
| 433 | Ga0496102_0056983 | 3300048905 | Bacteria | 3566 |
| 434 | Ga0496102_0144172 | 3300048905 | Bacteria | 2234 |
| 435 | Ga0496102_0153891 | 3300048905 | Bacteria | 2161 |
| 436 | Ga0496102_0174515 | 3300048905 | Bacteria | 2023 |
| 437 | Ga0496103_0001568 | 3300048906 | Bacteria | 15119 |
| 438 | Ga0496103_0030441 | 3300048906 | Bacteria | 3284 |
| 439 | Ga0496106_0126753 | 3300048909 | Bacteria | 1999 |
| 440 | Ga0496107_0104139 | 3300048910 | Bacteria | 2082 |
| 441 | Ga0496109_0004776 | 3300048912 | Bacteria | 11319 |
| 442 | Ga0496109_0018574 | 3300048912 | Bacteria | 6109 |
| 443 | Ga0496110_0024587 | 3300048913 | Bacteria | 5135 |
| 444 | Ga0496111_0015944 | 3300048914 | Bacteria | 5169 |
| 445 | Ga0496111_0054961 | 3300048914 | Bacteria | 2879 |
| 446 | Ga0496113_0121274 | 3300048916 | Bacteria | 2044 |
| 447 | Ga0496114_0001384 | 3300048917 | Bacteria | 18374 |
| 448 | Ga0496114_0006019 | 3300048917 | Bacteria | 9547 |
| 449 | Ga0496114_0043426 | 3300048917 | Bacteria | 3727 |
| 450 | Ga0496116_0032435 | 3300048919 | Bacteria | 3722 |
| 451 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 452 | Ga0496117_0016090 | 3300048920 | Bacteria | 6331 |
| 453 | Ga0496117_0036972 | 3300048920 | Bacteria | 3644 |
| 454 | Ga0496117_0051740 | 3300048920 | Bacteria | 2900 |
| 455 | Ga0496117_0129063 | 3300048920 | Bacteria | 1536 |
| 456 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 457 | Ga0496118_0004252 | 3300048921 | Bacteria | 17141 |
| 458 | Ga0496118_0013496 | 3300048921 | Bacteria | 7721 |
| 459 | Ga0496118_0022383 | 3300048921 | Bacteria | 5526 |
| 460 | Ga0496118_0024054 | 3300048921 | Bacteria | 5269 |
| 461 | Ga0496118_0061389 | 3300048921 | Bacteria | 2784 |
| 462 | Ga0496119_0057709 | 3300048922 | Bacteria | 2344 |
| 463 | Ga0496121_0000437 | 3300048924 | Bacteria | 82376 |
| 464 | Ga0496121_0009543 | 3300048924 | Bacteria | 11117 |
| 465 | Ga0496121_0010408 | 3300048924 | Bacteria | 10498 |
| 466 | Ga0496121_0015396 | 3300048924 | Bacteria | 8015 |
| 467 | Ga0496121_0047186 | 3300048924 | Bacteria | 3678 |
| 468 | Ga0496121_0093773 | 3300048924 | Bacteria | 2336 |
| 469 | Ga0496121_0110339 | 3300048924 | Bacteria | 2099 |
| 470 | Ga0496122_0001209 | 3300048925 | Bacteria | 43970 |
| 471 | Ga0496122_0002400 | 3300048925 | Bacteria | 26732 |
| 472 | Ga0496122_0072037 | 3300048925 | Bacteria | 2459 |
| 473 | Ga0496123_0001776 | 3300048926 | Bacteria | 28416 |
| 474 | Ga0496123_0004021 | 3300048926 | Bacteria | 15891 |
| 475 | Ga0496124_0000013 | 3300048927 | Bacteria | 484884 |
| 476 | Ga0496124_0027531 | 3300048927 | Bacteria | 5101 |
| 477 | Ga0496124_0080401 | 3300048927 | Bacteria | 2682 |
| 478 | Ga0496125_0093438 | 3300048928 | Bacteria | 2244 |
| 479 | Ga0496126_0000034 | 3300048929 | Bacteria | 362440 |
| 480 | Ga0496126_0000882 | 3300048929 | Bacteria | 52767 |
| 481 | Ga0496126_0006636 | 3300048929 | Bacteria | 12879 |
| 482 | Ga0496126_0034868 | 3300048929 | Bacteria | 4720 |
| 483 | Ga0496126_0110212 | 3300048929 | Bacteria | 2398 |
| 484 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 485 | Ga0495682_0003555 | 3300049460 | Bacteria | 6891 |
| 486 | Ga0501034_0000169 | 3300049571 | Bacteria | 122591 |
| 487 | Ga0501034_0010247 | 3300049571 | Bacteria | 9777 |
| 488 | Ga0501034_0015509 | 3300049571 | Bacteria | 7828 |
| 489 | Ga0501047_0028759 | 3300049581 | Bacteria | 5360 |
| 490 | Ga0501072_0008451 | 3300049588 | Bacteria | 7812 |
| 491 | Ga0501072_0021840 | 3300049588 | Bacteria | 4964 |
| 492 | Ga0501073_0012851 | 3300049589 | Bacteria | 6103 |
| 493 | Ga0501209_000101 | 3300049656 | Bacteria | 8706 |
| 494 | Ga0501249_002239 | 3300049679 | Bacteria | 3926 |
| 495 | Ga0501080_0009862 | 3300049742 | Bacteria | 8726 |
| 496 | Ga0501269_000182 | 3300049766 | Bacteria | 19267 |
| 497 | Ga0501035_0006947 | 3300049822 | Bacteria | 10570 |
| 498 | nmdc:mga00v17_11910_c1 | 3300050491 | Bacteria | 4788 |
| 499 | nmdc:mga09592_43378_c1 | 3300050508 | Bacteria | 3786 |
| 500 | nmdc:mga08y16_26660_c1 | 3300050511 | Bacteria | 6090 |
| 501 | nmdc:mga08y16_99292_c1 | 3300050511 | Bacteria | 3031 |
| 502 | nmdc:mga0n895_200504_c1 | 3300050512 | Bacteria | 2026 |
| 503 | Ga0500590_028942 | 3300053148 | Bacteria | 2874 |
| 504 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 505 | Ga0501084_0083146 | 3300054114 | Bacteria | 2687 |
| 506 | Ga0501082_0181401 | 3300060353 | Bacteria | 1831 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036712 | Ga0316584_0017192 | Ga0316584_0017192_3422_4513 | 360 |
| 2 | iso_pu_bacteria | 2857558681 | 2857561195 | 428 |
| 3 | 3300028380 | Ga0268265_10068297 | Ga0268265_100682972 | 435 |
| 4 | 3300036647 | Ga0316582_0001945 | Ga0316582_0001945_6980_8296 | 435 |
| 5 | 3300005328 | Ga0070676_10064579 | Ga0070676_100645792 | 437 |
| 6 | 3300005354 | Ga0070675_100040882 | Ga0070675_1000408823 | 437 |
| 7 | 3300025940 | Ga0207691_10041561 | Ga0207691_100415613 | 437 |
| 8 | 3300025972 | Ga0207668_10010999 | Ga0207668_100109992 | 437 |
| 9 | 3300005841 | Ga0068863_100077569 | Ga0068863_1000775692 | 439 |
| 10 | iso_pu_bacteria | 2816332286 | 2817456680 | 439 |
| 11 | 3300049571 | Ga0501034_0010247 | Ga0501034_0010247_7844_9244 | 443 |
| 12 | 3300048925 | Ga0496122_0072037 | Ga0496122_0072037_185_1582 | 444 |
| 13 | 3300048927 | Ga0496124_0000013 | Ga0496124_0000013_43861_45258 | 444 |
| 14 | 3300049656 | Ga0501209_000101 | Ga0501209_000101_3401_4789 | 444 |
| 15 | 3300006195 | Ga0075366_10084727 | Ga0075366_100847272 | 449 |
| 16 | iso_pu_bacteria | 2842711865 | 2842711919 | 450 |
| 17 | 3300050491 | nmdc:mga00v17_11910_c1 | nmdc:mga00v17_11910_c1_2200_3597 | 452 |
| 18 | iso_pu_bacteria | 2998344455 | 2998347186 | 452 |
| 19 | iso_pu_bacteria | 2643221664 | 2644356238 | 453 |
| 20 | iso_pu_bacteria | 2857547612 | 2857548070 | 453 |
| 21 | iso_pu_bacteria | 2857553236 | 2857555731 | 453 |
| 22 | iso_pu_bacteria | 2904424332 | 2904429085 | 453 |
| 23 | iso_pu_bacteria | 2919476304 | 2919479222 | 453 |
| 24 | iso_pu_bacteria | 2932410948 | 2932412660 | 453 |
| 25 | iso_pu_bacteria | 2932416698 | 2932420175 | 453 |
| 26 | 3300015262 | Ga0182007_10002194 | Ga0182007_100021945 | 454 |
| 27 | iso_pu_bacteria | 2600255292 | 2601670585 | 454 |
| 28 | iso_pu_bacteria | 8040167225 | 8040173276 | 454 |
| 29 | 3300003771 | Ga0055526_1000111 | Ga0055526_100011157 | 455 |
| 30 | 3300005549 | Ga0070704_100231198 | Ga0070704_1002311981 | 455 |
| 31 | 3300009093 | Ga0105240_10206112 | Ga0105240_102061122 | 455 |
| 32 | 3300013104 | Ga0157370_10002443 | Ga0157370_1000244323 | 455 |
| 33 | 3300015262 | Ga0182007_10000044 | Ga0182007_1000004459 | 455 |
| 34 | 3300015265 | Ga0182005_1000032 | Ga0182005_100003243 | 455 |
| 35 | 3300021361 | Ga0213872_10007875 | Ga0213872_100078755 | 455 |
| 36 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006450 | 455 |
| 37 | 3300039447 | Ga0436361_0215157 | Ga0436361_0215157_50046_51419 | 455 |
| 38 | 3300039447 | Ga0436361_0653615 | Ga0436361_0653615_6575_7957 | 455 |
| 39 | 3300039447 | Ga0436361_0720947 | Ga0436361_0720947_6401_7783 | 455 |
| 40 | 3300044712 | Ga0453684_0001452 | Ga0453684_0001452_52550_53923 | 455 |
| 41 | 3300045051 | Ga0451576_0016196 | Ga0451576_0016196_3812_5185 | 455 |
| 42 | 3300046453 | Ga0495627_000016 | Ga0495627_000016_266910_268292 | 455 |
| 43 | 3300046460 | Ga0495638_0014717 | Ga0495638_0014717_1044_2474 | 455 |
| 44 | 3300046463 | Ga0495653_0006523 | Ga0495653_0006523_7646_9028 | 455 |
| 45 | 3300046491 | Ga0495584_0000022 | Ga0495584_0000022_49813_51195 | 455 |
| 46 | 3300046492 | Ga0495585_0012983 | Ga0495585_0012983_2721_4151 | 455 |
| 47 | 3300046501 | Ga0495607_0001625 | Ga0495607_0001625_7297_8679 | 455 |
| 48 | 3300046507 | Ga0495606_0000690 | Ga0495606_0000690_23855_25237 | 455 |
| 49 | 3300046507 | Ga0495606_0001324 | Ga0495606_0001324_24820_26202 | 455 |
| 50 | 3300046507 | Ga0495606_0009012 | Ga0495606_0009012_5270_6652 | 455 |
| 51 | 3300046538 | Ga0495609_0000263 | Ga0495609_0000263_36154_37536 | 455 |
| 52 | 3300046558 | Ga0495633_0001345 | Ga0495633_0001345_13528_14910 | 455 |
| 53 | 3300046660 | Ga0495625_0007904 | Ga0495625_0007904_3244_4626 | 455 |
| 54 | 3300046660 | Ga0495625_0082058 | Ga0495625_0082058_131_1594 | 455 |
| 55 | 3300046663 | Ga0495635_0002165 | Ga0495635_0002165_501_1883 | 455 |
| 56 | 3300046694 | Ga0495649_0003994 | Ga0495649_0003994_4853_6235 | 455 |
| 57 | 3300046694 | Ga0495649_0092725 | Ga0495649_0092725_117_1496 | 455 |
| 58 | 3300047317 | Ga0495604_0011785 | Ga0495604_0011785_5268_6650 | 455 |
| 59 | 3300047444 | Ga0495675_0006213 | Ga0495675_0006213_243_1625 | 455 |
| 60 | 3300047469 | Ga0495673_0000027 | Ga0495673_0000027_291611_292993 | 455 |
| 61 | 3300047673 | Ga0495593_0002141 | Ga0495593_0002141_5335_6717 | 455 |
| 62 | 3300048906 | Ga0496103_0001568 | Ga0496103_0001568_5003_6385 | 455 |
| 63 | 3300048914 | Ga0496111_0015944 | Ga0496111_0015944_2512_3894 | 455 |
| 64 | 3300048919 | Ga0496116_0032435 | Ga0496116_0032435_844_2226 | 455 |
| 65 | 3300048920 | Ga0496117_0000010 | Ga0496117_0000010_43640_45022 | 455 |
| 66 | 3300048920 | Ga0496117_0129063 | Ga0496117_0129063_12_1454 | 455 |
| 67 | 3300048921 | Ga0496118_0000009 | Ga0496118_0000009_566933_568315 | 455 |
| 68 | 3300048924 | Ga0496121_0010408 | Ga0496121_0010408_3508_4890 | 455 |
| 69 | 3300048924 | Ga0496121_0015396 | Ga0496121_0015396_4992_6374 | 455 |
| 70 | 3300048925 | Ga0496122_0002400 | Ga0496122_0002400_15505_16887 | 455 |
| 71 | 3300048926 | Ga0496123_0004021 | Ga0496123_0004021_9974_11356 | 455 |
| 72 | 3300048927 | Ga0496124_0080401 | Ga0496124_0080401_910_2292 | 455 |
| 73 | 3300048928 | Ga0496125_0093438 | Ga0496125_0093438_278_1660 | 455 |
| 74 | 3300048929 | Ga0496126_0034868 | Ga0496126_0034868_1902_3284 | 455 |
| 75 | 3300049459 | Ga0495678_000001 | Ga0495678_000001_685331_686713 | 455 |
| 76 | 3300049460 | Ga0495682_0003555 | Ga0495682_0003555_3087_4517 | 455 |
| 77 | 3300049679 | Ga0501249_002239 | Ga0501249_002239_474_1856 | 455 |
| 78 | 3300049766 | Ga0501269_000182 | Ga0501269_000182_2332_3714 | 455 |
| 79 | 3300005327 | Ga0070658_10007669 | Ga0070658_100076698 | 456 |
| 80 | 3300005329 | Ga0070683_100015845 | Ga0070683_1000158452 | 456 |
| 81 | 3300005330 | Ga0070690_100012158 | Ga0070690_1000121583 | 456 |
| 82 | 3300005331 | Ga0070670_100006044 | Ga0070670_1000060447 | 456 |
| 83 | 3300005331 | Ga0070670_100006402 | Ga0070670_1000064027 | 456 |
| 84 | 3300005331 | Ga0070670_100055027 | Ga0070670_1000550272 | 456 |
| 85 | 3300005334 | Ga0068869_100000941 | Ga0068869_10000094111 | 456 |
| 86 | 3300005334 | Ga0068869_100001855 | Ga0068869_1000018552 | 456 |
| 87 | 3300005335 | Ga0070666_10013183 | Ga0070666_100131833 | 456 |
| 88 | 3300005338 | Ga0068868_100007389 | Ga0068868_1000073896 | 456 |
| 89 | 3300005344 | Ga0070661_100002328 | Ga0070661_1000023289 | 456 |
| 90 | 3300005344 | Ga0070661_100018424 | Ga0070661_1000184242 | 456 |
| 91 | 3300005354 | Ga0070675_100016834 | Ga0070675_1000168345 | 456 |
| 92 | 3300005355 | Ga0070671_100012870 | Ga0070671_1000128702 | 456 |
| 93 | 3300005355 | Ga0070671_100018269 | Ga0070671_1000182692 | 456 |
| 94 | 3300005364 | Ga0070673_100014894 | Ga0070673_1000148944 | 456 |
| 95 | 3300005364 | Ga0070673_100068418 | Ga0070673_1000684182 | 456 |
| 96 | 3300005366 | Ga0070659_100080811 | Ga0070659_1000808112 | 456 |
| 97 | 3300005366 | Ga0070659_100107786 | Ga0070659_1001077863 | 456 |
| 98 | 3300005367 | Ga0070667_100003833 | Ga0070667_1000038339 | 456 |
| 99 | 3300005434 | Ga0070709_10001157 | Ga0070709_100011575 | 456 |
| 100 | 3300005437 | Ga0070710_10009779 | Ga0070710_100097792 | 456 |
| 101 | 3300005445 | Ga0070708_100000125 | Ga0070708_1000001257 | 456 |
| 102 | 3300005456 | Ga0070678_100006242 | Ga0070678_1000062424 | 456 |
| 103 | 3300005458 | Ga0070681_10000413 | Ga0070681_1000041328 | 456 |
| 104 | 3300005459 | Ga0068867_100005612 | Ga0068867_1000056124 | 456 |
| 105 | 3300005459 | Ga0068867_100014149 | Ga0068867_1000141494 | 456 |
| 106 | 3300005459 | Ga0068867_100245685 | Ga0068867_1002456851 | 456 |
| 107 | 3300005530 | Ga0070679_100003879 | Ga0070679_1000038793 | 456 |
| 108 | 3300005530 | Ga0070679_100019673 | Ga0070679_1000196732 | 456 |
| 109 | 3300005535 | Ga0070684_100314155 | Ga0070684_1003141551 | 456 |
| 110 | 3300005543 | Ga0070672_100004932 | Ga0070672_1000049325 | 456 |
| 111 | 3300005548 | Ga0070665_100010975 | Ga0070665_1000109754 | 456 |
| 112 | 3300005563 | Ga0068855_100029324 | Ga0068855_1000293245 | 456 |
| 113 | 3300005564 | Ga0070664_100015585 | Ga0070664_1000155854 | 456 |
| 114 | 3300005617 | Ga0068859_100004344 | Ga0068859_10000434415 | 456 |
| 115 | 3300005617 | Ga0068859_100043558 | Ga0068859_1000435584 | 456 |
| 116 | 3300005618 | Ga0068864_100026306 | Ga0068864_1000263063 | 456 |
| 117 | 3300005719 | Ga0068861_100000216 | Ga0068861_10000021616 | 456 |
| 118 | 3300005719 | Ga0068861_100098864 | Ga0068861_1000988642 | 456 |
| 119 | 3300005834 | Ga0068851_10032305 | Ga0068851_100323052 | 456 |
| 120 | 3300005840 | Ga0068870_10002112 | Ga0068870_100021122 | 456 |
| 121 | 3300005841 | Ga0068863_100012923 | Ga0068863_1000129234 | 456 |
| 122 | 3300005841 | Ga0068863_100026740 | Ga0068863_1000267402 | 456 |
| 123 | 3300005842 | Ga0068858_100002185 | Ga0068858_1000021852 | 456 |
| 124 | 3300005842 | Ga0068858_100032968 | Ga0068858_1000329684 | 456 |
| 125 | 3300005843 | Ga0068860_100004954 | Ga0068860_10000495410 | 456 |
| 126 | 3300005844 | Ga0068862_100002123 | Ga0068862_1000021232 | 456 |
| 127 | 3300006237 | Ga0097621_100008935 | Ga0097621_1000089355 | 456 |
| 128 | 3300006237 | Ga0097621_100090246 | Ga0097621_1000902462 | 456 |
| 129 | 3300006931 | Ga0097620_100004344 | Ga0097620_10000434415 | 456 |
| 130 | 3300006931 | Ga0097620_100043559 | Ga0097620_1000435592 | 456 |
| 131 | 3300009094 | Ga0111539_10036219 | Ga0111539_100362193 | 456 |
| 132 | 3300009551 | Ga0105238_10029632 | Ga0105238_100296325 | 456 |
| 133 | 3300009553 | Ga0105249_10198787 | Ga0105249_101987872 | 456 |
| 134 | 3300010375 | Ga0105239_10233932 | Ga0105239_102339322 | 456 |
| 135 | 3300013100 | Ga0157373_10013708 | Ga0157373_100137082 | 456 |
| 136 | 3300013104 | Ga0157370_10005978 | Ga0157370_100059789 | 456 |
| 137 | 3300013105 | Ga0157369_10114611 | Ga0157369_101146112 | 456 |
| 138 | 3300013296 | Ga0157374_10108496 | Ga0157374_101084962 | 456 |
| 139 | 3300013297 | Ga0157378_10076823 | Ga0157378_100768233 | 456 |
| 140 | 3300013297 | Ga0157378_10187934 | Ga0157378_101879341 | 456 |
| 141 | 3300013307 | Ga0157372_10129853 | Ga0157372_101298532 | 456 |
| 142 | 3300014325 | Ga0163163_10006597 | Ga0163163_100065974 | 456 |
| 143 | 3300014325 | Ga0163163_10277062 | Ga0163163_102770622 | 456 |
| 144 | 3300014968 | Ga0157379_10000044 | Ga0157379_1000004436 | 456 |
| 145 | 3300014968 | Ga0157379_10006079 | Ga0157379_100060794 | 456 |
| 146 | 3300021384 | Ga0213876_10050204 | Ga0213876_100502042 | 456 |
| 147 | 3300025315 | Ga0207697_10004914 | Ga0207697_100049143 | 456 |
| 148 | 3300025893 | Ga0207682_10037324 | Ga0207682_100373242 | 456 |
| 149 | 3300025906 | Ga0207699_10061523 | Ga0207699_100615231 | 456 |
| 150 | 3300025907 | Ga0207645_10007275 | Ga0207645_100072754 | 456 |
| 151 | 3300025908 | Ga0207643_10015015 | Ga0207643_100150153 | 456 |
| 152 | 3300025909 | Ga0207705_10067174 | Ga0207705_100671742 | 456 |
| 153 | 3300025912 | Ga0207707_10003209 | Ga0207707_100032095 | 456 |
| 154 | 3300025921 | Ga0207652_10039036 | Ga0207652_100390364 | 456 |
| 155 | 3300025923 | Ga0207681_10121885 | Ga0207681_101218852 | 456 |
| 156 | 3300025925 | Ga0207650_10005000 | Ga0207650_100050007 | 456 |
| 157 | 3300025925 | Ga0207650_10076039 | Ga0207650_100760393 | 456 |
| 158 | 3300025926 | Ga0207659_10038111 | Ga0207659_100381114 | 456 |
| 159 | 3300025931 | Ga0207644_10007835 | Ga0207644_100078354 | 456 |
| 160 | 3300025931 | Ga0207644_10031728 | Ga0207644_100317282 | 456 |
| 161 | 3300025932 | Ga0207690_10020114 | Ga0207690_100201142 | 456 |
| 162 | 3300025937 | Ga0207669_10005389 | Ga0207669_100053894 | 456 |
| 163 | 3300025937 | Ga0207669_10009058 | Ga0207669_100090582 | 456 |
| 164 | 3300025940 | Ga0207691_10001229 | Ga0207691_100012294 | 456 |
| 165 | 3300025940 | Ga0207691_10116517 | Ga0207691_101165172 | 456 |
| 166 | 3300025942 | Ga0207689_10002193 | Ga0207689_100021937 | 456 |
| 167 | 3300025942 | Ga0207689_10002241 | Ga0207689_100022414 | 456 |
| 168 | 3300025945 | Ga0207679_10061329 | Ga0207679_100613292 | 456 |
| 169 | 3300025960 | Ga0207651_10008322 | Ga0207651_100083222 | 456 |
| 170 | 3300025960 | Ga0207651_10022147 | Ga0207651_100221473 | 456 |
| 171 | 3300025972 | Ga0207668_10033022 | Ga0207668_100330222 | 456 |
| 172 | 3300025981 | Ga0207640_10009199 | Ga0207640_100091993 | 456 |
| 173 | 3300025986 | Ga0207658_10001631 | Ga0207658_1000163114 | 456 |
| 174 | 3300025986 | Ga0207658_10004585 | Ga0207658_100045854 | 456 |
| 175 | 3300025986 | Ga0207658_10008086 | Ga0207658_100080865 | 456 |
| 176 | 3300026023 | Ga0207677_10137926 | Ga0207677_101379262 | 456 |
| 177 | 3300026035 | Ga0207703_10001245 | Ga0207703_1000124510 | 456 |
| 178 | 3300026067 | Ga0207678_10255420 | Ga0207678_102554201 | 456 |
| 179 | 3300026089 | Ga0207648_10000885 | Ga0207648_100008854 | 456 |
| 180 | 3300026116 | Ga0207674_10029280 | Ga0207674_100292803 | 456 |
| 181 | 3300026118 | Ga0207675_100000672 | Ga0207675_10000067218 | 456 |
| 182 | 3300026118 | Ga0207675_100031843 | Ga0207675_1000318433 | 456 |
| 183 | 3300026118 | Ga0207675_100052151 | Ga0207675_1000521513 | 456 |
| 184 | 3300026121 | Ga0207683_10001347 | Ga0207683_1000134720 | 456 |
| 185 | 3300026121 | Ga0207683_10005836 | Ga0207683_100058361 | 456 |
| 186 | 3300026142 | Ga0207698_10067021 | Ga0207698_100670212 | 456 |
| 187 | 3300027876 | Ga0209974_10022346 | Ga0209974_100223462 | 456 |
| 188 | 3300027907 | Ga0207428_10023424 | Ga0207428_100234243 | 456 |
| 189 | 3300028379 | Ga0268266_10021579 | Ga0268266_100215792 | 456 |
| 190 | 3300028380 | Ga0268265_10002148 | Ga0268265_1000214811 | 456 |
| 191 | 3300028380 | Ga0268265_10100368 | Ga0268265_101003682 | 456 |
| 192 | 3300028381 | Ga0268264_10001103 | Ga0268264_1000110317 | 456 |
| 193 | 3300028381 | Ga0268264_10010915 | Ga0268264_100109154 | 456 |
| 194 | 3300031235 | Ga0265330_10016511 | Ga0265330_100165113 | 456 |
| 195 | 3300031251 | Ga0265327_10000295 | Ga0265327_1000029547 | 456 |
| 196 | 3300031824 | Ga0307413_10020648 | Ga0307413_100206482 | 456 |
| 197 | 3300031852 | Ga0307410_10042294 | Ga0307410_100422942 | 456 |
| 198 | 3300032126 | Ga0307415_100018206 | Ga0307415_1000182064 | 456 |
| 199 | 3300035115 | Ga0373941_0023471 | Ga0373941_0023471_62_1435 | 456 |
| 200 | 3300038443 | Ga0395901_0030143 | Ga0395901_0030143_3393_4769 | 456 |
| 201 | 3300042139 | Ga0450904_000533 | Ga0450904_000533_3985_5370 | 456 |
| 202 | 3300042876 | Ga0451577_0116638 | Ga0451577_0116638_570_1958 | 456 |
| 203 | 3300044673 | Ga0453683_0009774 | Ga0453683_0009774_3199_4575 | 456 |
| 204 | 3300044673 | Ga0453683_0013014 | Ga0453683_0013014_2626_4002 | 456 |
| 205 | 3300044712 | Ga0453684_0003292 | Ga0453684_0003292_11920_13308 | 456 |
| 206 | 3300044712 | Ga0453684_0059857 | Ga0453684_0059857_709_2097 | 456 |
| 207 | 3300044712 | Ga0453684_0085184 | Ga0453684_0085184_2316_3776 | 456 |
| 208 | 3300045051 | Ga0451576_0000335 | Ga0451576_0000335_81951_83333 | 456 |
| 209 | 3300045051 | Ga0451576_0040985 | Ga0451576_0040985_3327_4703 | 456 |
| 210 | 3300045836 | Ga0466958_0038185 | Ga0466958_0038185_369_1745 | 456 |
| 211 | 3300048905 | Ga0496102_0056983 | Ga0496102_0056983_617_1993 | 456 |
| 212 | 3300048912 | Ga0496109_0004776 | Ga0496109_0004776_7486_8913 | 456 |
| 213 | 3300048912 | Ga0496109_0018574 | Ga0496109_0018574_4348_5724 | 456 |
| 214 | 3300048917 | Ga0496114_0001384 | Ga0496114_0001384_8248_9624 | 456 |
| 215 | 3300048917 | Ga0496114_0043426 | Ga0496114_0043426_275_1702 | 456 |
| 216 | 3300048929 | Ga0496126_0110212 | Ga0496126_0110212_789_2177 | 456 |
| 217 | 3300049571 | Ga0501034_0015509 | Ga0501034_0015509_799_2172 | 456 |
| 218 | 3300049581 | Ga0501047_0028759 | Ga0501047_0028759_1034_2431 | 456 |
| 219 | 3300049588 | Ga0501072_0008451 | Ga0501072_0008451_6098_7477 | 456 |
| 220 | 3300049588 | Ga0501072_0021840 | Ga0501072_0021840_2875_4248 | 456 |
| 221 | 3300049589 | Ga0501073_0012851 | Ga0501073_0012851_689_2062 | 456 |
| 222 | 3300049742 | Ga0501080_0009862 | Ga0501080_0009862_36_1409 | 456 |
| 223 | 3300049822 | Ga0501035_0006947 | Ga0501035_0006947_8198_9595 | 456 |
| 224 | 3300050508 | nmdc:mga09592_43378_c1 | nmdc:mga09592_43378_c1_1132_2505 | 456 |
| 225 | 3300050511 | nmdc:mga08y16_26660_c1 | nmdc:mga08y16_26660_c1_3982_5385 | 456 |
| 226 | 3300050511 | nmdc:mga08y16_99292_c1 | nmdc:mga08y16_99292_c1_1595_2971 | 456 |
| 227 | 3300050512 | nmdc:mga0n895_200504_c1 | nmdc:mga0n895_200504_c1_479_1852 | 456 |
| 228 | 3300053156 | Ga0500622_0000001 | Ga0500622_0000001_13391_14791 | 456 |
| 229 | 3300054114 | Ga0501084_0083146 | Ga0501084_0083146_212_1585 | 456 |
| 230 | 3300060353 | Ga0501082_0181401 | Ga0501082_0181401_150_1523 | 456 |
| 231 | iso_pu_bacteria | 2855730933 | 2855733215 | 456 |
| 232 | iso_pu_bacteria | 2855767633 | 2855771967 | 456 |
| 233 | iso_pu_bacteria | 2857542790 | 2857543021 | 456 |
| 234 | iso_pu_bacteria | 2881412998 | 2881416028 | 456 |
| 235 | iso_pu_bacteria | 639633007 | 639787934 | 456 |
| 236 | iso_pu_bacteria | 2513237150 | 2513954557 | 457 |
| 237 | iso_pu_bacteria | 2513237165 | 2514041162 | 457 |
| 238 | iso_pu_bacteria | 2834641062 | 2834641356 | 457 |
| 239 | iso_pu_bacteria | 2858688981 | 2858691336 | 457 |
| 240 | iso_pu_bacteria | 644736347 | 644748683 | 457 |
| 241 | iso_pu_bacteria | 8003400568 | 8003400970 | 457 |
| 242 | iso_pu_bacteria | 2599185178 | 2599445821 | 458 |
| 243 | 3300044735 | Ga0466968_0000016 | Ga0466968_0000016_899_2290 | 459 |
| 244 | 3300002705 | JGI25156J39149_1000917 | JGI25156J39149_100091713 | 460 |
| 245 | 3300002738 | JGI25154J39366_1000190 | JGI25154J39366_10001905 | 460 |
| 246 | 3300003187 | JGI25151J46595_10000841 | JGI25151J46595_100008415 | 460 |
| 247 | 3300003756 | Ga0055533_1000460 | Ga0055533_10004601 | 460 |
| 248 | 3300003771 | Ga0055526_1002108 | Ga0055526_100210811 | 460 |
| 249 | 3300003775 | Ga0055524_1000196 | Ga0055524_10001968 | 460 |
| 250 | 3300003781 | Ga0055536_1000022 | Ga0055536_100002272 | 460 |
| 251 | 3300003784 | Ga0055534_1000270 | Ga0055534_10002702 | 460 |
| 252 | 3300003784 | Ga0055534_1001156 | Ga0055534_10011563 | 460 |
| 253 | 3300003784 | Ga0055534_1001272 | Ga0055534_10012726 | 460 |
| 254 | 3300006948 | Ga0099826_10000016 | Ga0099826_1000001679 | 460 |
| 255 | 3300013307 | Ga0157372_10000110 | Ga0157372_1000011025 | 460 |
| 256 | 3300015261 | Ga0182006_1000392 | Ga0182006_100039210 | 460 |
| 257 | 3300025224 | Ga0209784_100600 | Ga0209784_1006003 | 460 |
| 258 | 3300025225 | Ga0209566_100200 | Ga0209566_10020032 | 460 |
| 259 | 3300025226 | Ga0209674_100237 | Ga0209674_10023736 | 460 |
| 260 | 3300025226 | Ga0209674_101104 | Ga0209674_1011045 | 460 |
| 261 | 3300025246 | Ga0209646_1000075 | Ga0209646_100007518 | 460 |
| 262 | 3300025254 | Ga0209148_1000043 | Ga0209148_1000043166 | 460 |
| 263 | 3300025256 | Ga0209759_1001195 | Ga0209759_10011953 | 460 |
| 264 | 3300025256 | Ga0209759_1002513 | Ga0209759_10025137 | 460 |
| 265 | 3300025263 | Ga0209565_1000368 | Ga0209565_10003688 | 460 |
| 266 | 3300025263 | Ga0209565_1005164 | Ga0209565_10051641 | 460 |
| 267 | 3300025291 | Ga0209675_1000070 | Ga0209675_100007033 | 460 |
| 268 | 3300025291 | Ga0209675_1000383 | Ga0209675_10003832 | 460 |
| 269 | 3300025291 | Ga0209675_1000389 | Ga0209675_10003892 | 460 |
| 270 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012604 | 460 |
| 271 | 3300025294 | Ga0209025_1000124 | Ga0209025_1000124108 | 460 |
| 272 | 3300025294 | Ga0209025_1000504 | Ga0209025_100050417 | 460 |
| 273 | 3300025294 | Ga0209025_1000788 | Ga0209025_10007888 | 460 |
| 274 | 3300025294 | Ga0209025_1001088 | Ga0209025_100108836 | 460 |
| 275 | 3300025294 | Ga0209025_1017948 | Ga0209025_10179482 | 460 |
| 276 | 3300025295 | Ga0209564_1000350 | Ga0209564_100035040 | 460 |
| 277 | 3300025295 | Ga0209564_1000380 | Ga0209564_100038033 | 460 |
| 278 | 3300025295 | Ga0209564_1000497 | Ga0209564_10004978 | 460 |
| 279 | 3300025299 | Ga0209256_1000059 | Ga0209256_1000059184 | 460 |
| 280 | 3300025299 | Ga0209256_1000842 | Ga0209256_100084229 | 460 |
| 281 | 3300025303 | Ga0209051_1004630 | Ga0209051_10046302 | 460 |
| 282 | 3300025303 | Ga0209051_1019161 | Ga0209051_10191613 | 460 |
| 283 | 3300027666 | Ga0209282_1000064 | Ga0209282_100006432 | 460 |
| 284 | 3300028800 | Ga0265338_10000110 | Ga0265338_1000011084 | 460 |
| 285 | 3300037418 | Ga0395900_0002152 | Ga0395900_0002152_14874_16262 | 460 |
| 286 | 3300044693 | Ga0466961_0000028 | Ga0466961_0000028_19508_20896 | 460 |
| 287 | 3300046500 | Ga0495596_0000048 | Ga0495596_0000048_52267_53652 | 460 |
| 288 | 3300046513 | Ga0495616_0001671 | Ga0495616_0001671_6135_7520 | 460 |
| 289 | 3300046692 | Ga0495671_0000298 | Ga0495671_0000298_15581_16966 | 460 |
| 290 | 3300046694 | Ga0495649_0019811 | Ga0495649_0019811_128_1513 | 460 |
| 291 | 3300047320 | Ga0495672_0007240 | Ga0495672_0007240_5287_6672 | 460 |
| 292 | 3300048924 | Ga0496121_0009543 | Ga0496121_0009543_811_2196 | 460 |
| 293 | 3300048925 | Ga0496122_0001209 | Ga0496122_0001209_32779_34164 | 460 |
| 294 | 3300048926 | Ga0496123_0001776 | Ga0496123_0001776_10661_12046 | 460 |
| 295 | 3300049571 | Ga0501034_0000169 | Ga0501034_0000169_93023_94408 | 460 |
| 296 | 3300053148 | Ga0500590_028942 | Ga0500590_028942_913_2295 | 460 |
| 297 | iso_pu_bacteria | 2501025501 | 2501071209 | 460 |
| 298 | iso_pu_bacteria | 2501025502 | 2501078639 | 460 |
| 299 | iso_pu_bacteria | 2501025504 | 2501414089 | 460 |
| 300 | iso_pu_bacteria | 2508501125 | 2509127464 | 460 |
| 301 | iso_pu_bacteria | 2510065045 | 2510250139 | 460 |
| 302 | iso_pu_bacteria | 2510917013 | 2511089287 | 460 |
| 303 | iso_pu_bacteria | 2510917014 | 2511094654 | 460 |
| 304 | iso_pu_bacteria | 2510917015 | 2511104358 | 460 |
| 305 | iso_pu_bacteria | 2513237082 | 2513557327 | 460 |
| 306 | iso_pu_bacteria | 2513237083 | 2513565556 | 460 |
| 307 | iso_pu_bacteria | 2513237151 | 2513962168 | 460 |
| 308 | iso_pu_bacteria | 2513237166 | 2514046484 | 460 |
| 309 | iso_pu_bacteria | 2515154189 | 2516024518 | 460 |
| 310 | iso_pu_bacteria | 2519103095 | 2519458025 | 460 |
| 311 | iso_pu_bacteria | 2526164713 | 2527076829 | 460 |
| 312 | iso_pu_bacteria | 2562617112 | 2563062156 | 460 |
| 313 | iso_pu_bacteria | 2599185239 | 2599739320 | 460 |
| 314 | iso_pu_bacteria | 2600255067 | 2600812628 | 460 |
| 315 | iso_pu_bacteria | 2711768613 | 2713477995 | 460 |
| 316 | iso_pu_bacteria | 2718217991 | 2719639297 | 460 |
| 317 | iso_pu_bacteria | 2721755763 | 2723876494 | 460 |
| 318 | iso_pu_bacteria | 2738541296 | 2738819920 | 460 |
| 319 | iso_pu_bacteria | 2738541298 | 2738832400 | 460 |
| 320 | iso_pu_bacteria | 2738541306 | 2738873927 | 460 |
| 321 | iso_pu_bacteria | 2738543002 | 2739185557 | 460 |
| 322 | iso_pu_bacteria | 2738543008 | 2739220525 | 460 |
| 323 | iso_pu_bacteria | 2744054900 | 2746092044 | 460 |
| 324 | iso_pu_bacteria | 2744054901 | 2746093637 | 460 |
| 325 | iso_pu_bacteria | 2751185846 | 2753566000 | 460 |
| 326 | iso_pu_bacteria | 2808606384 | 2808972176 | 460 |
| 327 | iso_pu_bacteria | 2808606390 | 2809006906 | 460 |
| 328 | iso_pu_bacteria | 2808606391 | 2809014044 | 460 |
| 329 | iso_pu_bacteria | 2816332253 | 2817260189 | 460 |
| 330 | iso_pu_bacteria | 2816332256 | 2817277856 | 460 |
| 331 | iso_pu_bacteria | 2818991450 | 2819621043 | 460 |
| 332 | iso_pu_bacteria | 2818991452 | 2819632703 | 460 |
| 333 | iso_pu_bacteria | 2842324504 | 2842331171 | 460 |
| 334 | iso_pu_bacteria | 2842348783 | 2842355510 | 460 |
| 335 | iso_pu_bacteria | 2842454564 | 2842457891 | 460 |
| 336 | iso_pu_bacteria | 2856287931 | 2856291587 | 460 |
| 337 | iso_pu_bacteria | 2857357740 | 2857364645 | 460 |
| 338 | iso_pu_bacteria | 2883087390 | 2883093850 | 460 |
| 339 | iso_pu_bacteria | 2900634093 | 2900636046 | 460 |
| 340 | iso_pu_bacteria | 2904483920 | 2904484150 | 460 |
| 341 | iso_pu_bacteria | 2919527303 | 2919530092 | 460 |
| 342 | iso_pu_bacteria | 2928108538 | 2928109846 | 460 |
| 343 | iso_pu_bacteria | 2928135762 | 2928136699 | 460 |
| 344 | iso_pu_bacteria | 2928157003 | 2928159706 | 460 |
| 345 | iso_pu_bacteria | 2928163908 | 2928164240 | 460 |
| 346 | iso_pu_bacteria | 2928503688 | 2928508921 | 460 |
| 347 | iso_pu_bacteria | 2945934425 | 2945935715 | 460 |
| 348 | iso_pu_bacteria | 2981990288 | 2981994147 | 460 |
| 349 | iso_pu_bacteria | 2990703756 | 2990710372 | 460 |
| 350 | iso_pu_bacteria | 641736151 | 642422895 | 460 |
| 351 | iso_pu_bacteria | 641736154 | 642415770 | 460 |
| 352 | iso_pu_bacteria | 642555112 | 642594058 | 460 |
| 353 | iso_pu_bacteria | 642555113 | 642620480 | 460 |
| 354 | iso_pu_bacteria | 8003955200 | 8003961832 | 460 |
| 355 | iso_pu_bacteria | 8018845410 | 8018849958 | 460 |
| 356 | iso_pu_bacteria | 8021120328 | 8021122593 | 460 |
| 357 | iso_pu_bacteria | 8039098773 | 8039099329 | 460 |
| 358 | iso_pu_bacteria | 8055266321 | 8055266533 | 460 |
| 359 | iso_pu_bacteria | 8055301274 | 8055305060 | 460 |
| 360 | 3300001990 | JGI24737J22298_10028436 | JGI24737J22298_100284362 | 464 |
| 361 | 3300002075 | JGI24738J21930_10002378 | JGI24738J21930_100023784 | 464 |
| 362 | 3300002705 | JGI25156J39149_1000337 | JGI25156J39149_100033725 | 464 |
| 363 | 3300002705 | JGI25156J39149_1000568 | JGI25156J39149_100056817 | 464 |
| 364 | 3300003214 | JGI25165J46597_1001162 | JGI25165J46597_10011628 | 464 |
| 365 | 3300003756 | Ga0055533_1000124 | Ga0055533_100012454 | 464 |
| 366 | 3300003756 | Ga0055533_1000956 | Ga0055533_10009563 | 464 |
| 367 | 3300003758 | Ga0055532_1000001 | Ga0055532_1000001774 | 464 |
| 368 | 3300003758 | Ga0055532_1002673 | Ga0055532_10026732 | 464 |
| 369 | 3300003760 | Ga0055527_1000014 | Ga0055527_1000014240 | 464 |
| 370 | 3300003761 | Ga0055535_1000001 | Ga0055535_1000001231 | 464 |
| 371 | 3300003762 | Ga0055542_1000001 | Ga0055542_1000001773 | 464 |
| 372 | 3300003763 | Ga0055529_1000001 | Ga0055529_1000001231 | 464 |
| 373 | 3300003763 | Ga0055529_1001481 | Ga0055529_10014815 | 464 |
| 374 | 3300005262 | Ga0065165_1000791 | Ga0065165_100079139 | 464 |
| 375 | 3300005327 | Ga0070658_10026186 | Ga0070658_100261863 | 464 |
| 376 | 3300005339 | Ga0070660_100000008 | Ga0070660_10000000890 | 464 |
| 377 | 3300005339 | Ga0070660_100049661 | Ga0070660_1000496612 | 464 |
| 378 | 3300005344 | Ga0070661_100099874 | Ga0070661_1000998742 | 464 |
| 379 | 3300005366 | Ga0070659_100000729 | Ga0070659_10000072917 | 464 |
| 380 | 3300005367 | Ga0070667_100159659 | Ga0070667_1001596592 | 464 |
| 381 | 3300005455 | Ga0070663_100001124 | Ga0070663_1000011248 | 464 |
| 382 | 3300005563 | Ga0068855_100014208 | Ga0068855_1000142087 | 464 |
| 383 | 3300005563 | Ga0068855_100074562 | Ga0068855_1000745623 | 464 |
| 384 | 3300005564 | Ga0070664_100116376 | Ga0070664_1001163763 | 464 |
| 385 | 3300009011 | Ga0105251_10000405 | Ga0105251_1000040523 | 464 |
| 386 | 3300009011 | Ga0105251_10001416 | Ga0105251_100014161 | 464 |
| 387 | 3300009093 | Ga0105240_10018939 | Ga0105240_100189393 | 464 |
| 388 | 3300009093 | Ga0105240_10035383 | Ga0105240_100353836 | 464 |
| 389 | 3300009545 | Ga0105237_10064744 | Ga0105237_100647442 | 464 |
| 390 | 3300010375 | Ga0105239_10006669 | Ga0105239_100066697 | 464 |
| 391 | 3300013100 | Ga0157373_10033545 | Ga0157373_100335452 | 464 |
| 392 | 3300013104 | Ga0157370_10005421 | Ga0157370_1000542113 | 464 |
| 393 | 3300013104 | Ga0157370_10008752 | Ga0157370_100087522 | 464 |
| 394 | 3300013104 | Ga0157370_10162085 | Ga0157370_101620852 | 464 |
| 395 | 3300013105 | Ga0157369_10000138 | Ga0157369_1000013878 | 464 |
| 396 | 3300013105 | Ga0157369_10014085 | Ga0157369_100140858 | 464 |
| 397 | 3300013296 | Ga0157374_10000102 | Ga0157374_1000010265 | 464 |
| 398 | 3300013296 | Ga0157374_10054480 | Ga0157374_100544801 | 464 |
| 399 | 3300013306 | Ga0163162_10051114 | Ga0163162_100511142 | 464 |
| 400 | 3300013307 | Ga0157372_10150389 | Ga0157372_101503893 | 464 |
| 401 | 3300013308 | Ga0157375_10034775 | Ga0157375_100347754 | 464 |
| 402 | 3300015262 | Ga0182007_10002938 | Ga0182007_100029386 | 464 |
| 403 | 3300016635 | Ga0183361_10018 | Ga0183361_10018114 | 464 |
| 404 | 3300020069 | Ga0197907_10105477 | Ga0197907_101054772 | 464 |
| 405 | 3300020081 | Ga0206354_11066516 | Ga0206354_110665162 | 464 |
| 406 | 3300022467 | Ga0224712_10003832 | Ga0224712_100038323 | 464 |
| 407 | 3300025226 | Ga0209674_100005 | Ga0209674_1000051202 | 464 |
| 408 | 3300025226 | Ga0209674_100150 | Ga0209674_10015051 | 464 |
| 409 | 3300025228 | Ga0209672_100001 | Ga0209672_1000011603 | 464 |
| 410 | 3300025228 | Ga0209672_100532 | Ga0209672_1005327 | 464 |
| 411 | 3300025229 | Ga0209147_100001 | Ga0209147_1000011603 | 464 |
| 412 | 3300025229 | Ga0209147_100378 | Ga0209147_10037825 | 464 |
| 413 | 3300025230 | Ga0209563_100794 | Ga0209563_1007947 | 464 |
| 414 | 3300025231 | Ga0207427_103643 | Ga0207427_1036432 | 464 |
| 415 | 3300025242 | Ga0209258_100001 | Ga0209258_1000011603 | 464 |
| 416 | 3300025254 | Ga0209148_1000003 | Ga0209148_10000031603 | 464 |
| 417 | 3300025256 | Ga0209759_1000228 | Ga0209759_100022846 | 464 |
| 418 | 3300025256 | Ga0209759_1000275 | Ga0209759_100027531 | 464 |
| 419 | 3300025256 | Ga0209759_1000879 | Ga0209759_10008793 | 464 |
| 420 | 3300025256 | Ga0209759_1002243 | Ga0209759_10022433 | 464 |
| 421 | 3300025261 | Ga0209233_1000016 | Ga0209233_1000016565 | 464 |
| 422 | 3300025272 | Ga0209455_1000001 | Ga0209455_10000011603 | 464 |
| 423 | 3300025284 | Ga0209130_1007352 | Ga0209130_10073521 | 464 |
| 424 | 3300025302 | Ga0207426_1000305 | Ga0207426_10003052 | 464 |
| 425 | 3300025735 | Ga0207713_1001376 | Ga0207713_100137615 | 464 |
| 426 | 3300025904 | Ga0207647_10000214 | Ga0207647_100002142 | 464 |
| 427 | 3300025904 | Ga0207647_10011603 | Ga0207647_100116035 | 464 |
| 428 | 3300025904 | Ga0207647_10025243 | Ga0207647_100252433 | 464 |
| 429 | 3300025909 | Ga0207705_10011384 | Ga0207705_100113844 | 464 |
| 430 | 3300025909 | Ga0207705_10016417 | Ga0207705_100164173 | 464 |
| 431 | 3300025914 | Ga0207671_10006819 | Ga0207671_100068197 | 464 |
| 432 | 3300025914 | Ga0207671_10058846 | Ga0207671_100588462 | 464 |
| 433 | 3300025919 | Ga0207657_10000018 | Ga0207657_1000001838 | 464 |
| 434 | 3300025919 | Ga0207657_10013915 | Ga0207657_100139158 | 464 |
| 435 | 3300025920 | Ga0207649_10031429 | Ga0207649_100314293 | 464 |
| 436 | 3300025924 | Ga0207694_10062186 | Ga0207694_100621862 | 464 |
| 437 | 3300025932 | Ga0207690_10000006 | Ga0207690_1000000690 | 464 |
| 438 | 3300025949 | Ga0207667_10000427 | Ga0207667_100004272 | 464 |
| 439 | 3300025986 | Ga0207658_10093471 | Ga0207658_100934712 | 464 |
| 440 | 3300026067 | Ga0207678_10000110 | Ga0207678_1000011042 | 464 |
| 441 | 3300026142 | Ga0207698_10008605 | Ga0207698_100086054 | 464 |
| 442 | 3300031731 | Ga0307405_10013096 | Ga0307405_100130962 | 464 |
| 443 | 3300031911 | Ga0307412_10000005 | Ga0307412_1000000538 | 464 |
| 444 | 3300031911 | Ga0307412_10078267 | Ga0307412_100782671 | 464 |
| 445 | 3300032002 | Ga0307416_100036132 | Ga0307416_1000361322 | 464 |
| 446 | 3300037312 | Ga0395899_0000008 | Ga0395899_0000008_88597_89991 | 464 |
| 447 | 3300037418 | Ga0395900_0063136 | Ga0395900_0063136_1548_2942 | 464 |
| 448 | 3300037466 | Ga0395898_0000072 | Ga0395898_0000072_125906_127300 | 464 |
| 449 | 3300037466 | Ga0395898_0007569 | Ga0395898_0007569_8632_10026 | 464 |
| 450 | 3300037471 | Ga0395905_0000012 | Ga0395905_0000012_336875_338269 | 464 |
| 451 | 3300038443 | Ga0395901_0000003 | Ga0395901_0000003_256295_257689 | 464 |
| 452 | 3300038443 | Ga0395901_0000154 | Ga0395901_0000154_16009_17403 | 464 |
| 453 | 3300042005 | Ga0439448_0005240 | Ga0439448_0005240_1322_2716 | 464 |
| 454 | 3300044684 | Ga0466966_0000008 | Ga0466966_0000008_25770_27164 | 464 |
| 455 | 3300044693 | Ga0466961_0025766 | Ga0466961_0025766_2322_3722 | 464 |
| 456 | 3300046454 | Ga0495592_0008737 | Ga0495592_0008737_6023_7417 | 464 |
| 457 | 3300046455 | Ga0495603_0035874 | Ga0495603_0035874_808_2202 | 464 |
| 458 | 3300046455 | Ga0495603_0053825 | Ga0495603_0053825_422_1816 | 464 |
| 459 | 3300046458 | Ga0495591_001099 | Ga0495591_001099_12828_14222 | 464 |
| 460 | 3300046459 | Ga0495629_0000099 | Ga0495629_0000099_40507_41901 | 464 |
| 461 | 3300046459 | Ga0495629_0001848 | Ga0495629_0001848_8032_9438 | 464 |
| 462 | 3300046459 | Ga0495629_0007335 | Ga0495629_0007335_3593_4987 | 464 |
| 463 | 3300046459 | Ga0495629_0016933 | Ga0495629_0016933_1619_3013 | 464 |
| 464 | 3300046460 | Ga0495638_0004081 | Ga0495638_0004081_2615_4021 | 464 |
| 465 | 3300046462 | Ga0495651_0008059 | Ga0495651_0008059_4248_5642 | 464 |
| 466 | 3300046463 | Ga0495653_0003639 | Ga0495653_0003639_3369_4763 | 464 |
| 467 | 3300046463 | Ga0495653_0018658 | Ga0495653_0018658_4160_5554 | 464 |
| 468 | 3300046463 | Ga0495653_0025481 | Ga0495653_0025481_86_1480 | 464 |
| 469 | 3300046463 | Ga0495653_0162930 | Ga0495653_0162930_23_1417 | 464 |
| 470 | 3300046471 | Ga0495650_0002455 | Ga0495650_0002455_13448_14842 | 464 |
| 471 | 3300046471 | Ga0495650_0003189 | Ga0495650_0003189_2621_4015 | 464 |
| 472 | 3300046471 | Ga0495650_0007872 | Ga0495650_0007872_419_1825 | 464 |
| 473 | 3300046471 | Ga0495650_0015323 | Ga0495650_0015323_59_1453 | 464 |
| 474 | 3300046471 | Ga0495650_0036830 | Ga0495650_0036830_255_1649 | 464 |
| 475 | 3300046472 | Ga0495580_0006624 | Ga0495580_0006624_4819_6213 | 464 |
| 476 | 3300046472 | Ga0495580_0009216 | Ga0495580_0009216_3770_5164 | 464 |
| 477 | 3300046472 | Ga0495580_0049822 | Ga0495580_0049822_394_1788 | 464 |
| 478 | 3300046472 | Ga0495580_0134456 | Ga0495580_0134456_295_1689 | 464 |
| 479 | 3300046474 | Ga0495605_0002569 | Ga0495605_0002569_4439_5845 | 464 |
| 480 | 3300046474 | Ga0495605_0005175 | Ga0495605_0005175_6014_7408 | 464 |
| 481 | 3300046477 | Ga0495664_0000349 | Ga0495664_0000349_6484_7878 | 464 |
| 482 | 3300046477 | Ga0495664_0033708 | Ga0495664_0033708_1430_2845 | 464 |
| 483 | 3300046477 | Ga0495664_0041390 | Ga0495664_0041390_1244_2638 | 464 |
| 484 | 3300046477 | Ga0495664_0054077 | Ga0495664_0054077_361_1755 | 464 |
| 485 | 3300046492 | Ga0495585_0026189 | Ga0495585_0026189_868_2274 | 464 |
| 486 | 3300046500 | Ga0495596_0001254 | Ga0495596_0001254_8605_9999 | 464 |
| 487 | 3300046506 | Ga0495583_0003132 | Ga0495583_0003132_8949_10343 | 464 |
| 488 | 3300046507 | Ga0495606_0020913 | Ga0495606_0020913_645_2039 | 464 |
| 489 | 3300046511 | Ga0495608_0017474 | Ga0495608_0017474_3533_4927 | 464 |
| 490 | 3300046512 | Ga0495610_0004942 | Ga0495610_0004942_4107_5501 | 464 |
| 491 | 3300046514 | Ga0495618_0007880 | Ga0495618_0007880_4216_5610 | 464 |
| 492 | 3300046514 | Ga0495618_0015383 | Ga0495618_0015383_2405_3799 | 464 |
| 493 | 3300046516 | Ga0495628_0016162 | Ga0495628_0016162_2616_4010 | 464 |
| 494 | 3300046517 | Ga0495630_0014647 | Ga0495630_0014647_4241_5635 | 464 |
| 495 | 3300046524 | Ga0495648_0020738 | Ga0495648_0020738_770_2164 | 464 |
| 496 | 3300046524 | Ga0495648_0026735 | Ga0495648_0026735_769_2163 | 464 |
| 497 | 3300046524 | Ga0495648_0050272 | Ga0495648_0050272_374_1768 | 464 |
| 498 | 3300046526 | Ga0495666_0003464 | Ga0495666_0003464_4180_5574 | 464 |
| 499 | 3300046526 | Ga0495666_0004621 | Ga0495666_0004621_1076_2470 | 464 |
| 500 | 3300046526 | Ga0495666_0011094 | Ga0495666_0011094_2370_3764 | 464 |
| 501 | 3300046529 | Ga0495652_0040394 | Ga0495652_0040394_394_1788 | 464 |
| 502 | 3300046530 | Ga0495654_0061314 | Ga0495654_0061314_184_1590 | 464 |
| 503 | 3300046533 | Ga0495640_0002986 | Ga0495640_0002986_6468_7862 | 464 |
| 504 | 3300046533 | Ga0495640_0048205 | Ga0495640_0048205_317_1711 | 464 |
| 505 | 3300046543 | Ga0495645_0001683 | Ga0495645_0001683_3135_4529 | 464 |
| 506 | 3300046557 | Ga0495622_0000880 | Ga0495622_0000880_7152_8546 | 464 |
| 507 | 3300046557 | Ga0495622_0018803 | Ga0495622_0018803_1034_2428 | 464 |
| 508 | 3300046559 | Ga0495667_0032052 | Ga0495667_0032052_95_1501 | 464 |
| 509 | 3300046642 | Ga0495634_0004092 | Ga0495634_0004092_3465_4859 | 464 |
| 510 | 3300046642 | Ga0495634_0009265 | Ga0495634_0009265_130_1524 | 464 |
| 511 | 3300046660 | Ga0495625_0081073 | Ga0495625_0081073_62_1456 | 464 |
| 512 | 3300046663 | Ga0495635_0012758 | Ga0495635_0012758_962_2356 | 464 |
| 513 | 3300046663 | Ga0495635_0018948 | Ga0495635_0018948_691_2085 | 464 |
| 514 | 3300046663 | Ga0495635_0028210 | Ga0495635_0028210_320_1714 | 464 |
| 515 | 3300046665 | Ga0495661_0001337 | Ga0495661_0001337_14413_15807 | 464 |
| 516 | 3300046665 | Ga0495661_0011631 | Ga0495661_0011631_4404_5798 | 464 |
| 517 | 3300046674 | Ga0495588_0051671 | Ga0495588_0051671_45_1451 | 464 |
| 518 | 3300046675 | Ga0495657_0050263 | Ga0495657_0050263_381_1775 | 464 |
| 519 | 3300046678 | Ga0495599_0016168 | Ga0495599_0016168_2809_4203 | 464 |
| 520 | 3300046679 | Ga0495623_0008796 | Ga0495623_0008796_1697_3091 | 464 |
| 521 | 3300046680 | Ga0495646_0001798 | Ga0495646_0001798_10462_11856 | 464 |
| 522 | 3300046689 | Ga0495613_0028123 | Ga0495613_0028123_1074_2468 | 464 |
| 523 | 3300046689 | Ga0495613_0037701 | Ga0495613_0037701_1004_2398 | 464 |
| 524 | 3300046690 | Ga0495624_0010339 | Ga0495624_0010339_3672_5066 | 464 |
| 525 | 3300046690 | Ga0495624_0019421 | Ga0495624_0019421_2346_3740 | 464 |
| 526 | 3300046690 | Ga0495624_0034551 | Ga0495624_0034551_940_2334 | 464 |
| 527 | 3300046690 | Ga0495624_0077654 | Ga0495624_0077654_361_1755 | 464 |
| 528 | 3300046691 | Ga0495670_0008646 | Ga0495670_0008646_1501_2907 | 464 |
| 529 | 3300046692 | Ga0495671_0006874 | Ga0495671_0006874_738_2132 | 464 |
| 530 | 3300046794 | Ga0495589_0000928 | Ga0495589_0000928_14391_15785 | 464 |
| 531 | 3300046794 | Ga0495589_0010014 | Ga0495589_0010014_3083_4489 | 464 |
| 532 | 3300046794 | Ga0495589_0049716 | Ga0495589_0049716_85_1479 | 464 |
| 533 | 3300046809 | Ga0495600_0001945 | Ga0495600_0001945_6052_7446 | 464 |
| 534 | 3300047315 | Ga0495581_0018968 | Ga0495581_0018968_1336_2742 | 464 |
| 535 | 3300047317 | Ga0495604_0006905 | Ga0495604_0006905_5891_7285 | 464 |
| 536 | 3300047317 | Ga0495604_0007838 | Ga0495604_0007838_6485_7879 | 464 |
| 537 | 3300047319 | Ga0495674_0079395 | Ga0495674_0079395_1242_2657 | 464 |
| 538 | 3300047319 | Ga0495674_0132611 | Ga0495674_0132611_541_1935 | 464 |
| 539 | 3300047321 | Ga0495676_0005874 | Ga0495676_0005874_6567_7961 | 464 |
| 540 | 3300047321 | Ga0495676_0020180 | Ga0495676_0020180_190_1584 | 464 |
| 541 | 3300047322 | Ga0495680_0052605 | Ga0495680_0052605_774_2168 | 464 |
| 542 | 3300047323 | Ga0495683_0002027 | Ga0495683_0002027_10968_12368 | 464 |
| 543 | 3300047323 | Ga0495683_0018507 | Ga0495683_0018507_887_2281 | 464 |
| 544 | 3300047323 | Ga0495683_0067460 | Ga0495683_0067460_332_1726 | 464 |
| 545 | 3300047443 | Ga0495687_000104 | Ga0495687_000104_66276_67676 | 464 |
| 546 | 3300047443 | Ga0495687_011819 | Ga0495687_011819_355_1749 | 464 |
| 547 | 3300047443 | Ga0495687_023572 | Ga0495687_023572_1084_2478 | 464 |
| 548 | 3300047444 | Ga0495675_0001679 | Ga0495675_0001679_5632_7026 | 464 |
| 549 | 3300047444 | Ga0495675_0023657 | Ga0495675_0023657_2287_3681 | 464 |
| 550 | 3300047446 | Ga0495679_000062 | Ga0495679_000062_43455_44849 | 464 |
| 551 | 3300047469 | Ga0495673_0027555 | Ga0495673_0027555_503_1897 | 464 |
| 552 | 3300047471 | Ga0495684_0031865 | Ga0495684_0031865_233_1627 | 464 |
| 553 | 3300047471 | Ga0495684_0183711 | Ga0495684_0183711_65_1459 | 464 |
| 554 | 3300047472 | Ga0495686_0000468 | Ga0495686_0000468_58594_60009 | 464 |
| 555 | 3300047673 | Ga0495593_0003580 | Ga0495593_0003580_6305_7699 | 464 |
| 556 | 3300047673 | Ga0495593_0007871 | Ga0495593_0007871_3975_5369 | 464 |
| 557 | 3300047673 | Ga0495593_0023731 | Ga0495593_0023731_1013_2407 | 464 |
| 558 | 3300048088 | Ga0495602_0000856 | Ga0495602_0000856_8380_9774 | 464 |
| 559 | 3300048088 | Ga0495602_0010590 | Ga0495602_0010590_6339_7733 | 464 |
| 560 | 3300048088 | Ga0495602_0076492 | Ga0495602_0076492_699_2093 | 464 |
| 561 | 3300048089 | Ga0495614_0024723 | Ga0495614_0024723_91_1485 | 464 |
| 562 | 3300048089 | Ga0495614_0033440 | Ga0495614_0033440_138_1532 | 464 |
| 563 | 3300048089 | Ga0495614_0033967 | Ga0495614_0033967_776_2170 | 464 |
| 564 | 3300048091 | Ga0495626_0016822 | Ga0495626_0016822_165_1559 | 464 |
| 565 | 3300048903 | Ga0496100_0068740 | Ga0496100_0068740_128_1534 | 464 |
| 566 | 3300048903 | Ga0496100_0104330 | Ga0496100_0104330_374_1774 | 464 |
| 567 | 3300048904 | Ga0496101_0080148 | Ga0496101_0080148_815_2215 | 464 |
| 568 | 3300048905 | Ga0496102_0144172 | Ga0496102_0144172_112_1506 | 464 |
| 569 | 3300048905 | Ga0496102_0153891 | Ga0496102_0153891_657_2057 | 464 |
| 570 | 3300048905 | Ga0496102_0174515 | Ga0496102_0174515_545_1939 | 464 |
| 571 | 3300048906 | Ga0496103_0030441 | Ga0496103_0030441_1020_2414 | 464 |
| 572 | 3300048909 | Ga0496106_0126753 | Ga0496106_0126753_436_1836 | 464 |
| 573 | 3300048910 | Ga0496107_0104139 | Ga0496107_0104139_48_1454 | 464 |
| 574 | 3300048913 | Ga0496110_0024587 | Ga0496110_0024587_3538_4938 | 464 |
| 575 | 3300048914 | Ga0496111_0054961 | Ga0496111_0054961_931_2331 | 464 |
| 576 | 3300048916 | Ga0496113_0121274 | Ga0496113_0121274_465_1865 | 464 |
| 577 | 3300048917 | Ga0496114_0006019 | Ga0496114_0006019_7257_8663 | 464 |
| 578 | 3300048920 | Ga0496117_0016090 | Ga0496117_0016090_327_1721 | 464 |
| 579 | 3300048920 | Ga0496117_0036972 | Ga0496117_0036972_826_2220 | 464 |
| 580 | 3300048920 | Ga0496117_0051740 | Ga0496117_0051740_420_1814 | 464 |
| 581 | 3300048921 | Ga0496118_0004252 | Ga0496118_0004252_2720_4114 | 464 |
| 582 | 3300048921 | Ga0496118_0013496 | Ga0496118_0013496_4342_5736 | 464 |
| 583 | 3300048921 | Ga0496118_0022383 | Ga0496118_0022383_3598_4992 | 464 |
| 584 | 3300048921 | Ga0496118_0024054 | Ga0496118_0024054_2820_4214 | 464 |
| 585 | 3300048921 | Ga0496118_0061389 | Ga0496118_0061389_1022_2416 | 464 |
| 586 | 3300048922 | Ga0496119_0057709 | Ga0496119_0057709_460_1854 | 464 |
| 587 | 3300048924 | Ga0496121_0000437 | Ga0496121_0000437_78186_79580 | 464 |
| 588 | 3300048924 | Ga0496121_0047186 | Ga0496121_0047186_262_1656 | 464 |
| 589 | 3300048924 | Ga0496121_0093773 | Ga0496121_0093773_761_2161 | 464 |
| 590 | 3300048924 | Ga0496121_0110339 | Ga0496121_0110339_648_2042 | 464 |
| 591 | 3300048927 | Ga0496124_0027531 | Ga0496124_0027531_3146_4546 | 464 |
| 592 | 3300048929 | Ga0496126_0000034 | Ga0496126_0000034_48133_49548 | 464 |
| 593 | 3300048929 | Ga0496126_0000882 | Ga0496126_0000882_13673_15067 | 464 |
| 594 | 3300048929 | Ga0496126_0006636 | Ga0496126_0006636_2863_4257 | 464 |
| 595 | iso_pu_bacteria | 2519103095 | 2519463197 | 464 |
| 596 | iso_pu_bacteria | 2816332253 | 2817263425 | 464 |
| 597 | iso_pu_bacteria | 2816332256 | 2817276801 | 464 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1p5g-assembly1.cif.gz_X | enzyme-ligand complex of p. aeruginosa pmm/pgm | 0.9809 | 5 | 464 |
| 2fkm-assembly1.cif.gz_X | pmm/pgm s108d mutant with alpha-d-glucose 1,6-bisphosphate bound | 0.979 | 3 | 464 |
| 3uw2-assembly1.cif.gz_A | x-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis | 0.9774 | 1 | 464 |
| 2fkm-assembly1.cif.gz_X | pmm/pgm s108d mutant with alpha-d-glucose 1,6-bisphosphate bound | 0.9769 | 3 | 464 |
| 3uw2-assembly1.cif.gz_A | x-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis | 0.9753 | 1 | 464 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1p5dX04 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain | 0.9853 | 371 | 464 | 3.30.310.50 |
| 1k35A01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9772 | 5 | 155 | 3.40.120.10 |
| 1p5dX04 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain | 0.9749 | 371 | 464 | 3.30.310.50 |
| 3rsmA01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.971 | 20 | 155 | 3.40.120.10 |
| 1k35A03 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9687 | 253 | 369 | 3.40.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A011P127-F1-model_v4 | Phosphomannomutase/phosphoglucomutase (EC 5.4.2.2) | 0.9969 | 267 | 464 |
GO:0004614
GO:0005975 |
| AF-A0A6H3H9M6-F1-model_v4 | deleted | 0.9958 | 1 | 154 |
|
| AF-F0G1Q5-F1-model_v4 | Phosphomannomutase | 0.9947 | 1 | 194 |
GO:0005975
GO:0016868 |
| AF-A0A2N2S6X9-F1-model_v4 | Phosphomannomutase/phosphoglucomutase (EC 5.4.2.2, EC 5.4.2.8) | 0.9923 | 323 | 464 |
GO:0004614
GO:0004615 GO:0005975 |
| AF-A0A7V8MXU0-F1-model_v4 | deleted | 0.9917 | 1 | 418 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar