F467641

General Info

Members Datasets Scaffolds Average Seq Length
597 394 1194 445

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100194851|Ga0068856_1001948511
Length 481
Sequence LWTSLSCLTKPSRPVSLQPEIIPPGSREPLAASEIAQAVKDGRLSALAVTEATLARIAKRDGVLNSFTDVTADRARTRARAIDAAIAAGKNPGALAGVPLAVKNLFDVQGLPTRAGSRINRDAAPAARDAALIERLEAAGAVLVGALNMGEYAYDFTGENIHDGPSRNPHDPSRMTGGSSVGGALVPLALGSDTNGSIRVPSSFCGVFGLKPTYGRLSRARTFPFVFSLDHLGPLARNVGDLALAYDAMQGADADDAACTARPAEPVFASLTQATGDLRIAVAGGYFQKNVFPEAVEAVARVAKALGATRTVEIPEAARARAAAYVITTCEGASLHLERLRRRPNDFDPAVRDRLIAGAMIPAPMVDRAQKFRRWYRQQVLELFKSVDVILAPATPCVAPKLGQATFVLDGVELPVRAHIGIHTQPISFIGLPVVAVPVALDPLPIGVQIIVPPWRENVALRVAYALERMGTAFAPQPMGI

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
43 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
44 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
59 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
60 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
61 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
98 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
99 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
100 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
264 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
265 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
268 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
269 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
270 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
273 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
274 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
275 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
278 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
279 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
280 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
281 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
284 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
285 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
286 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
287 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
288 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
289 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
290 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
291 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
292 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
293 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
294 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
295 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
296 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
297 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
298 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
299 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
300 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
301 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
302 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
303 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
304 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
305 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
306 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
307 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
308 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
309 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
310 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
311 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
312 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
313 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
314 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
315 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
316 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
317 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
318 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
319 2842694124 Methylopila sp. R-72369 Isolate Unclassified
320 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
321 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
322 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
323 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
324 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
325 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
326 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
327 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
328 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
329 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
330 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
331 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
332 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
333 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
334 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
335 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
336 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
337 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
338 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
339 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
340 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
341 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
342 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
343 2906610324
344 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
345 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
346 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
347 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
348 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
349 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
350 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
351 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
352 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
353 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
354 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
355 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
356 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
357 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
358 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
359 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
360 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
361 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
362 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
363 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
364 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
365 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
366 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
367 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
368 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
369 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
370 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
371 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
372 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
373 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
374 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
375 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
376 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
377 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
378 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
379 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
380 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
381 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
382 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
383 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
384 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
385 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
386 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
387 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
388 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
389 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
390 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
391 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
392 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
393 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
394 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.55
Metatranscriptomes 0.17
Isolates 17.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.41
Nodule 16.25
Rhizoplane 5.36
Rhizosphere 51.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100194851 3300005614 Bacteria 2040
2 JGI25406J46586_10000471 3300003203 Bacteria 18790
3 JGI25165J46597_1004300 3300003214 Bacteria 3114
4 JGI25153J46596_10002109 3300003215 Bacteria 11645
5 JGI25153J46596_10004526 3300003215 Bacteria 7477
6 JGI25153J46596_10012156 3300003215 Bacteria 3741
7 JGI25153J46596_10012608 3300003215 Bacteria 3630
8 JGI25160J50197_1002305 3300003354 Bacteria 8949
9 JGI25160J50197_1005985 3300003354 Bacteria 4991
10 JGI25404J52841_10003282 3300003659 Bacteria 3179
11 Ga0055531_10021605 3300003794 Bacteria 2489
12 Ga0055543_1003281 3300004625 Bacteria 4867
13 Ga0065165_1005102 3300005262 Bacteria 7628
14 Ga0068868_100099635 3300005338 Bacteria 2351
15 Ga0070671_100031378 3300005355 Bacteria 4389
16 Ga0070709_10001435 3300005434 Bacteria 12865
17 Ga0070709_10006237 3300005434 Bacteria 6489
18 Ga0070709_10042500 3300005434 Bacteria 2807
19 Ga0070714_100141706 3300005435 Bacteria 2159
20 Ga0070713_100009559 3300005436 Bacteria 6952
21 Ga0070713_100023379 3300005436 Bacteria 4796
22 Ga0070713_100051353 3300005436 Bacteria 3409
23 Ga0070710_10003070 3300005437 Bacteria 7934
24 Ga0070710_10006535 3300005437 Bacteria 5605
25 Ga0070711_100002872 3300005439 Bacteria 9922
26 Ga0070711_100007255 3300005439 Bacteria 6734
27 Ga0070711_100066959 3300005439 Bacteria 2518
28 Ga0070663_100017505 3300005455 Bacteria 4679
29 Ga0070678_100007756 3300005456 Bacteria 6383
30 Ga0070681_10062334 3300005458 Bacteria 3702
31 Ga0070698_100164481 3300005471 Bacteria 2162
32 Ga0070679_100034288 3300005530 Bacteria 5030
33 Ga0070679_100040567 3300005530 Bacteria 4631
34 Ga0070679_100151264 3300005530 Bacteria 2297
35 Ga0070679_100240153 3300005530 Bacteria 1769
36 Ga0070684_100010499 3300005535 Bacteria 7338
37 Ga0068853_100032206 3300005539 Bacteria 4440
38 Ga0070693_100025488 3300005547 Bacteria 3184
39 Ga0070665_100101028 3300005548 Bacteria 2888
40 Ga0070665_100200956 3300005548 Bacteria 1993
41 Ga0068855_100120990 3300005563 Bacteria 2996
42 Ga0070664_100060034 3300005564 Bacteria 3237
43 Ga0068856_100014815 3300005614 Bacteria 7527
44 Ga0068856_100126719 3300005614 Bacteria 2557
45 Ga0068852_100038062 3300005616 Bacteria 4039
46 Ga0068860_100002058 3300005843 Bacteria 21189
47 Ga0068862_100078953 3300005844 Bacteria 2852
48 Ga0081455_10006198 3300005937 Bacteria 12894
49 Ga0081455_10021542 3300005937 Bacteria 6043
50 Ga0081455_10023244 3300005937 Bacteria 5774
51 Ga0081455_10080872 3300005937 Bacteria 2663
52 Ga0081540_1002527 3300005983 Bacteria 14845
53 Ga0081540_1004494 3300005983 Bacteria 10596
54 Ga0081540_1004784 3300005983 Bacteria 10207
55 Ga0081540_1005108 3300005983 Bacteria 9845
56 Ga0081540_1006449 3300005983 Bacteria 8541
57 Ga0081540_1009916 3300005983 Bacteria 6498
58 Ga0081540_1023303 3300005983 Bacteria 3624
59 Ga0081540_1023634 3300005983 Bacteria 3589
60 Ga0081540_1031883 3300005983 Bacteria 2887
61 Ga0081539_10000048 3300005985 Bacteria 272906
62 Ga0081539_10019994 3300005985 Bacteria 4554
63 Ga0070717_10006987 3300006028 Bacteria 8350
64 Ga0070717_10019819 3300006028 Bacteria 5280
65 Ga0070717_10077195 3300006028 Bacteria 2788
66 Ga0075365_10008364 3300006038 Bacteria 5867
67 Ga0075365_10016090 3300006038 Bacteria 4540
68 Ga0075365_10019967 3300006038 Bacteria 4146
69 Ga0075365_10058946 3300006038 Bacteria 2557
70 Ga0070715_10015520 3300006163 Bacteria 2843
71 Ga0070716_100001410 3300006173 Bacteria 10662
72 Ga0070712_100007612 3300006175 Bacteria 6771
73 Ga0070712_100035265 3300006175 Bacteria 3396
74 Ga0075367_10036631 3300006178 Bacteria 2846
75 Ga0075370_10032088 3300006353 Bacteria 2934
76 Ga0075370_10057194 3300006353 Bacteria 2216
77 Ga0075428_100197345 3300006844 Bacteria 2176
78 Ga0099825_1026268 3300006941 Bacteria 3123
79 Ga0099824_1004372 3300006942 Bacteria 20372
80 Ga0099823_1022824 3300006944 Bacteria 5771
81 Ga0099794_10008383 3300007265 Bacteria 4291
82 Ga0105240_10081136 3300009093 Bacteria 3987
83 Ga0105240_10214150 3300009093 Bacteria 2249
84 Ga0105247_10026513 3300009101 Bacteria 3500
85 Ga0114129_10139792 3300009147 Bacteria 3320
86 Ga0105241_10031842 3300009174 Bacteria 3949
87 Ga0105237_10098769 3300009545 Bacteria 2910
88 Ga0105238_10041922 3300009551 Bacteria 4636
89 Ga0105238_10049949 3300009551 Bacteria 4211
90 Ga0105239_10041089 3300010375 Bacteria 5068
91 Ga0105239_10167149 3300010375 Bacteria 2460
92 Ga0157374_10046331 3300013296 Bacteria 4026
93 Ga0157378_10022522 3300013297 Bacteria 5543
94 Ga0157379_10051438 3300014968 Bacteria 3680
95 Ga0157376_10138263 3300014969 Bacteria 2182
96 Ga0206353_10559486 3300020082 Bacteria 1606
97 Ga0214544_1000003 3300021320 Bacteria 643752
98 Ga0214542_1000003 3300021321 Bacteria 435700
99 Ga0214545_1000004 3300021324 Bacteria 453352
100 Ga0214543_1000007 3300021327 Bacteria 414744
101 Ga0213873_10018834 3300021358 Bacteria 1593
102 Ga0213876_10002313 3300021384 Bacteria 11242
103 Ga0213871_10003226 3300021441 Bacteria 3117
104 Ga0209677_101261 3300025253 Bacteria 11366
105 Ga0209148_1000351 3300025254 Bacteria 59739
106 Ga0209233_1004670 3300025261 Bacteria 4625
107 Ga0209455_1005444 3300025272 Bacteria 3931
108 Ga0209564_1003721 3300025295 Bacteria 9997
109 Ga0209758_1000015 3300025297 Bacteria 851943
110 Ga0209758_1000224 3300025297 Bacteria 121530
111 Ga0209758_1001252 3300025297 Bacteria 31479
112 Ga0209758_1005621 3300025297 Bacteria 9519
113 Ga0209758_1008757 3300025297 Bacteria 6457
114 Ga0209758_1016184 3300025297 Bacteria 3803
115 Ga0209256_1006394 3300025299 Bacteria 6263
116 Ga0207426_1000585 3300025302 Bacteria 48529
117 Ga0209257_1000440 3300025304 Bacteria 79182
118 Ga0209257_1011507 3300025304 Bacteria 4249
119 Ga0207697_10025131 3300025315 Bacteria 2436
120 Ga0207692_10006989 3300025898 Bacteria 4606
121 Ga0207692_10013152 3300025898 Bacteria 3582
122 Ga0207692_10023804 3300025898 Bacteria 2838
123 Ga0207692_10024941 3300025898 Bacteria 2787
124 Ga0207647_10009677 3300025904 Bacteria 6841
125 Ga0207685_10008958 3300025905 Bacteria 2884
126 Ga0207699_10000386 3300025906 Bacteria 23177
127 Ga0207699_10001899 3300025906 Bacteria 9840
128 Ga0207654_10018970 3300025911 Bacteria 3618
129 Ga0207707_10000816 3300025912 Bacteria 30547
130 Ga0207707_10016028 3300025912 Bacteria 6536
131 Ga0207707_10032139 3300025912 Bacteria 4594
132 Ga0207695_10000065 3300025913 Bacteria 336949
133 Ga0207671_10007223 3300025914 Bacteria 9676
134 Ga0207693_10000774 3300025915 Bacteria 28742
135 Ga0207693_10003263 3300025915 Bacteria 13891
136 Ga0207693_10011795 3300025915 Bacteria 7063
137 Ga0207693_10122612 3300025915 Bacteria 2042
138 Ga0207663_10001349 3300025916 Bacteria 11352
139 Ga0207663_10068541 3300025916 Bacteria 2279
140 Ga0207660_10171037 3300025917 Bacteria 1682
141 Ga0207652_10005821 3300025921 Bacteria 9997
142 Ga0207652_10120924 3300025921 Bacteria 2329
143 Ga0207664_10093885 3300025929 Bacteria 2465
144 Ga0207706_10058020 3300025933 Bacteria 3410
145 Ga0207665_10000289 3300025939 Bacteria 34924
146 Ga0207665_10001425 3300025939 Bacteria 16086
147 Ga0207689_10136504 3300025942 Bacteria 2020
148 Ga0207661_10091684 3300025944 Bacteria 2532
149 Ga0207639_10056862 3300026041 Bacteria 3000
150 Ga0207678_10018636 3300026067 Bacteria 6093
151 Ga0207702_10000539 3300026078 Bacteria 42329
152 Ga0207702_10077037 3300026078 Bacteria 2883
153 Ga0207702_10102048 3300026078 Bacteria 2534
154 Ga0207674_10004428 3300026116 Bacteria 16886
155 Ga0207675_100030164 3300026118 Bacteria 5050
156 Ga0209389_1000029 3300027296 Bacteria 140337
157 Ga0209389_1000076 3300027296 Bacteria 92447
158 Ga0209589_1000012 3300027357 Bacteria 229451
159 Ga0209589_1000013 3300027357 Bacteria 229273
160 Ga0209489_100013 3300027361 Bacteria 229831
161 Ga0209489_100416 3300027361 Bacteria 77981
162 Ga0209700_100014 3300027363 Bacteria 299349
163 Ga0268266_10001689 3300028379 Bacteria 25367
164 Ga0268266_10087590 3300028379 Bacteria 2724
165 Ga0268264_10000049 3300028381 Bacteria 329992
166 Ga0265334_10001581 3300028573 Bacteria 10962
167 Ga0265318_10029881 3300028577 Bacteria 2122
168 Ga0265336_10001012 3300028666 Bacteria 13808
169 Ga0307517_10000766 3300028786 Bacteria 55210
170 Ga0307515_10015099 3300028794 Bacteria 14254
171 Ga0307515_10182336 3300028794 Bacteria 2044
172 Ga0265338_10000024 3300028800 Bacteria 297778
173 Ga0265330_10034791 3300031235 Bacteria 2249
174 Ga0265332_10014170 3300031238 Bacteria 3528
175 Ga0265325_10016798 3300031241 Bacteria 4085
176 Ga0265340_10003211 3300031247 Bacteria 9274
177 Ga0265340_10005839 3300031247 Bacteria 6812
178 Ga0265339_10000432 3300031249 Bacteria 32986
179 Ga0265339_10009403 3300031249 Bacteria 6146
180 Ga0265331_10019916 3300031250 Bacteria 3454
181 Ga0265316_10064325 3300031344 Bacteria 2842
182 Ga0265316_10088257 3300031344 Bacteria 2368
183 Ga0265316_10090928 3300031344 Bacteria 2329
184 Ga0307513_10135503 3300031456 Bacteria 2399
185 Ga0307509_10029257 3300031507 Bacteria 6116
186 Ga0265313_10015522 3300031595 Bacteria 4427
187 Ga0307508_10011103 3300031616 Bacteria 8236
188 Ga0307508_10083047 3300031616 Bacteria 2786
189 Ga0265314_10002061 3300031711 Bacteria 21230
190 Ga0265314_10021684 3300031711 Bacteria 4933
191 Ga0265314_10026727 3300031711 Bacteria 4332
192 Ga0265342_10000031 3300031712 Bacteria 152577
193 Ga0265342_10006253 3300031712 Bacteria 8889
194 Ga0265342_10061614 3300031712 Bacteria 2210
195 Ga0307516_10048770 3300031730 Bacteria 4166
196 Ga0307406_10082824 3300031901 Bacteria 2138
197 Ga0307409_100090356 3300031995 Bacteria 2507
198 Ga0307510_10011049 3300033180 Bacteria 10732
199 Ga0307510_10030284 3300033180 Bacteria 6136
200 Ga0315911_1000024 3300033442 Bacteria 97712
201 Ga0373923_0000022 3300035111 Bacteria 23262
202 Ga0373953_0001610 3300035117 Bacteria 6605
203 Ga0373953_0015235 3300035117 Bacteria 2781
204 Ga0373954_0000519 3300035118 Bacteria 14460
205 Ga0373954_0061066 3300035118 Bacteria 1778
206 Ga0373957_0002302 3300035120 Bacteria 5424
207 Ga0373943_0001832 3300035170 Bacteria 9614
208 Ga0373946_0021484 3300035171 Bacteria 2503
209 Ga0373955_0050528 3300035172 Bacteria 2261
210 Ga0373935_0000244 3300035692 Bacteria 26819
211 Ga0373935_0035558 3300035692 Bacteria 3110
212 Ga0373927_0001820 3300035695 Bacteria 15839
213 Ga0373927_0003221 3300035695 Bacteria 11752
214 Ga0373933_0000374 3300035724 Bacteria 28691
215 Ga0373933_0062505 3300035724 Bacteria 2249
216 Ga0373947_0002144 3300035725 Bacteria 11991
217 Ga0373947_0008108 3300035725 Bacteria 6055
218 Ga0373937_0003416 3300036401 Bacteria 13330
219 Ga0395899_0092351 3300037312 Bacteria 2192
220 Ga0395900_0005774 3300037418 Bacteria 12930
221 Ga0395898_0004005 3300037466 Bacteria 16206
222 Ga0395905_0023500 3300037471 Bacteria 5824
223 Ga0395901_0104412 3300038443 Bacteria 2974
224 Ga0436365_0989879 3300039437 Bacteria 21862
225 Ga0436360_1052272 3300039438 Bacteria 1938
226 Ga0436362_0816704 3300039453 Bacteria 2104
227 Ga0436362_0876959 3300039453 Bacteria 8029
228 Ga0466972_0000048 3300044658 Bacteria 119165
229 Ga0466966_0000238 3300044684 Bacteria 36401
230 Ga0466961_0000044 3300044693 Bacteria 76071
231 Ga0466964_0018381 3300044706 Bacteria 2682
232 Ga0466968_0004386 3300044735 Bacteria 5269
233 Ga0466957_0033689 3300044842 Bacteria 3074
234 Ga0466959_0000963 3300045049 Bacteria 17121
235 Ga0466959_0014545 3300045049 Bacteria 5724
236 Ga0466958_0023391 3300045836 Bacteria 3628
237 Ga0466967_0029200 3300045976 Bacteria 4613
238 Ga0495592_0006994 3300046454 Bacteria 8432
239 Ga0495592_0025947 3300046454 Bacteria 4445
240 Ga0495603_0000370 3300046455 Bacteria 24383
241 Ga0495603_0006854 3300046455 Bacteria 6834
242 Ga0495603_0010858 3300046455 Bacteria 5525
243 Ga0495603_0103956 3300046455 Bacteria 1658
244 Ga0495629_0000081 3300046459 Bacteria 85305
245 Ga0495629_0000380 3300046459 Bacteria 37205
246 Ga0495629_0001706 3300046459 Bacteria 17249
247 Ga0495629_0027158 3300046459 Bacteria 4066
248 Ga0495629_0169158 3300046459 Bacteria 1517
249 Ga0495638_0040121 3300046460 Bacteria 2967
250 Ga0495638_0045735 3300046460 Bacteria 2752
251 Ga0495638_0046663 3300046460 Bacteria 2721
252 Ga0495641_0037572 3300046461 Bacteria 2268
253 Ga0495651_0001544 3300046462 Bacteria 17788
254 Ga0495651_0009321 3300046462 Bacteria 7534
255 Ga0495651_0025096 3300046462 Bacteria 4638
256 Ga0495653_0008281 3300046463 Bacteria 8525
257 Ga0495653_0032374 3300046463 Bacteria 4152
258 Ga0495580_0000435 3300046472 Bacteria 34468
259 Ga0495580_0021347 3300046472 Bacteria 4778
260 Ga0495580_0033867 3300046472 Bacteria 3679
261 Ga0495582_0000051 3300046473 Bacteria 59010
262 Ga0495582_0021176 3300046473 Bacteria 3560
263 Ga0495639_0000010 3300046475 Bacteria 93685
264 Ga0495639_0036105 3300046475 Bacteria 2212
265 Ga0495662_0015859 3300046476 Bacteria 3656
266 Ga0495664_0003734 3300046477 Bacteria 8306
267 Ga0495664_0006633 3300046477 Bacteria 6400
268 Ga0495584_0007389 3300046491 Bacteria 5731
269 Ga0495594_0001553 3300046499 Bacteria 11928
270 Ga0495607_0015021 3300046501 Bacteria 5030
271 Ga0495606_0000265 3300046507 Bacteria 92526
272 Ga0495606_0024523 3300046507 Bacteria 4343
273 Ga0495606_0134060 3300046507 Bacteria 1469
274 Ga0495608_0006818 3300046511 Bacteria 8098
275 Ga0495628_0006851 3300046516 Bacteria 9905
276 Ga0495630_0011435 3300046517 Bacteria 6429
277 Ga0495632_0057414 3300046519 Bacteria 1900
278 Ga0495637_0046494 3300046520 Bacteria 1836
279 Ga0495643_0026421 3300046522 Bacteria 3277
280 Ga0495648_0000271 3300046524 Bacteria 58164
281 Ga0495648_0004027 3300046524 Bacteria 12693
282 Ga0495648_0004338 3300046524 Bacteria 12147
283 Ga0495648_0007795 3300046524 Bacteria 8519
284 Ga0495652_0007397 3300046529 Bacteria 10125
285 Ga0495652_0020559 3300046529 Bacteria 5867
286 Ga0495665_0000005 3300046531 Bacteria 86491
287 Ga0495640_0000301 3300046533 Bacteria 33996
288 Ga0495640_0009451 3300046533 Bacteria 7596
289 Ga0495640_0012766 3300046533 Bacteria 6412
290 Ga0495640_0013425 3300046533 Bacteria 6223
291 Ga0495586_0113090 3300046535 Bacteria 1512
292 Ga0495587_0002764 3300046536 Bacteria 11712
293 Ga0495587_0011668 3300046536 Bacteria 5562
294 Ga0495587_0033875 3300046536 Bacteria 3081
295 Ga0495645_0079303 3300046543 Bacteria 2358
296 Ga0495622_0003164 3300046557 Bacteria 7794
297 Ga0495622_0019048 3300046557 Bacteria 3197
298 Ga0495622_0066421 3300046557 Bacteria 1667
299 Ga0495667_0030543 3300046559 Bacteria 3620
300 Ga0495667_0061802 3300046559 Bacteria 2455
301 Ga0495656_0001491 3300046615 Bacteria 7662
302 Ga0495634_0000764 3300046642 Bacteria 31101
303 Ga0495634_0008147 3300046642 Bacteria 7807
304 Ga0495634_0026354 3300046642 Bacteria 4058
305 Ga0495634_0103224 3300046642 Bacteria 1840
306 Ga0495625_0040142 3300046660 Bacteria 3416
307 Ga0495625_0079134 3300046660 Bacteria 2293
308 Ga0495625_0087934 3300046660 Bacteria 2153
309 Ga0495635_0000213 3300046663 Bacteria 36809
310 Ga0495635_0000259 3300046663 Bacteria 33960
311 Ga0495635_0005005 3300046663 Bacteria 9223
312 Ga0495635_0099120 3300046663 Bacteria 1991
313 Ga0495659_0006006 3300046664 Bacteria 3837
314 Ga0495659_0009037 3300046664 Bacteria 3176
315 Ga0495661_0009639 3300046665 Bacteria 6617
316 Ga0495588_0006723 3300046674 Bacteria 5196
317 Ga0495588_0021656 3300046674 Bacteria 3170
318 Ga0495657_0002844 3300046675 Bacteria 14362
319 Ga0495657_0016391 3300046675 Bacteria 5399
320 Ga0495623_0005373 3300046679 Bacteria 8381
321 Ga0495623_0014745 3300046679 Bacteria 5052
322 Ga0495646_0017294 3300046680 Bacteria 4574
323 Ga0495647_0000671 3300046681 Bacteria 10182
324 Ga0495647_0028812 3300046681 Bacteria 2050
325 Ga0495658_0010836 3300046683 Bacteria 4566
326 Ga0495613_0031679 3300046689 Bacteria 3928
327 Ga0495624_0000094 3300046690 Bacteria 59911
328 Ga0495670_0027112 3300046691 Bacteria 2836
329 Ga0495600_0001162 3300046809 Bacteria 14346
330 Ga0495600_0133818 3300046809 Bacteria 1611
331 Ga0495581_0000810 3300047315 Bacteria 16618
332 Ga0495581_0019197 3300047315 Bacteria 3967
333 Ga0495581_0064221 3300047315 Bacteria 2121
334 Ga0495604_0033791 3300047317 Bacteria 4047
335 Ga0495604_0057292 3300047317 Bacteria 2996
336 Ga0495604_0125420 3300047317 Bacteria 1852
337 Ga0495604_0159196 3300047317 Bacteria 1597
338 Ga0495636_0009585 3300047318 Bacteria 3814
339 Ga0495674_0000955 3300047319 Bacteria 27621
340 Ga0495672_0006198 3300047320 Bacteria 9324
341 Ga0495672_0030505 3300047320 Bacteria 3380
342 Ga0495676_0020537 3300047321 Bacteria 5792
343 Ga0495676_0022280 3300047321 Bacteria 5514
344 Ga0495680_0002637 3300047322 Bacteria 18206
345 Ga0495680_0004426 3300047322 Bacteria 13424
346 Ga0495675_0000756 3300047444 Bacteria 20233
347 Ga0495675_0009113 3300047444 Bacteria 6169
348 Ga0495673_0031996 3300047469 Bacteria 2458
349 Ga0495684_0000052 3300047471 Bacteria 85125
350 Ga0495593_0000084 3300047673 Bacteria 41155
351 Ga0495602_0011425 3300048088 Bacteria 9182
352 Ga0495602_0053428 3300048088 Bacteria 3578
353 Ga0495602_0111923 3300048088 Bacteria 2216
354 Ga0495626_0040243 3300048091 Bacteria 2209
355 Ga0496100_0014294 3300048903 Bacteria 4606
356 Ga0496101_0020764 3300048904 Bacteria 4504
357 Ga0496102_0005804 3300048905 Bacteria 10496
358 Ga0496102_0066766 3300048905 Bacteria 3297
359 Ga0496103_0017638 3300048906 Bacteria 4273
360 Ga0496103_0023140 3300048906 Bacteria 3746
361 Ga0496104_0023685 3300048907 Bacteria 5646
362 Ga0496104_0090783 3300048907 Bacteria 2919
363 Ga0496104_0121874 3300048907 Bacteria 2504
364 Ga0496104_0263674 3300048907 Bacteria 1635
365 Ga0496105_0064838 3300048908 Bacteria 3014
366 Ga0496105_0073921 3300048908 Bacteria 2816
367 Ga0496106_0001452 3300048909 Bacteria 17800
368 Ga0496106_0158597 3300048909 Bacteria 1788
369 Ga0496106_0188782 3300048909 Bacteria 1638
370 Ga0496107_0016390 3300048910 Bacteria 5202
371 Ga0496109_0016364 3300048912 Bacteria 6482
372 Ga0496109_0059237 3300048912 Bacteria 3498
373 Ga0496110_0003476 3300048913 Bacteria 12083
374 Ga0496112_0000019 3300048915 Bacteria 185531
375 Ga0496112_0007159 3300048915 Bacteria 9877
376 Ga0496112_0099712 3300048915 Bacteria 2875
377 Ga0496112_0132000 3300048915 Bacteria 2468
378 Ga0496112_0217233 3300048915 Bacteria 1868
379 Ga0496113_0053179 3300048916 Bacteria 3027
380 Ga0496113_0079517 3300048916 Bacteria 2510
381 Ga0496113_0207665 3300048916 Bacteria 1558
382 Ga0496114_0016833 3300048917 Bacteria 5896
383 Ga0496114_0095643 3300048917 Bacteria 2528
384 Ga0496115_0001776 3300048918 Bacteria 15451
385 Ga0496115_0078574 3300048918 Bacteria 2684
386 Ga0496115_0114564 3300048918 Bacteria 2216
387 Ga0496116_0002417 3300048919 Bacteria 19673
388 Ga0496117_0018002 3300048920 Bacteria 5878
389 Ga0496117_0037758 3300048920 Bacteria 3593
390 Ga0496118_0008852 3300048921 Bacteria 10300
391 Ga0496118_0045553 3300048921 Bacteria 3422
392 Ga0496118_0056203 3300048921 Bacteria 2961
393 Ga0496118_0096570 3300048921 Bacteria 2013
394 Ga0496119_0008930 3300048922 Bacteria 8707
395 Ga0496119_0041607 3300048922 Bacteria 2924
396 Ga0496120_0034261 3300048923 Bacteria 3044
397 Ga0496121_0000261 3300048924 Bacteria 110085
398 Ga0496121_0002340 3300048924 Bacteria 29257
399 Ga0496121_0010594 3300048924 Bacteria 10360
400 Ga0496121_0012632 3300048924 Bacteria 9174
401 Ga0496121_0023069 3300048924 Bacteria 6011
402 Ga0496121_0040104 3300048924 Bacteria 4112
403 Ga0496121_0092016 3300048924 Bacteria 2365
404 Ga0496121_0094722 3300048924 Bacteria 2322
405 Ga0496121_0181886 3300048924 Bacteria 1516
406 Ga0496122_0066741 3300048925 Bacteria 2596
407 Ga0496122_0087089 3300048925 Bacteria 2147
408 Ga0496123_0054922 3300048926 Bacteria 2617
409 Ga0496123_0055591 3300048926 Bacteria 2595
410 Ga0496124_0002998 3300048927 Bacteria 21122
411 Ga0496125_0003042 3300048928 Bacteria 20965
412 Ga0496125_0020421 3300048928 Bacteria 6217
413 Ga0496125_0047989 3300048928 Bacteria 3565
414 Ga0496125_0057736 3300048928 Bacteria 3140
415 Ga0496125_0072635 3300048928 Bacteria 2679
416 Ga0496126_0001531 3300048929 Bacteria 35598
417 Ga0496126_0007269 3300048929 Bacteria 12174
418 Ga0496126_0011299 3300048929 Bacteria 9262
419 Ga0496126_0022191 3300048929 Bacteria 6182
420 Ga0496126_0029441 3300048929 Bacteria 5217
421 Ga0496126_0034784 3300048929 Bacteria 4727
422 Ga0496126_0043359 3300048929 Bacteria 4150
423 Ga0496126_0047232 3300048929 Bacteria 3942
424 Ga0496126_0066904 3300048929 Bacteria 3212
425 Ga0496126_0186725 3300048929 Bacteria 1757
426 Ga0496126_0242906 3300048929 Bacteria 1503
427 Ga0501042_0162754 3300049578 Bacteria 1610
428 Ga0501046_0112612 3300049580 Bacteria 2077
429 Ga0501047_0046968 3300049581 Bacteria 4172
430 Ga0501070_0064188 3300049586 Bacteria 3041
431 Ga0501080_0064659 3300049742 Bacteria 3402
432 Ga0501044_0139506 3300049823 Bacteria 2413
433 nmdc:mga0yw44_3382_c1 3300050492 Bacteria 7076
434 nmdc:mga06z11_81454_c1 3300050494 Bacteria 1738
435 nmdc:mga04h51_36571_c1 3300050495 Bacteria 1580
436 nmdc:mga07m45_19595_c1 3300050496 Bacteria 3667
437 nmdc:mga07m45_34138_c1 3300050496 Bacteria 2827
438 nmdc:mga07m45_38587_c1 3300050496 Bacteria 2665
439 nmdc:mga05p37_99636_c1 3300050507 Bacteria 3578
440 nmdc:mga0n895_43152_c1 3300050512 Bacteria 4393
441 Ga0495601_0027411 3300053077 Bacteria 3522
442 Ga0500635_0014513 3300053080 Bacteria 2310
443 Ga0495595_0005730 3300053084 Bacteria 5029
444 Ga0495595_0022161 3300053084 Bacteria 2785
445 Ga0495619_0000913 3300053085 Bacteria 19380
446 Ga0495619_0010200 3300053085 Bacteria 5918
447 Ga0500578_0095614 3300053086 Bacteria 1884
448 Ga0500643_000091 3300053087 Bacteria 93825
449 Ga0500644_0023181 3300053088 Bacteria 1882
450 Ga0500581_089994 3300053089 Bacteria 1522
451 Ga0500566_0000199 3300053094 Bacteria 31473
452 Ga0500566_0000762 3300053094 Bacteria 18172
453 Ga0500566_0005554 3300053094 Bacteria 7494
454 Ga0500641_0017426 3300053096 Bacteria 2686
455 Ga0500555_006418 3300053103 Bacteria 3340
456 Ga0500556_0000091 3300053104 Bacteria 83564
457 Ga0500557_000043 3300053105 Bacteria 63389
458 Ga0500562_017462 3300053108 Bacteria 1850
459 Ga0500569_000723 3300053109 Bacteria 5739
460 Ga0500572_001685 3300053111 Bacteria 5771
461 Ga0500593_053885 3300053117 Bacteria 1781
462 Ga0500594_0002936 3300053118 Bacteria 3725
463 Ga0500595_001894 3300053119 Bacteria 10778
464 Ga0500595_002247 3300053119 Bacteria 9783
465 Ga0500595_004559 3300053119 Bacteria 6186
466 Ga0500607_058217 3300053121 Bacteria 2034
467 Ga0500608_038903 3300053122 Bacteria 2276
468 Ga0500608_069067 3300053122 Bacteria 1681
469 Ga0500618_008566 3300053125 Bacteria 2846
470 Ga0500642_0000046 3300053130 Bacteria 82391
471 Ga0500658_0037126 3300053134 Bacteria 1936
472 Ga0500559_0000287 3300053136 Bacteria 38965
473 Ga0500559_0000803 3300053136 Bacteria 20545
474 Ga0500559_0066100 3300053136 Bacteria 1621
475 Ga0500568_0000167 3300053139 Bacteria 56971
476 Ga0500568_0009134 3300053139 Bacteria 4727
477 Ga0500586_000631 3300053145 Bacteria 7153
478 Ga0500588_0013117 3300053146 Bacteria 2073
479 Ga0500590_025663 3300053148 Bacteria 3060
480 Ga0500590_068953 3300053148 Bacteria 1761
481 Ga0500616_0000059 3300053153 Bacteria 259741
482 Ga0500616_0000283 3300053153 Bacteria 74456
483 Ga0500622_0007335 3300053156 Bacteria 6272
484 Ga0500622_0035683 3300053156 Bacteria 2601
485 Ga0500627_0037104 3300053158 Bacteria 2078
486 Ga0500639_002046 3300053163 Bacteria 10075
487 Ga0500636_0000291 3300053177 Bacteria 27724
488 Ga0500636_0010476 3300053177 Bacteria 5410
489 Ga0500636_0037394 3300053177 Bacteria 2872
490 Ga0500637_0001082 3300053178 Bacteria 11204
491 Ga0500645_006160 3300053730 Bacteria 4310
492 Ga0500596_003293 3300053735 Bacteria 3091
493 Ga0500601_000421 3300053737 Bacteria 7093
494 2507504813 2507262055 Bacteria 8048963
495 2508546166 2508501009 Bacteria 7784016
496 2508695100 2508501042 Bacteria 8719808
497 2509149768 2508501128 Bacteria 8613869
498 2513641881 2513237094 Bacteria 8789602
499 2513706303 2513237102 Bacteria 7703324
500 2513858954 2513237137 Bacteria 9558895
501 2513890434 2513237141 Bacteria 8496279
502 2513917349 2513237145 Bacteria 8979722
503 2514012917 2513237161 Bacteria 8871253
504 2515625896 2515154112 Bacteria 8294334
505 2517102419 2517093001 Bacteria 9002274
506 2517889572 2517572143 Bacteria 9484767
507 2524466484 2524023210 Bacteria 9029266
508 2528850369 2528768022 Bacteria 10457665
509 2793063130 2791355196 Bacteria 7323613
510 2805919470 2802429603 Bacteria 8777136
511 2824602545 2824600985 Bacteria 8488197
512 2824612675 2824609381 Bacteria 8672835
513 2824654489 2824653114 Bacteria 8493680
514 2824700442 2824696289 Bacteria 8335049
515 2838129527 2838122688 Bacteria 8803140
516 2841944428 2841941048 Bacteria 8688029
517 2841951569 2841949485 Bacteria 8680857
518 2841964644 2841957949 Bacteria 8652217
519 2841969205 2841966195 Bacteria 8673214
520 2841982870 2841974524 Bacteria 8931498
521 2841991048 2841983080 Bacteria 8395090
522 2842697028 2842694124 Bacteria 4063419
523 2844321793 2844315083 Bacteria 8138177
524 2847941723 2847939898 Bacteria 8606328
525 2857511538 2857509624 Bacteria 7472071
526 2874594227 2874590934 Bacteria 8299676
527 2874624391 2874620515 Bacteria 8290088
528 2874647653 2874645413 Bacteria 8214782
529 2876771875 2876771140 Bacteria 8287509
530 2876819181 2876818435 Bacteria 8274608
531 2879075726 2879074833 Bacteria 8279565
532 2879130743 2879127579 Bacteria 8294491
533 2879146097 2879142872 Bacteria 8267021
534 2885371426 2885366525 Bacteria 8326213
535 2885385384 2885383462 Bacteria 9473874
536 2885410826 2885409591 Bacteria 9235467
537 2888391074 2888388044 Bacteria 7304136
538 2888420802 2888419890 Bacteria 7857137
539 2889035036 2889033259 Bacteria 9099371
540 2903727657 2903727486 Bacteria 8281579
541 2903755869 2903748898 Bacteria 9972761
542 2903772290 2903768456 Bacteria 9749579
543 2904672270 2904666416 Bacteria 8226587
544 2904692125 2904690495 Bacteria 9412302
545 2906602853 2906602504 Bacteria 8295279
546 2906613045
547 2906634410 2906626472 Bacteria 8826946
548 2908757407 2908756301 Bacteria 8864324
549 2932794716 2932794094 Bacteria 7915132
550 2932805474 2932801729 Bacteria 7987968
551 2935614988 2935608549 Bacteria 8203142
552 2935651663 2935648319 Bacteria 8801166
553 2935659569 2935656913 Bacteria 8965014
554 2935772805 2935769743 Bacteria 7878163
555 2935778059 2935777560 Bacteria 8077691
556 2935787286 2935785616 Bacteria 7962367
557 2935795926 2935793552 Bacteria 8012592
558 2935825973 2935819856 Bacteria 8261050
559 2935851592 2935847175 Bacteria 8228321
560 2935888929 2935883170 Bacteria 7964738
561 2935910385 2935908558 Bacteria 8568796
562 2935918329 2935916978 Bacteria 9113783
563 2935927704 2935926038 Bacteria 8601059
564 2935936424 2935934488 Bacteria 8602579
565 2935944023 2935942939 Bacteria 8599779
566 2935952460 2935951376 Bacteria 8602333
567 2935964175 2935959822 Bacteria 7869783
568 2935969300 2935967501 Bacteria 8603075
569 2935977938 2935975950 Bacteria 8347125
570 2935984761 2935984226 Bacteria 8302647
571 2936013985 2936011229 Bacteria 8801034
572 2936023106 2936019824 Bacteria 8804134
573 2936031242 2936028420 Bacteria 8965941
574 2936049364 2936046547 Bacteria 8903709
575 2936055931 2936055302 Bacteria 8785755
576 3005602142 3005594810 Bacteria 8716512
577 3005717898 3005710791 Bacteria 7622528
578 3005724930 3005718088 Bacteria 8283608
579 8016526635 8016522445 Bacteria 8156687
580 8016531720 8016530956 Bacteria 8155261
581 8016544917 8016539877 Bacteria 8155419
582 8016569994 8016566248 Bacteria 8158151
583 8016582566 8016575299 Bacteria 8154085
584 8016586846 8016583857 Bacteria 10421953
585 8016603132 8016595262 Bacteria 8149947
586 8016606047 8016603502 Bacteria 8731218
587 8016617930 8016613128 Bacteria 8794220
588 8019531543 8019530166 Bacteria 8155624
589 8019563241 8019555841 Bacteria 9642137
590 8019622523 8019619141 Bacteria 9218857
591 8019630594 8019629233 Bacteria 8687553
592 8019652051 8019648815 Bacteria 10014479
593 8019667421 8019659431 Bacteria 8577854
594 8019678792 8019678201 Bacteria 8863603
595 8019696733 8019687851 Bacteria 8712826
596 8056677763 8056673599 Bacteria 7871253
597 8056970883 8056967851 Bacteria 9038162
598 Ga0068856_100194851
599 JGI25406J46586_10000471
600 JGI25165J46597_1004300
601 JGI25153J46596_10002109
602 JGI25153J46596_10004526
603 JGI25153J46596_10012156
604 JGI25153J46596_10012608
605 JGI25160J50197_1002305
606 JGI25160J50197_1005985
607 JGI25404J52841_10003282
608 Ga0055531_10021605
609 Ga0055543_1003281
610 Ga0065165_1005102
611 Ga0068868_100099635
612 Ga0070671_100031378
613 Ga0070709_10001435
614 Ga0070709_10006237
615 Ga0070709_10042500
616 Ga0070714_100141706
617 Ga0070713_100009559
618 Ga0070713_100023379
619 Ga0070713_100051353
620 Ga0070710_10003070
621 Ga0070710_10006535
622 Ga0070711_100002872
623 Ga0070711_100007255
624 Ga0070711_100066959
625 Ga0070663_100017505
626 Ga0070678_100007756
627 Ga0070681_10062334
628 Ga0070698_100164481
629 Ga0070679_100034288
630 Ga0070679_100040567
631 Ga0070679_100151264
632 Ga0070679_100240153
633 Ga0070684_100010499
634 Ga0068853_100032206
635 Ga0070693_100025488
636 Ga0070665_100101028
637 Ga0070665_100200956
638 Ga0068855_100120990
639 Ga0070664_100060034
640 Ga0068856_100014815
641 Ga0068856_100126719
642 Ga0068852_100038062
643 Ga0068860_100002058
644 Ga0068862_100078953
645 Ga0081455_10006198
646 Ga0081455_10021542
647 Ga0081455_10023244
648 Ga0081455_10080872
649 Ga0081540_1002527
650 Ga0081540_1004494
651 Ga0081540_1004784
652 Ga0081540_1005108
653 Ga0081540_1006449
654 Ga0081540_1009916
655 Ga0081540_1023303
656 Ga0081540_1023634
657 Ga0081540_1031883
658 Ga0081539_10000048
659 Ga0081539_10019994
660 Ga0070717_10006987
661 Ga0070717_10019819
662 Ga0070717_10077195
663 Ga0075365_10008364
664 Ga0075365_10016090
665 Ga0075365_10019967
666 Ga0075365_10058946
667 Ga0070715_10015520
668 Ga0070716_100001410
669 Ga0070712_100007612
670 Ga0070712_100035265
671 Ga0075367_10036631
672 Ga0075370_10032088
673 Ga0075370_10057194
674 Ga0075428_100197345
675 Ga0099825_1026268
676 Ga0099824_1004372
677 Ga0099823_1022824
678 Ga0099794_10008383
679 Ga0105240_10081136
680 Ga0105240_10214150
681 Ga0105247_10026513
682 Ga0114129_10139792
683 Ga0105241_10031842
684 Ga0105237_10098769
685 Ga0105238_10041922
686 Ga0105238_10049949
687 Ga0105239_10041089
688 Ga0105239_10167149
689 Ga0157374_10046331
690 Ga0157378_10022522
691 Ga0157379_10051438
692 Ga0157376_10138263
693 Ga0206353_10559486
694 Ga0214544_1000003
695 Ga0214542_1000003
696 Ga0214545_1000004
697 Ga0214543_1000007
698 Ga0213873_10018834
699 Ga0213876_10002313
700 Ga0213871_10003226
701 Ga0209677_101261
702 Ga0209148_1000351
703 Ga0209233_1004670
704 Ga0209455_1005444
705 Ga0209564_1003721
706 Ga0209758_1000015
707 Ga0209758_1000224
708 Ga0209758_1001252
709 Ga0209758_1005621
710 Ga0209758_1008757
711 Ga0209758_1016184
712 Ga0209256_1006394
713 Ga0207426_1000585
714 Ga0209257_1000440
715 Ga0209257_1011507
716 Ga0207697_10025131
717 Ga0207692_10006989
718 Ga0207692_10013152
719 Ga0207692_10023804
720 Ga0207692_10024941
721 Ga0207647_10009677
722 Ga0207685_10008958
723 Ga0207699_10000386
724 Ga0207699_10001899
725 Ga0207654_10018970
726 Ga0207707_10000816
727 Ga0207707_10016028
728 Ga0207707_10032139
729 Ga0207695_10000065
730 Ga0207671_10007223
731 Ga0207693_10000774
732 Ga0207693_10003263
733 Ga0207693_10011795
734 Ga0207693_10122612
735 Ga0207663_10001349
736 Ga0207663_10068541
737 Ga0207660_10171037
738 Ga0207652_10005821
739 Ga0207652_10120924
740 Ga0207664_10093885
741 Ga0207706_10058020
742 Ga0207665_10000289
743 Ga0207665_10001425
744 Ga0207689_10136504
745 Ga0207661_10091684
746 Ga0207639_10056862
747 Ga0207678_10018636
748 Ga0207702_10000539
749 Ga0207702_10077037
750 Ga0207702_10102048
751 Ga0207674_10004428
752 Ga0207675_100030164
753 Ga0209389_1000029
754 Ga0209389_1000076
755 Ga0209589_1000012
756 Ga0209589_1000013
757 Ga0209489_100013
758 Ga0209489_100416
759 Ga0209700_100014
760 Ga0268266_10001689
761 Ga0268266_10087590
762 Ga0268264_10000049
763 Ga0265334_10001581
764 Ga0265318_10029881
765 Ga0265336_10001012
766 Ga0307517_10000766
767 Ga0307515_10015099
768 Ga0307515_10182336
769 Ga0265338_10000024
770 Ga0265330_10034791
771 Ga0265332_10014170
772 Ga0265325_10016798
773 Ga0265340_10003211
774 Ga0265340_10005839
775 Ga0265339_10000432
776 Ga0265339_10009403
777 Ga0265331_10019916
778 Ga0265316_10064325
779 Ga0265316_10088257
780 Ga0265316_10090928
781 Ga0307513_10135503
782 Ga0307509_10029257
783 Ga0265313_10015522
784 Ga0307508_10011103
785 Ga0307508_10083047
786 Ga0265314_10002061
787 Ga0265314_10021684
788 Ga0265314_10026727
789 Ga0265342_10000031
790 Ga0265342_10006253
791 Ga0265342_10061614
792 Ga0307516_10048770
793 Ga0307406_10082824
794 Ga0307409_100090356
795 Ga0307510_10011049
796 Ga0307510_10030284
797 Ga0315911_1000024
798 Ga0373923_0000022
799 Ga0373953_0001610
800 Ga0373953_0015235
801 Ga0373954_0000519
802 Ga0373954_0061066
803 Ga0373957_0002302
804 Ga0373943_0001832
805 Ga0373946_0021484
806 Ga0373955_0050528
807 Ga0373935_0000244
808 Ga0373935_0035558
809 Ga0373927_0001820
810 Ga0373927_0003221
811 Ga0373933_0000374
812 Ga0373933_0062505
813 Ga0373947_0002144
814 Ga0373947_0008108
815 Ga0373937_0003416
816 Ga0395899_0092351
817 Ga0395900_0005774
818 Ga0395898_0004005
819 Ga0395905_0023500
820 Ga0395901_0104412
821 Ga0436365_0989879
822 Ga0436360_1052272
823 Ga0436362_0816704
824 Ga0436362_0876959
825 Ga0466972_0000048
826 Ga0466966_0000238
827 Ga0466961_0000044
828 Ga0466964_0018381
829 Ga0466968_0004386
830 Ga0466957_0033689
831 Ga0466959_0000963
832 Ga0466959_0014545
833 Ga0466958_0023391
834 Ga0466967_0029200
835 Ga0495592_0006994
836 Ga0495592_0025947
837 Ga0495603_0000370
838 Ga0495603_0006854
839 Ga0495603_0010858
840 Ga0495603_0103956
841 Ga0495629_0000081
842 Ga0495629_0000380
843 Ga0495629_0001706
844 Ga0495629_0027158
845 Ga0495629_0169158
846 Ga0495638_0040121
847 Ga0495638_0045735
848 Ga0495638_0046663
849 Ga0495641_0037572
850 Ga0495651_0001544
851 Ga0495651_0009321
852 Ga0495651_0025096
853 Ga0495653_0008281
854 Ga0495653_0032374
855 Ga0495580_0000435
856 Ga0495580_0021347
857 Ga0495580_0033867
858 Ga0495582_0000051
859 Ga0495582_0021176
860 Ga0495639_0000010
861 Ga0495639_0036105
862 Ga0495662_0015859
863 Ga0495664_0003734
864 Ga0495664_0006633
865 Ga0495584_0007389
866 Ga0495594_0001553
867 Ga0495607_0015021
868 Ga0495606_0000265
869 Ga0495606_0024523
870 Ga0495606_0134060
871 Ga0495608_0006818
872 Ga0495628_0006851
873 Ga0495630_0011435
874 Ga0495632_0057414
875 Ga0495637_0046494
876 Ga0495643_0026421
877 Ga0495648_0000271
878 Ga0495648_0004027
879 Ga0495648_0004338
880 Ga0495648_0007795
881 Ga0495652_0007397
882 Ga0495652_0020559
883 Ga0495665_0000005
884 Ga0495640_0000301
885 Ga0495640_0009451
886 Ga0495640_0012766
887 Ga0495640_0013425
888 Ga0495586_0113090
889 Ga0495587_0002764
890 Ga0495587_0011668
891 Ga0495587_0033875
892 Ga0495645_0079303
893 Ga0495622_0003164
894 Ga0495622_0019048
895 Ga0495622_0066421
896 Ga0495667_0030543
897 Ga0495667_0061802
898 Ga0495656_0001491
899 Ga0495634_0000764
900 Ga0495634_0008147
901 Ga0495634_0026354
902 Ga0495634_0103224
903 Ga0495625_0040142
904 Ga0495625_0079134
905 Ga0495625_0087934
906 Ga0495635_0000213
907 Ga0495635_0000259
908 Ga0495635_0005005
909 Ga0495635_0099120
910 Ga0495659_0006006
911 Ga0495659_0009037
912 Ga0495661_0009639
913 Ga0495588_0006723
914 Ga0495588_0021656
915 Ga0495657_0002844
916 Ga0495657_0016391
917 Ga0495623_0005373
918 Ga0495623_0014745
919 Ga0495646_0017294
920 Ga0495647_0000671
921 Ga0495647_0028812
922 Ga0495658_0010836
923 Ga0495613_0031679
924 Ga0495624_0000094
925 Ga0495670_0027112
926 Ga0495600_0001162
927 Ga0495600_0133818
928 Ga0495581_0000810
929 Ga0495581_0019197
930 Ga0495581_0064221
931 Ga0495604_0033791
932 Ga0495604_0057292
933 Ga0495604_0125420
934 Ga0495604_0159196
935 Ga0495636_0009585
936 Ga0495674_0000955
937 Ga0495672_0006198
938 Ga0495672_0030505
939 Ga0495676_0020537
940 Ga0495676_0022280
941 Ga0495680_0002637
942 Ga0495680_0004426
943 Ga0495675_0000756
944 Ga0495675_0009113
945 Ga0495673_0031996
946 Ga0495684_0000052
947 Ga0495593_0000084
948 Ga0495602_0011425
949 Ga0495602_0053428
950 Ga0495602_0111923
951 Ga0495626_0040243
952 Ga0496100_0014294
953 Ga0496101_0020764
954 Ga0496102_0005804
955 Ga0496102_0066766
956 Ga0496103_0017638
957 Ga0496103_0023140
958 Ga0496104_0023685
959 Ga0496104_0090783
960 Ga0496104_0121874
961 Ga0496104_0263674
962 Ga0496105_0064838
963 Ga0496105_0073921
964 Ga0496106_0001452
965 Ga0496106_0158597
966 Ga0496106_0188782
967 Ga0496107_0016390
968 Ga0496109_0016364
969 Ga0496109_0059237
970 Ga0496110_0003476
971 Ga0496112_0000019
972 Ga0496112_0007159
973 Ga0496112_0099712
974 Ga0496112_0132000
975 Ga0496112_0217233
976 Ga0496113_0053179
977 Ga0496113_0079517
978 Ga0496113_0207665
979 Ga0496114_0016833
980 Ga0496114_0095643
981 Ga0496115_0001776
982 Ga0496115_0078574
983 Ga0496115_0114564
984 Ga0496116_0002417
985 Ga0496117_0018002
986 Ga0496117_0037758
987 Ga0496118_0008852
988 Ga0496118_0045553
989 Ga0496118_0056203
990 Ga0496118_0096570
991 Ga0496119_0008930
992 Ga0496119_0041607
993 Ga0496120_0034261
994 Ga0496121_0000261
995 Ga0496121_0002340
996 Ga0496121_0010594
997 Ga0496121_0012632
998 Ga0496121_0023069
999 Ga0496121_0040104
1000 Ga0496121_0092016
1001 Ga0496121_0094722
1002 Ga0496121_0181886
1003 Ga0496122_0066741
1004 Ga0496122_0087089
1005 Ga0496123_0054922
1006 Ga0496123_0055591
1007 Ga0496124_0002998
1008 Ga0496125_0003042
1009 Ga0496125_0020421
1010 Ga0496125_0047989
1011 Ga0496125_0057736
1012 Ga0496125_0072635
1013 Ga0496126_0001531
1014 Ga0496126_0007269
1015 Ga0496126_0011299
1016 Ga0496126_0022191
1017 Ga0496126_0029441
1018 Ga0496126_0034784
1019 Ga0496126_0043359
1020 Ga0496126_0047232
1021 Ga0496126_0066904
1022 Ga0496126_0186725
1023 Ga0496126_0242906
1024 Ga0501042_0162754
1025 Ga0501046_0112612
1026 Ga0501047_0046968
1027 Ga0501070_0064188
1028 Ga0501080_0064659
1029 Ga0501044_0139506
1030 nmdc:mga0yw44_3382_c1
1031 nmdc:mga06z11_81454_c1
1032 nmdc:mga04h51_36571_c1
1033 nmdc:mga07m45_19595_c1
1034 nmdc:mga07m45_34138_c1
1035 nmdc:mga07m45_38587_c1
1036 nmdc:mga05p37_99636_c1
1037 nmdc:mga0n895_43152_c1
1038 Ga0495601_0027411
1039 Ga0500635_0014513
1040 Ga0495595_0005730
1041 Ga0495595_0022161
1042 Ga0495619_0000913
1043 Ga0495619_0010200
1044 Ga0500578_0095614
1045 Ga0500643_000091
1046 Ga0500644_0023181
1047 Ga0500581_089994
1048 Ga0500566_0000199
1049 Ga0500566_0000762
1050 Ga0500566_0005554
1051 Ga0500641_0017426
1052 Ga0500555_006418
1053 Ga0500556_0000091
1054 Ga0500557_000043
1055 Ga0500562_017462
1056 Ga0500569_000723
1057 Ga0500572_001685
1058 Ga0500593_053885
1059 Ga0500594_0002936
1060 Ga0500595_001894
1061 Ga0500595_002247
1062 Ga0500595_004559
1063 Ga0500607_058217
1064 Ga0500608_038903
1065 Ga0500608_069067
1066 Ga0500618_008566
1067 Ga0500642_0000046
1068 Ga0500658_0037126
1069 Ga0500559_0000287
1070 Ga0500559_0000803
1071 Ga0500559_0066100
1072 Ga0500568_0000167
1073 Ga0500568_0009134
1074 Ga0500586_000631
1075 Ga0500588_0013117
1076 Ga0500590_025663
1077 Ga0500590_068953
1078 Ga0500616_0000059
1079 Ga0500616_0000283
1080 Ga0500622_0007335
1081 Ga0500622_0035683
1082 Ga0500627_0037104
1083 Ga0500639_002046
1084 Ga0500636_0000291
1085 Ga0500636_0010476
1086 Ga0500636_0037394
1087 Ga0500637_0001082
1088 Ga0500645_006160
1089 Ga0500596_003293
1090 Ga0500601_000421
1091 2507504813
1092 2508546166
1093 2508695100
1094 2509149768
1095 2513641881
1096 2513706303
1097 2513858954
1098 2513890434
1099 2513917349
1100 2514012917
1101 2515625896
1102 2517102419
1103 2517889572
1104 2524466484
1105 2528850369
1106 2793063130
1107 2805919470
1108 2824602545
1109 2824612675
1110 2824654489
1111 2824700442
1112 2838129527
1113 2841944428
1114 2841951569
1115 2841964644
1116 2841969205
1117 2841982870
1118 2841991048
1119 2842697028
1120 2844321793
1121 2847941723
1122 2857511538
1123 2874594227
1124 2874624391
1125 2874647653
1126 2876771875
1127 2876819181
1128 2879075726
1129 2879130743
1130 2879146097
1131 2885371426
1132 2885385384
1133 2885410826
1134 2888391074
1135 2888420802
1136 2889035036
1137 2903727657
1138 2903755869
1139 2903772290
1140 2904672270
1141 2904692125
1142 2906602853
1143 2906613045
1144 2906634410
1145 2908757407
1146 2932794716
1147 2932805474
1148 2935614988
1149 2935651663
1150 2935659569
1151 2935772805
1152 2935778059
1153 2935787286
1154 2935795926
1155 2935825973
1156 2935851592
1157 2935888929
1158 2935910385
1159 2935918329
1160 2935927704
1161 2935936424
1162 2935944023
1163 2935952460
1164 2935964175
1165 2935969300
1166 2935977938
1167 2935984761
1168 2936013985
1169 2936023106
1170 2936031242
1171 2936049364
1172 2936055931
1173 3005602142
1174 3005717898
1175 3005724930
1176 8016526635
1177 8016531720
1178 8016544917
1179 8016569994
1180 8016582566
1181 8016586846
1182 8016603132
1183 8016606047
1184 8016617930
1185 8019531543
1186 8019563241
1187 8019622523
1188 8019630594
1189 8019652051
1190 8019667421
1191 8019678792
1192 8019696733
1193 8056677763
1194 8056970883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

48

461

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c62-assembly1.cif.gz_A an unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. 0.88 16 450
6c6g-assembly1.cif.gz_B-2 an unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. inhibitor bound complex. 0.8763 16 450
6c62-assembly1.cif.gz_A an unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. 0.84 16 450
4wj3-assembly2.cif.gz_D crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8077 16 445
3a1i-assembly1.cif.gz_A-2 crystal structure of rhodococcus sp. n-771 amidase complexed with benzamide 0.7972 79 455
ID Description Score Start End Superfamily
6c6gA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8754 16 450 3.90.1300.10
af_P9WQ93_21_468_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8229 18 444 3.90.1300.10
4issB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8157 302 362 1.20.58.1700
4wj3D00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8077 16 445 3.90.1300.10
3a1iA02 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.7972 79 455 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A376F750-F1-model_v4 Amidase (EC 3.5.1.4) 0.9339 258 376 GO:0004040
AF-A0A2N5DU26-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A (EC 3.5.1.4) 0.9053 226 451 GO:0004040
GO:0016740
AF-A0A376F750-F1-model_v4 Amidase (EC 3.5.1.4) 0.9048 258 376 GO:0004040
AF-A0A1I0TTV9-F1-model_v4 Aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A 0.897 213 445 GO:0016740
AF-A0A7C2X1L5-F1-model_v4 Amidase 0.8927 15 134 GO:0003824

Map