F467644

General Info

Members Datasets Scaffolds Average Seq Length
597 238 1194 294

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100393275|Ga0068859_1003932751
Length 294
Sequence MFKKTTRRNALKNLLLTGSAVIASPALTMAARDAEEKPNKLKGNVNHSVCQWTYNFISVEELCQAVKKIGFSAIDLVGPKDWPTLKKYGVYSSMCNGAEISLTEGWNDKQYHSTLIKNYTDHIELAAQAGYKNIICFSGSRRGMDDETGLKNCAEGLKQILSLAEKKGIMIQMELLNSKIDHKDYMCDRSPWGVELCKRVSSPNFKLLYDIYHMQIDEGDVIRTINDNHQYFGHYHTGGVPGRHEINETQELFYPAVMRAILKTGFNDYVAQEFIPIAEDKIASLKEAVKICDV

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
207 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
208 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
213 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
214 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
215 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
216 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
219 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
223 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
224 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
225 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
226 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
227 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 1.01
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100393275 3300005617 Bacteria 1482
2 JGI24740J21852_10011654 3300001979 Bacteria 3341
3 rootH2_10069618 3300003320 Bacteria 6933
4 rootL2_10264449 3300003322 Bacteria 1224
5 JGI25160J50197_1005029 3300003354 Bacteria 5593
6 Ga0065712_10073587 3300005290 Bacteria 4328
7 Ga0065715_10103531 3300005293 Bacteria 3028
8 Ga0070676_10000375 3300005328 Bacteria 20682
9 Ga0070676_10004885 3300005328 Bacteria 7102
10 Ga0070676_10006242 3300005328 Bacteria 6364
11 Ga0070676_10034710 3300005328 Bacteria 2897
12 Ga0070676_10087563 3300005328 Bacteria 1901
13 Ga0070676_10094299 3300005328 Bacteria 1839
14 Ga0070676_10318638 3300005328 Bacteria 1060
15 Ga0070683_100005920 3300005329 Bacteria 10233
16 Ga0070683_100063404 3300005329 Bacteria 3438
17 Ga0070690_100012971 3300005330 Bacteria 4914
18 Ga0070690_100173510 3300005330 Bacteria 1485
19 Ga0070690_100205898 3300005330 Bacteria 1371
20 Ga0070670_100018618 3300005331 Bacteria 5951
21 Ga0070670_100079324 3300005331 Bacteria 2821
22 Ga0070670_100094815 3300005331 Bacteria 2567
23 Ga0070670_100143324 3300005331 Bacteria 2066
24 Ga0070670_100222419 3300005331 Bacteria 1643
25 Ga0070670_100252236 3300005331 Bacteria 1537
26 Ga0070670_100446516 3300005331 Bacteria 1146
27 Ga0068869_100007341 3300005334 Bacteria 7034
28 Ga0068869_100030132 3300005334 Bacteria 3807
29 Ga0068869_100060301 3300005334 Bacteria 2780
30 Ga0068869_100101238 3300005334 Bacteria 2179
31 Ga0068869_100125261 3300005334 Bacteria 1969
32 Ga0068869_100287478 3300005334 Bacteria 1324
33 Ga0070666_10000132 3300005335 Bacteria 52718
34 Ga0070666_10006643 3300005335 Bacteria 7112
35 Ga0070680_100293178 3300005336 Bacteria 1379
36 Ga0070682_100109111 3300005337 Bacteria 1841
37 Ga0068868_100000075 3300005338 Bacteria 58452
38 Ga0068868_100002272 3300005338 Bacteria 13287
39 Ga0068868_100377828 3300005338 Bacteria 1218
40 Ga0070689_100009176 3300005340 Bacteria 7004
41 Ga0070689_100015800 3300005340 Bacteria 5514
42 Ga0070689_100148292 3300005340 Bacteria 1891
43 Ga0070691_10013689 3300005341 Bacteria 3719
44 Ga0070687_100117706 3300005343 Bacteria 1514
45 Ga0070687_100268805 3300005343 Bacteria 1068
46 Ga0070661_100000277 3300005344 Bacteria 41446
47 Ga0070661_100062556 3300005344 Bacteria 2732
48 Ga0070668_100000859 3300005347 Bacteria 21121
49 Ga0070668_100338010 3300005347 Bacteria 1271
50 Ga0070668_100498075 3300005347 Bacteria 1054
51 Ga0070669_100003023 3300005353 Bacteria 12102
52 Ga0070675_100009919 3300005354 Bacteria 7426
53 Ga0070675_100030595 3300005354 Bacteria 4347
54 Ga0070675_100118683 3300005354 Bacteria 2246
55 Ga0070675_100294980 3300005354 Bacteria 1427
56 Ga0070671_100020821 3300005355 Bacteria 5350
57 Ga0070671_100070912 3300005355 Bacteria 2907
58 Ga0070671_100086328 3300005355 Bacteria 2625
59 Ga0070671_100363559 3300005355 Bacteria 1236
60 Ga0070671_100450186 3300005355 Bacteria 1105
61 Ga0070674_100009204 3300005356 Bacteria 5909
62 Ga0070674_100147542 3300005356 Bacteria 1772
63 Ga0070674_100251052 3300005356 Bacteria 1389
64 Ga0070674_100425076 3300005356 Bacteria 1091
65 Ga0070673_100000448 3300005364 Bacteria 21839
66 Ga0070673_100005672 3300005364 Bacteria 8020
67 Ga0070673_100017306 3300005364 Bacteria 5121
68 Ga0070673_100017915 3300005364 Bacteria 5048
69 Ga0070673_100019388 3300005364 Bacteria 4881
70 Ga0070673_100061208 3300005364 Bacteria 2986
71 Ga0070673_100062231 3300005364 Bacteria 2964
72 Ga0070673_100182204 3300005364 Bacteria 1799
73 Ga0070673_100187065 3300005364 Bacteria 1776
74 Ga0070688_100004571 3300005365 Bacteria 7218
75 Ga0070688_100017477 3300005365 Bacteria 4117
76 Ga0070688_100024605 3300005365 Bacteria 3555
77 Ga0070688_100157524 3300005365 Unclassified 1558
78 Ga0070659_100019379 3300005366 Bacteria 5155
79 Ga0070667_100000482 3300005367 Bacteria 40557
80 Ga0070667_100017378 3300005367 Bacteria 5961
81 Ga0070667_100038040 3300005367 Bacteria 4035
82 Ga0070667_100176274 3300005367 Bacteria 1889
83 Ga0070667_100293730 3300005367 Bacteria 1462
84 Ga0070700_100182997 3300005441 Bacteria 1460
85 Ga0070678_100198015 3300005456 Bacteria 1656
86 Ga0070662_100009485 3300005457 Bacteria 6368
87 Ga0070662_100020503 3300005457 Bacteria 4501
88 Ga0070662_100353009 3300005457 Bacteria 1205
89 Ga0070681_10106717 3300005458 Bacteria 2742
90 Ga0068867_100005707 3300005459 Bacteria 8824
91 Ga0068867_100014228 3300005459 Bacteria 5636
92 Ga0068867_100076697 3300005459 Bacteria 2510
93 Ga0068867_100360262 3300005459 Bacteria 1216
94 Ga0070685_10019109 3300005466 Bacteria 3694
95 Ga0070685_10035007 3300005466 Bacteria 2831
96 Ga0070698_100000791 3300005471 Bacteria 34361
97 Ga0070679_100018717 3300005530 Bacteria 6723
98 Ga0070679_100415481 3300005530 Bacteria 1291
99 Ga0070684_100000773 3300005535 Bacteria 22194
100 Ga0070684_100075450 3300005535 Bacteria 2974
101 Ga0068853_100007384 3300005539 Bacteria 8793
102 Ga0068853_100014216 3300005539 Bacteria 6513
103 Ga0068853_100018278 3300005539 Bacteria 5800
104 Ga0068853_100044684 3300005539 Bacteria 3792
105 Ga0068853_100419273 3300005539 Unclassified 1255
106 Ga0070672_100000361 3300005543 Bacteria 26202
107 Ga0070672_100014615 3300005543 Bacteria 5567
108 Ga0070672_100038656 3300005543 Bacteria 3649
109 Ga0070672_100137013 3300005543 Bacteria 2016
110 Ga0070672_100187330 3300005543 Bacteria 1726
111 Ga0070672_100269960 3300005543 Bacteria 1436
112 Ga0070672_100369103 3300005543 Bacteria 1226
113 Ga0070686_100284129 3300005544 Bacteria 1221
114 Ga0070665_100002163 3300005548 Bacteria 21925
115 Ga0070665_100566532 3300005548 Bacteria 1148
116 Ga0068855_100166084 3300005563 Bacteria 2502
117 Ga0070664_100008983 3300005564 Bacteria 8104
118 Ga0070664_100029540 3300005564 Bacteria 4570
119 Ga0070664_100031538 3300005564 Bacteria 4429
120 Ga0070664_100039762 3300005564 Bacteria 3964
121 Ga0070664_100183357 3300005564 Bacteria 1861
122 Ga0070664_100400082 3300005564 Bacteria 1256
123 Ga0068857_100003006 3300005577 Bacteria 13919
124 Ga0068857_100014247 3300005577 Bacteria 6927
125 Ga0068857_100290532 3300005577 Unclassified 1505
126 Ga0068852_100057165 3300005616 Bacteria 3374
127 Ga0068852_100100085 3300005616 Bacteria 2614
128 Ga0068852_100235135 3300005616 Bacteria 1748
129 Ga0068852_100293005 3300005616 Bacteria 1573
130 Ga0068859_100000003 3300005617 Bacteria 479218
131 Ga0068859_100017056 3300005617 Bacteria 7290
132 Ga0068859_100108851 3300005617 Bacteria 2832
133 Ga0068859_100138083 3300005617 Bacteria 2511
134 Ga0068859_100307206 3300005617 Bacteria 1679
135 Ga0068859_100386746 3300005617 Bacteria 1495
136 Ga0068859_100890288 3300005617 Bacteria 975
137 Ga0068864_100000785 3300005618 Bacteria 26636
138 Ga0068864_100026328 3300005618 Bacteria 4905
139 Ga0068864_100046615 3300005618 Bacteria 3720
140 Ga0068864_100047620 3300005618 Bacteria 3683
141 Ga0068864_100109363 3300005618 Bacteria 2461
142 Ga0068864_100189315 3300005618 Bacteria 1885
143 Ga0068861_100022280 3300005719 Bacteria 4562
144 Ga0068861_100088713 3300005719 Bacteria 2436
145 Ga0068851_10002930 3300005834 Bacteria 7539
146 Ga0068851_10008931 3300005834 Bacteria 4648
147 Ga0068851_10051718 3300005834 Bacteria 2088
148 Ga0068870_10005311 3300005840 Bacteria 5615
149 Ga0068863_100000394 3300005841 Bacteria 44355
150 Ga0068863_100044449 3300005841 Bacteria 4216
151 Ga0068863_100054028 3300005841 Bacteria 3806
152 Ga0068863_100066866 3300005841 Bacteria 3400
153 Ga0068863_100123174 3300005841 Bacteria 2473
154 Ga0068863_100154531 3300005841 Bacteria 2196
155 Ga0068863_100154773 3300005841 Bacteria 2194
156 Ga0068863_100242534 3300005841 Bacteria 1739
157 Ga0068863_100426134 3300005841 Bacteria 1300
158 Ga0068858_100034696 3300005842 Bacteria 4679
159 Ga0068858_100070155 3300005842 Bacteria 3248
160 Ga0068858_100124817 3300005842 Bacteria 2409
161 Ga0068858_100359894 3300005842 Bacteria 1395
162 Ga0068860_100002493 3300005843 Bacteria 19315
163 Ga0068860_100005227 3300005843 Bacteria 13184
164 Ga0068860_100039307 3300005843 Bacteria 4525
165 Ga0068860_100052463 3300005843 Bacteria 3879
166 Ga0068860_100109512 3300005843 Bacteria 2640
167 Ga0068860_100228584 3300005843 Bacteria 1808
168 Ga0068860_100317143 3300005843 Bacteria 1530
169 Ga0068860_100391000 3300005843 Bacteria 1374
170 Ga0068862_100004418 3300005844 Bacteria 11866
171 Ga0068862_100066495 3300005844 Bacteria 3107
172 Ga0068862_100154962 3300005844 Bacteria 2041
173 Ga0081539_10000366 3300005985 Bacteria 98762
174 Ga0081539_10004761 3300005985 Bacteria 14651
175 Ga0081539_10119218 3300005985 Bacteria 1313
176 Ga0070715_10080125 3300006163 Bacteria 1480
177 Ga0075366_10042330 3300006195 Bacteria 2696
178 Ga0097621_100000448 3300006237 Bacteria 28883
179 Ga0097621_100000626 3300006237 Bacteria 24907
180 Ga0097621_100026951 3300006237 Bacteria 4515
181 Ga0097621_100048531 3300006237 Bacteria 3445
182 Ga0097621_100156290 3300006237 Bacteria 1957
183 Ga0097621_100166727 3300006237 Bacteria 1896
184 Ga0097621_100251845 3300006237 Bacteria 1546
185 Ga0097621_100304435 3300006237 Bacteria 1408
186 Ga0068871_100081278 3300006358 Bacteria 2684
187 Ga0068871_100150041 3300006358 Bacteria 1987
188 Ga0068871_100300409 3300006358 Bacteria 1409
189 Ga0075428_100051884 3300006844 Bacteria 4498
190 Ga0075428_100082193 3300006844 Bacteria 3515
191 Ga0075430_100024120 3300006846 Bacteria 5179
192 Ga0075431_100083509 3300006847 Bacteria 3297
193 Ga0075429_100004398 3300006880 Bacteria 12107
194 Ga0068865_100018872 3300006881 Bacteria 4457
195 Ga0068865_100064790 3300006881 Bacteria 2573
196 Ga0097620_100000003 3300006931 Bacteria 479218
197 Ga0097620_100017056 3300006931 Bacteria 7290
198 Ga0097620_100108851 3300006931 Bacteria 2832
199 Ga0097620_100138083 3300006931 Bacteria 2511
200 Ga0097620_100307208 3300006931 Bacteria 1679
201 Ga0097620_100386724 3300006931 Bacteria 1495
202 Ga0097620_100393269 3300006931 Bacteria 1482
203 Ga0097620_100890463 3300006931 Bacteria 975
204 Ga0075435_100273548 3300007076 Bacteria 1441
205 Ga0105240_10177588 3300009093 Bacteria 2516
206 Ga0105240_10486688 3300009093 Bacteria 1374
207 Ga0111539_10005429 3300009094 Bacteria 16497
208 Ga0111539_10348582 3300009094 Bacteria 1723
209 Ga0105245_10114799 3300009098 Bacteria 2508
210 Ga0105247_10001444 3300009101 Bacteria 17174
211 Ga0105247_10003817 3300009101 Bacteria 9750
212 Ga0105247_10031211 3300009101 Bacteria 3233
213 Ga0114129_10093918 3300009147 Bacteria 4154
214 Ga0114129_10245295 3300009147 Bacteria 2407
215 Ga0105243_10524744 3300009148 Bacteria 1127
216 Ga0105241_10001671 3300009174 Bacteria 16896
217 Ga0105241_10008306 3300009174 Bacteria 7643
218 Ga0105242_10022509 3300009176 Bacteria 4957
219 Ga0105242_10051028 3300009176 Bacteria 3370
220 Ga0105242_10182857 3300009176 Bacteria 1851
221 Ga0105248_10200398 3300009177 Bacteria 2249
222 Ga0105248_10446552 3300009177 Bacteria 1457
223 Ga0105248_11126704 3300009177 Bacteria 887
224 Ga0105237_10001393 3300009545 Bacteria 31945
225 Ga0105237_10166606 3300009545 Bacteria 2202
226 Ga0105249_10002967 3300009553 Bacteria 14640
227 Ga0105249_10004604 3300009553 Bacteria 11918
228 Ga0105249_10019812 3300009553 Bacteria 6005
229 Ga0105249_10026406 3300009553 Bacteria 5233
230 Ga0105249_10033426 3300009553 Bacteria 4655
231 Ga0105249_10035661 3300009553 Bacteria 4510
232 Ga0105249_10042290 3300009553 Bacteria 4144
233 Ga0105249_10042675 3300009553 Bacteria 4126
234 Ga0105249_10044800 3300009553 Bacteria 4023
235 Ga0105249_10163544 3300009553 Bacteria 2153
236 Ga0105239_10021840 3300010375 Bacteria 7055
237 Ga0105239_10021884 3300010375 Bacteria 7049
238 Ga0105239_10736121 3300010375 Bacteria 1128
239 Ga0105246_10041242 3300011119 Bacteria 3119
240 Ga0157373_10001087 3300013100 Bacteria 20959
241 Ga0157373_10040971 3300013100 Bacteria 3313
242 Ga0157373_10109128 3300013100 Bacteria 1946
243 Ga0157373_10373556 3300013100 Unclassified 1019
244 Ga0157371_10001061 3300013102 Bacteria 30053
245 Ga0157371_10358654 3300013102 Bacteria 1062
246 Ga0157370_10277503 3300013104 Bacteria 1549
247 Ga0157370_10349705 3300013104 Bacteria 1362
248 Ga0157374_10001371 3300013296 Bacteria 20705
249 Ga0157374_10002589 3300013296 Bacteria 15240
250 Ga0157374_10035153 3300013296 Bacteria 4583
251 Ga0157374_10041157 3300013296 Bacteria 4256
252 Ga0157374_10296626 3300013296 Bacteria 1599
253 Ga0157374_10420630 3300013296 Bacteria 1335
254 Ga0157374_10722312 3300013296 Bacteria 1010
255 Ga0157378_10003090 3300013297 Bacteria 14801
256 Ga0157378_10003886 3300013297 Bacteria 13230
257 Ga0157378_10026601 3300013297 Bacteria 5099
258 Ga0157378_10082724 3300013297 Bacteria 2904
259 Ga0157378_10200574 3300013297 Bacteria 1887
260 Ga0157378_10385063 3300013297 Unclassified 1378
261 Ga0163162_10000328 3300013306 Bacteria 43763
262 Ga0163162_10000377 3300013306 Bacteria 40533
263 Ga0163162_10002723 3300013306 Bacteria 16760
264 Ga0163162_10034203 3300013306 Bacteria 5056
265 Ga0163162_10037495 3300013306 Bacteria 4838
266 Ga0163162_10064650 3300013306 Bacteria 3703
267 Ga0163162_10065915 3300013306 Bacteria 3670
268 Ga0163162_10120223 3300013306 Bacteria 2730
269 Ga0163162_10172044 3300013306 Bacteria 2291
270 Ga0163162_10229946 3300013306 Bacteria 1985
271 Ga0163162_10240405 3300013306 Bacteria 1942
272 Ga0163162_10269058 3300013306 Bacteria 1836
273 Ga0163162_10477988 3300013306 Bacteria 1377
274 Ga0157372_10016543 3300013307 Bacteria 7914
275 Ga0157372_10051539 3300013307 Bacteria 4581
276 Ga0157372_10108466 3300013307 Bacteria 3177
277 Ga0157372_10461416 3300013307 Bacteria 1480
278 Ga0157372_10798523 3300013307 Bacteria 1096
279 Ga0157375_10004745 3300013308 Bacteria 11813
280 Ga0157375_10013323 3300013308 Bacteria 7314
281 Ga0157375_10025603 3300013308 Bacteria 5486
282 Ga0157375_10035797 3300013308 Bacteria 4743
283 Ga0157375_10055146 3300013308 Bacteria 3918
284 Ga0157375_10056304 3300013308 Bacteria 3882
285 Ga0157375_10107476 3300013308 Bacteria 2884
286 Ga0157375_10130832 3300013308 Bacteria 2628
287 Ga0157375_10143811 3300013308 Bacteria 2514
288 Ga0157375_10452066 3300013308 Bacteria 1450
289 Ga0157375_10619434 3300013308 Bacteria 1240
290 Ga0157375_10793840 3300013308 Bacteria 1096
291 Ga0163163_10000348 3300014325 Bacteria 44508
292 Ga0163163_10000752 3300014325 Bacteria 27543
293 Ga0163163_10063516 3300014325 Bacteria 3661
294 Ga0163163_10160485 3300014325 Bacteria 2293
295 Ga0163163_10188170 3300014325 Bacteria 2113
296 Ga0163163_10500156 3300014325 Bacteria 1277
297 Ga0157380_10003484 3300014326 Bacteria 10807
298 Ga0157380_10011917 3300014326 Bacteria 6290
299 Ga0157380_10361860 3300014326 Bacteria 1362
300 Ga0157380_10380759 3300014326 Bacteria 1331
301 Ga0157377_10001155 3300014745 Bacteria 11202
302 Ga0157377_10008430 3300014745 Bacteria 5027
303 Ga0157377_10067790 3300014745 Bacteria 2055
304 Ga0157377_10164409 3300014745 Bacteria 1383
305 Ga0157377_10172715 3300014745 Bacteria 1353
306 Ga0157379_10047283 3300014968 Bacteria 3839
307 Ga0157379_10164435 3300014968 Bacteria 2003
308 Ga0157376_10000381 3300014969 Bacteria 28821
309 Ga0157376_10030198 3300014969 Bacteria 4325
310 Ga0157376_10079741 3300014969 Bacteria 2807
311 Ga0157376_10081778 3300014969 Bacteria 2774
312 Ga0157376_10210767 3300014969 Bacteria 1793
313 Ga0157376_10255728 3300014969 Bacteria 1638
314 Ga0157376_10453753 3300014969 Bacteria 1251
315 Ga0157376_10506622 3300014969 Bacteria 1187
316 Ga0163161_10019724 3300017792 Bacteria 4730
317 Ga0163161_10053033 3300017792 Unclassified 2940
318 Ga0163161_10053472 3300017792 Bacteria 2929
319 Ga0163161_10055024 3300017792 Bacteria 2888
320 Ga0163161_10210665 3300017792 Bacteria 1501
321 Ga0163161_10217298 3300017792 Bacteria 1479
322 Ga0209646_1006014 3300025246 Bacteria 2065
323 Ga0207426_1000052 3300025302 Bacteria 389825
324 Ga0207697_10056128 3300025315 Bacteria 1633
325 Ga0207656_10006843 3300025321 Bacteria 4126
326 Ga0207682_10033580 3300025893 Bacteria 2066
327 Ga0207710_10007530 3300025900 Bacteria 4610
328 Ga0207688_10033019 3300025901 Bacteria 2861
329 Ga0207688_10065776 3300025901 Bacteria 2049
330 Ga0207680_10000014 3300025903 Bacteria 179035
331 Ga0207680_10019434 3300025903 Bacteria 3633
332 Ga0207680_10083245 3300025903 Bacteria 2016
333 Ga0207680_10128926 3300025903 Bacteria 1665
334 Ga0207647_10065934 3300025904 Bacteria 2197
335 Ga0207645_10000949 3300025907 Bacteria 24072
336 Ga0207645_10003750 3300025907 Bacteria 11423
337 Ga0207645_10008195 3300025907 Bacteria 7312
338 Ga0207645_10053554 3300025907 Bacteria 2579
339 Ga0207645_10077273 3300025907 Bacteria 2133
340 Ga0207643_10028393 3300025908 Bacteria 3107
341 Ga0207654_10002095 3300025911 Bacteria 10217
342 Ga0207654_10009042 3300025911 Bacteria 5054
343 Ga0207707_10002312 3300025912 Bacteria 17183
344 Ga0207707_10093075 3300025912 Bacteria 2633
345 Ga0207695_10127357 3300025913 Bacteria 2507
346 Ga0207671_10000746 3300025914 Bacteria 41287
347 Ga0207671_10113496 3300025914 Bacteria 2064
348 Ga0207660_10003846 3300025917 Bacteria 9785
349 Ga0207662_10282167 3300025918 Bacteria 1099
350 Ga0207662_10389547 3300025918 Bacteria 943
351 Ga0207657_10013150 3300025919 Bacteria 8126
352 Ga0207649_10003070 3300025920 Bacteria 9169
353 Ga0207649_10012025 3300025920 Bacteria 4788
354 Ga0207652_10180463 3300025921 Bacteria 1897
355 Ga0207681_10012913 3300025923 Bacteria 5164
356 Ga0207681_10120589 3300025923 Bacteria 1923
357 Ga0207650_10140506 3300025925 Bacteria 1898
358 Ga0207650_10167289 3300025925 Bacteria 1745
359 Ga0207650_10190750 3300025925 Bacteria 1637
360 Ga0207650_10442526 3300025925 Unclassified 1081
361 Ga0207659_10052858 3300025926 Bacteria 2895
362 Ga0207659_10299853 3300025926 Bacteria 1319
363 Ga0207687_10064062 3300025927 Bacteria 2605
364 Ga0207644_10079998 3300025931 Bacteria 2413
365 Ga0207644_10156315 3300025931 Bacteria 1769
366 Ga0207706_10022124 3300025933 Bacteria 5706
367 Ga0207706_10031196 3300025933 Bacteria 4749
368 Ga0207706_10248285 3300025933 Bacteria 1555
369 Ga0207706_10449531 3300025933 Bacteria 1115
370 Ga0207686_10000998 3300025934 Bacteria 16801
371 Ga0207670_10116038 3300025936 Bacteria 1938
372 Ga0207669_10143214 3300025937 Bacteria 1663
373 Ga0207669_10200998 3300025937 Bacteria 1447
374 Ga0207704_10004208 3300025938 Bacteria 6576
375 Ga0207704_10150264 3300025938 Bacteria 1642
376 Ga0207691_10000037 3300025940 Bacteria 108385
377 Ga0207691_10009239 3300025940 Bacteria 9461
378 Ga0207691_10024267 3300025940 Bacteria 5703
379 Ga0207691_10073733 3300025940 Bacteria 3079
380 Ga0207691_10117353 3300025940 Bacteria 2361
381 Ga0207691_10118813 3300025940 Bacteria 2345
382 Ga0207691_10246929 3300025940 Unclassified 1542
383 Ga0207691_10325454 3300025940 Bacteria 1317
384 Ga0207691_10333752 3300025940 Bacteria 1299
385 Ga0207711_10386713 3300025941 Bacteria 1299
386 Ga0207689_10001749 3300025942 Bacteria 20508
387 Ga0207689_10025654 3300025942 Bacteria 4938
388 Ga0207689_10033411 3300025942 Bacteria 4275
389 Ga0207689_10074464 3300025942 Bacteria 2790
390 Ga0207689_10220044 3300025942 Bacteria 1569
391 Ga0207689_10552991 3300025942 Bacteria 967
392 Ga0207661_10000840 3300025944 Bacteria 20127
393 Ga0207661_10136241 3300025944 Unclassified 2109
394 Ga0207679_10101550 3300025945 Bacteria 2250
395 Ga0207679_10119168 3300025945 Bacteria 2098
396 Ga0207679_10157702 3300025945 Bacteria 1855
397 Ga0207679_10246208 3300025945 Bacteria 1517
398 Ga0207679_10313765 3300025945 Bacteria 1355
399 Ga0207667_10038615 3300025949 Bacteria 5097
400 Ga0207667_10059510 3300025949 Bacteria 4001
401 Ga0207667_10230113 3300025949 Bacteria 1898
402 Ga0207651_10000443 3300025960 Bacteria 17529
403 Ga0207651_10038917 3300025960 Bacteria 3130
404 Ga0207651_10105832 3300025960 Bacteria 2099
405 Ga0207651_10121906 3300025960 Bacteria 1979
406 Ga0207712_10002419 3300025961 Bacteria 12064
407 Ga0207712_10010419 3300025961 Bacteria 5901
408 Ga0207712_10011005 3300025961 Bacteria 5760
409 Ga0207712_10011230 3300025961 Bacteria 5703
410 Ga0207712_10013226 3300025961 Bacteria 5288
411 Ga0207712_10031999 3300025961 Bacteria 3547
412 Ga0207712_10043666 3300025961 Bacteria 3093
413 Ga0207712_10211910 3300025961 Bacteria 1543
414 Ga0207668_10001307 3300025972 Bacteria 14792
415 Ga0207668_10283472 3300025972 Bacteria 1360
416 Ga0207658_10000629 3300025986 Bacteria 31155
417 Ga0207658_10013187 3300025986 Bacteria 5644
418 Ga0207658_10035097 3300025986 Bacteria 3590
419 Ga0207677_10004861 3300026023 Bacteria 7252
420 Ga0207677_10031065 3300026023 Bacteria 3418
421 Ga0207677_10034992 3300026023 Bacteria 3257
422 Ga0207677_10401047 3300026023 Bacteria 1163
423 Ga0207703_10004145 3300026035 Bacteria 11957
424 Ga0207703_10036672 3300026035 Bacteria 3903
425 Ga0207703_10076041 3300026035 Bacteria 2784
426 Ga0207703_10108561 3300026035 Bacteria 2364
427 Ga0207639_10004235 3300026041 Bacteria 9670
428 Ga0207639_10016611 3300026041 Bacteria 5211
429 Ga0207639_10025857 3300026041 Bacteria 4260
430 Ga0207639_10167312 3300026041 Bacteria 1859
431 Ga0207678_10107753 3300026067 Bacteria 2377
432 Ga0207678_10274469 3300026067 Bacteria 1446
433 Ga0207641_10000015 3300026088 Bacteria 321332
434 Ga0207641_10000637 3300026088 Bacteria 38255
435 Ga0207641_10052991 3300026088 Bacteria 3437
436 Ga0207641_10110439 3300026088 Bacteria 2436
437 Ga0207641_10165931 3300026088 Bacteria 2011
438 Ga0207641_10204080 3300026088 Bacteria 1824
439 Ga0207641_10340521 3300026088 Bacteria 1427
440 Ga0207648_10001276 3300026089 Bacteria 28144
441 Ga0207648_10054525 3300026089 Bacteria 3491
442 Ga0207648_10080004 3300026089 Bacteria 2851
443 Ga0207648_10082472 3300026089 Bacteria 2804
444 Ga0207648_10106154 3300026089 Bacteria 2464
445 Ga0207648_10208016 3300026089 Bacteria 1736
446 Ga0207676_10002535 3300026095 Bacteria 13033
447 Ga0207676_10035998 3300026095 Bacteria 3762
448 Ga0207676_10066001 3300026095 Bacteria 2884
449 Ga0207676_10374613 3300026095 Bacteria 1323
450 Ga0207676_10412562 3300026095 Bacteria 1265
451 Ga0207676_10513945 3300026095 Bacteria 1139
452 Ga0207674_10005270 3300026116 Bacteria 15389
453 Ga0207674_10006323 3300026116 Bacteria 13959
454 Ga0207674_10061581 3300026116 Bacteria 3792
455 Ga0207674_10102190 3300026116 Bacteria 2847
456 Ga0207675_100000791 3300026118 Bacteria 31464
457 Ga0207675_100044239 3300026118 Bacteria 4160
458 Ga0207675_100112585 3300026118 Bacteria 2569
459 Ga0207675_100158154 3300026118 Bacteria 2160
460 Ga0207675_100170713 3300026118 Bacteria 2079
461 Ga0207675_100889104 3300026118 Bacteria 907
462 Ga0207683_10062554 3300026121 Bacteria 3278
463 Ga0207683_10070857 3300026121 Bacteria 3080
464 Ga0207683_10144708 3300026121 Bacteria 2143
465 Ga0207683_10244261 3300026121 Bacteria 1638
466 Ga0207683_10354323 3300026121 Bacteria 1347
467 Ga0207698_10135195 3300026142 Bacteria 2114
468 Ga0207698_10179524 3300026142 Bacteria 1874
469 Ga0207428_10066477 3300027907 Bacteria 2841
470 Ga0268266_10004818 3300028379 Bacteria 12818
471 Ga0268266_10009526 3300028379 Bacteria 8548
472 Ga0268266_10592044 3300028379 Bacteria 1065
473 Ga0268265_10066828 3300028380 Bacteria 2780
474 Ga0268265_10127373 3300028380 Bacteria 2110
475 Ga0268264_10001958 3300028381 Bacteria 18506
476 Ga0268264_10004239 3300028381 Bacteria 12238
477 Ga0268264_10027800 3300028381 Bacteria 4624
478 Ga0268264_10037450 3300028381 Bacteria 3999
479 Ga0268264_10103879 3300028381 Bacteria 2475
480 Ga0307515_10000118 3300028794 Bacteria 190444
481 Ga0265327_10000115 3300031251 Bacteria 173854
482 Ga0265327_10000191 3300031251 Bacteria 130083
483 Ga0265327_10020243 3300031251 Bacteria 4061
484 Ga0307408_100023469 3300031548 Unclassified 4201
485 Ga0307412_10034881 3300031911 Unclassified 3209
486 Ga0307414_10032027 3300032004 Bacteria 3457
487 Ga0373955_0037148 3300035172 Bacteria 2589
488 Ga0373927_0080637 3300035695 Bacteria 2109
489 Ga0373933_0094894 3300035724 Bacteria 1845
490 Ga0373937_0021247 3300036401 Bacteria 5824
491 Ga0373937_0118797 3300036401 Bacteria 2463
492 Ga0373937_0226722 3300036401 Bacteria 1759
493 Ga0395899_0227135 3300037312 Bacteria 1290
494 Ga0395900_0154554 3300037418 Bacteria 2343
495 Ga0395905_0018342 3300037471 Bacteria 6642
496 Ga0395905_0134474 3300037471 Bacteria 2326
497 Ga0395905_0220288 3300037471 Bacteria 1776
498 Ga0436365_1313174 3300039437 Bacteria 18752
499 Ga0439439_0044158 3300041406 Bacteria 1160
500 Ga0439442_007475 3300042002 Bacteria 2197
501 Ga0439449_0055673 3300042007 Bacteria 1461
502 Ga0450899_002619 3300042135 Bacteria 1943
503 Ga0466972_0015584 3300044658 Bacteria 3800
504 Ga0466972_0131704 3300044658 Bacteria 1178
505 Ga0453683_0082157 3300044673 Bacteria 2019
506 Ga0453684_0367965 3300044712 Bacteria 1617
507 Ga0466957_0003931 3300044842 Bacteria 8212
508 Ga0466967_0020593 3300045976 Bacteria 5336
509 Ga0495592_0111839 3300046454 Bacteria 1932
510 Ga0495629_0104248 3300046459 Bacteria 1978
511 Ga0495608_0292099 3300046511 Bacteria 1010
512 Ga0495618_0017235 3300046514 Bacteria 4427
513 Ga0495628_0105920 3300046516 Bacteria 2166
514 Ga0495630_0089673 3300046517 Bacteria 2323
515 Ga0495630_0125914 3300046517 Bacteria 1944
516 Ga0495630_0422218 3300046517 Bacteria 1022
517 Ga0495643_0027257 3300046522 Bacteria 3214
518 Ga0495652_0158688 3300046529 Bacteria 1759
519 Ga0495586_0084640 3300046535 Bacteria 1746
520 Ga0495587_0119783 3300046536 Bacteria 1508
521 Ga0495667_0170404 3300046559 Bacteria 1399
522 Ga0495635_0162836 3300046663 Bacteria 1518
523 Ga0495658_0047968 3300046683 Bacteria 2407
524 Ga0495672_0055635 3300047320 Bacteria 2308
525 Ga0495680_0115725 3300047322 Bacteria 1984
526 Ga0495684_0123035 3300047471 Bacteria 1953
527 Ga0495684_0135040 3300047471 Bacteria 1852
528 Ga0495684_0294114 3300047471 Bacteria 1168
529 Ga0495686_0029011 3300047472 Bacteria 3601
530 Ga0495686_0045820 3300047472 Bacteria 2766
531 Ga0496108_0052353 3300048911 Bacteria 3421
532 Ga0496109_0028678 3300048912 Bacteria 4982
533 Ga0496110_0028886 3300048913 Bacteria 4767
534 Ga0496110_0045652 3300048913 Bacteria 3831
535 Ga0496110_0420155 3300048913 Bacteria 1219
536 Ga0496114_0727231 3300048917 Bacteria 869
537 Ga0501298_003351 3300049521 Bacteria 2483
538 Ga0501299_004745 3300049522 Bacteria 2053
539 Ga0501031_0009209 3300049568 Bacteria 6419
540 Ga0501032_0010337 3300049569 Bacteria 6728
541 Ga0501034_0051308 3300049571 Bacteria 4160
542 Ga0501036_0022513 3300049572 Bacteria 5301
543 Ga0501036_0043239 3300049572 Bacteria 3814
544 Ga0501037_0025030 3300049573 Bacteria 4412
545 Ga0501037_0147757 3300049573 Bacteria 1681
546 Ga0501038_0056967 3300049574 Bacteria 3356
547 Ga0501039_0171528 3300049575 Bacteria 1705
548 Ga0501043_0008277 3300049579 Bacteria 8189
549 Ga0501043_0022394 3300049579 Bacteria 4956
550 Ga0501046_0018347 3300049580 Bacteria 5824
551 Ga0501046_0029613 3300049580 Bacteria 4450
552 Ga0501070_0014914 3300049586 Bacteria 6536
553 Ga0501071_0174442 3300049587 Bacteria 1610
554 Ga0501073_0097903 3300049589 Bacteria 2037
555 Ga0501201_000090 3300049651 Bacteria 6980
556 Ga0501202_001429 3300049652 Bacteria 3833
557 Ga0501207_002113 3300049654 Bacteria 2541
558 Ga0501223_002173 3300049663 Bacteria 4398
559 Ga0501223_020352 3300049663 Bacteria 1301
560 Ga0501224_005729 3300049664 Bacteria 1790
561 Ga0501235_016263 3300049669 Bacteria 1642
562 Ga0501242_005019 3300049674 Bacteria 1479
563 Ga0501243_001888 3300049675 Bacteria 3051
564 Ga0501252_002112 3300049682 Bacteria 1939
565 Ga0501259_002933 3300049688 Bacteria 2736
566 Ga0501259_003440 3300049688 Bacteria 2523
567 Ga0501261_001676 3300049690 Bacteria 2715
568 Ga0501261_009464 3300049690 Bacteria 1272
569 Ga0501225_0005657 3300049705 Bacteria 3663
570 Ga0501234_009604 3300049707 Bacteria 1510
571 Ga0501245_000616 3300049708 Bacteria 4387
572 Ga0501245_003198 3300049708 Bacteria 2213
573 Ga0501079_0042018 3300049741 Bacteria 3531
574 Ga0501080_0052618 3300049742 Bacteria 3790
575 Ga0501241_015578 3300049758 Bacteria 1384
576 Ga0501263_004495 3300049760 Bacteria 1541
577 Ga0501266_010981 3300049763 Bacteria 1156
578 Ga0501268_028616 3300049765 Bacteria 997
579 Ga0501270_004792 3300049767 Bacteria 1537
580 Ga0501283_029082 3300049779 Bacteria 920
581 Ga0501035_0039542 3300049822 Bacteria 4268
582 Ga0501044_0009683 3300049823 Bacteria 10482
583 Ga0501044_0015662 3300049823 Bacteria 8166
584 Ga0501044_0058388 3300049823 Bacteria 3957
585 nmdc:mga05p37_589631_c1 3300050507 Bacteria 1257
586 nmdc:mga05p37_86408_c1 3300050507 Bacteria 3865
587 nmdc:mga09592_2970_c1 3300050508 Bacteria 13746
588 nmdc:mga09592_89883_c1 3300050508 Bacteria 2624
589 nmdc:mga06r32_62591_c1 3300050510 Bacteria 3585
590 nmdc:mga08y16_273522_c1 3300050511 Bacteria 1743
591 nmdc:mga08y16_34266_c1 3300050511 Bacteria 5334
592 nmdc:mga08y16_40429_c1 3300050511 Bacteria 4889
593 Ga0495619_0006408 3300053085 Bacteria 7455
594 Ga0500578_0066488 3300053086 Bacteria 2299
595 Ga0500636_0033291 3300053177 Bacteria 3052
596 Ga0501084_0354991 3300054114 Bacteria 1238
597 Ga0501082_0110247 3300060353 Bacteria 2382
598 Ga0068859_100393275
599 JGI24740J21852_10011654
600 rootH2_10069618
601 rootL2_10264449
602 JGI25160J50197_1005029
603 Ga0065712_10073587
604 Ga0065715_10103531
605 Ga0070676_10000375
606 Ga0070676_10004885
607 Ga0070676_10006242
608 Ga0070676_10034710
609 Ga0070676_10087563
610 Ga0070676_10094299
611 Ga0070676_10318638
612 Ga0070683_100005920
613 Ga0070683_100063404
614 Ga0070690_100012971
615 Ga0070690_100173510
616 Ga0070690_100205898
617 Ga0070670_100018618
618 Ga0070670_100079324
619 Ga0070670_100094815
620 Ga0070670_100143324
621 Ga0070670_100222419
622 Ga0070670_100252236
623 Ga0070670_100446516
624 Ga0068869_100007341
625 Ga0068869_100030132
626 Ga0068869_100060301
627 Ga0068869_100101238
628 Ga0068869_100125261
629 Ga0068869_100287478
630 Ga0070666_10000132
631 Ga0070666_10006643
632 Ga0070680_100293178
633 Ga0070682_100109111
634 Ga0068868_100000075
635 Ga0068868_100002272
636 Ga0068868_100377828
637 Ga0070689_100009176
638 Ga0070689_100015800
639 Ga0070689_100148292
640 Ga0070691_10013689
641 Ga0070687_100117706
642 Ga0070687_100268805
643 Ga0070661_100000277
644 Ga0070661_100062556
645 Ga0070668_100000859
646 Ga0070668_100338010
647 Ga0070668_100498075
648 Ga0070669_100003023
649 Ga0070675_100009919
650 Ga0070675_100030595
651 Ga0070675_100118683
652 Ga0070675_100294980
653 Ga0070671_100020821
654 Ga0070671_100070912
655 Ga0070671_100086328
656 Ga0070671_100363559
657 Ga0070671_100450186
658 Ga0070674_100009204
659 Ga0070674_100147542
660 Ga0070674_100251052
661 Ga0070674_100425076
662 Ga0070673_100000448
663 Ga0070673_100005672
664 Ga0070673_100017306
665 Ga0070673_100017915
666 Ga0070673_100019388
667 Ga0070673_100061208
668 Ga0070673_100062231
669 Ga0070673_100182204
670 Ga0070673_100187065
671 Ga0070688_100004571
672 Ga0070688_100017477
673 Ga0070688_100024605
674 Ga0070688_100157524
675 Ga0070659_100019379
676 Ga0070667_100000482
677 Ga0070667_100017378
678 Ga0070667_100038040
679 Ga0070667_100176274
680 Ga0070667_100293730
681 Ga0070700_100182997
682 Ga0070678_100198015
683 Ga0070662_100009485
684 Ga0070662_100020503
685 Ga0070662_100353009
686 Ga0070681_10106717
687 Ga0068867_100005707
688 Ga0068867_100014228
689 Ga0068867_100076697
690 Ga0068867_100360262
691 Ga0070685_10019109
692 Ga0070685_10035007
693 Ga0070698_100000791
694 Ga0070679_100018717
695 Ga0070679_100415481
696 Ga0070684_100000773
697 Ga0070684_100075450
698 Ga0068853_100007384
699 Ga0068853_100014216
700 Ga0068853_100018278
701 Ga0068853_100044684
702 Ga0068853_100419273
703 Ga0070672_100000361
704 Ga0070672_100014615
705 Ga0070672_100038656
706 Ga0070672_100137013
707 Ga0070672_100187330
708 Ga0070672_100269960
709 Ga0070672_100369103
710 Ga0070686_100284129
711 Ga0070665_100002163
712 Ga0070665_100566532
713 Ga0068855_100166084
714 Ga0070664_100008983
715 Ga0070664_100029540
716 Ga0070664_100031538
717 Ga0070664_100039762
718 Ga0070664_100183357
719 Ga0070664_100400082
720 Ga0068857_100003006
721 Ga0068857_100014247
722 Ga0068857_100290532
723 Ga0068852_100057165
724 Ga0068852_100100085
725 Ga0068852_100235135
726 Ga0068852_100293005
727 Ga0068859_100000003
728 Ga0068859_100017056
729 Ga0068859_100108851
730 Ga0068859_100138083
731 Ga0068859_100307206
732 Ga0068859_100386746
733 Ga0068859_100890288
734 Ga0068864_100000785
735 Ga0068864_100026328
736 Ga0068864_100046615
737 Ga0068864_100047620
738 Ga0068864_100109363
739 Ga0068864_100189315
740 Ga0068861_100022280
741 Ga0068861_100088713
742 Ga0068851_10002930
743 Ga0068851_10008931
744 Ga0068851_10051718
745 Ga0068870_10005311
746 Ga0068863_100000394
747 Ga0068863_100044449
748 Ga0068863_100054028
749 Ga0068863_100066866
750 Ga0068863_100123174
751 Ga0068863_100154531
752 Ga0068863_100154773
753 Ga0068863_100242534
754 Ga0068863_100426134
755 Ga0068858_100034696
756 Ga0068858_100070155
757 Ga0068858_100124817
758 Ga0068858_100359894
759 Ga0068860_100002493
760 Ga0068860_100005227
761 Ga0068860_100039307
762 Ga0068860_100052463
763 Ga0068860_100109512
764 Ga0068860_100228584
765 Ga0068860_100317143
766 Ga0068860_100391000
767 Ga0068862_100004418
768 Ga0068862_100066495
769 Ga0068862_100154962
770 Ga0081539_10000366
771 Ga0081539_10004761
772 Ga0081539_10119218
773 Ga0070715_10080125
774 Ga0075366_10042330
775 Ga0097621_100000448
776 Ga0097621_100000626
777 Ga0097621_100026951
778 Ga0097621_100048531
779 Ga0097621_100156290
780 Ga0097621_100166727
781 Ga0097621_100251845
782 Ga0097621_100304435
783 Ga0068871_100081278
784 Ga0068871_100150041
785 Ga0068871_100300409
786 Ga0075428_100051884
787 Ga0075428_100082193
788 Ga0075430_100024120
789 Ga0075431_100083509
790 Ga0075429_100004398
791 Ga0068865_100018872
792 Ga0068865_100064790
793 Ga0097620_100000003
794 Ga0097620_100017056
795 Ga0097620_100108851
796 Ga0097620_100138083
797 Ga0097620_100307208
798 Ga0097620_100386724
799 Ga0097620_100393269
800 Ga0097620_100890463
801 Ga0075435_100273548
802 Ga0105240_10177588
803 Ga0105240_10486688
804 Ga0111539_10005429
805 Ga0111539_10348582
806 Ga0105245_10114799
807 Ga0105247_10001444
808 Ga0105247_10003817
809 Ga0105247_10031211
810 Ga0114129_10093918
811 Ga0114129_10245295
812 Ga0105243_10524744
813 Ga0105241_10001671
814 Ga0105241_10008306
815 Ga0105242_10022509
816 Ga0105242_10051028
817 Ga0105242_10182857
818 Ga0105248_10200398
819 Ga0105248_10446552
820 Ga0105248_11126704
821 Ga0105237_10001393
822 Ga0105237_10166606
823 Ga0105249_10002967
824 Ga0105249_10004604
825 Ga0105249_10019812
826 Ga0105249_10026406
827 Ga0105249_10033426
828 Ga0105249_10035661
829 Ga0105249_10042290
830 Ga0105249_10042675
831 Ga0105249_10044800
832 Ga0105249_10163544
833 Ga0105239_10021840
834 Ga0105239_10021884
835 Ga0105239_10736121
836 Ga0105246_10041242
837 Ga0157373_10001087
838 Ga0157373_10040971
839 Ga0157373_10109128
840 Ga0157373_10373556
841 Ga0157371_10001061
842 Ga0157371_10358654
843 Ga0157370_10277503
844 Ga0157370_10349705
845 Ga0157374_10001371
846 Ga0157374_10002589
847 Ga0157374_10035153
848 Ga0157374_10041157
849 Ga0157374_10296626
850 Ga0157374_10420630
851 Ga0157374_10722312
852 Ga0157378_10003090
853 Ga0157378_10003886
854 Ga0157378_10026601
855 Ga0157378_10082724
856 Ga0157378_10200574
857 Ga0157378_10385063
858 Ga0163162_10000328
859 Ga0163162_10000377
860 Ga0163162_10002723
861 Ga0163162_10034203
862 Ga0163162_10037495
863 Ga0163162_10064650
864 Ga0163162_10065915
865 Ga0163162_10120223
866 Ga0163162_10172044
867 Ga0163162_10229946
868 Ga0163162_10240405
869 Ga0163162_10269058
870 Ga0163162_10477988
871 Ga0157372_10016543
872 Ga0157372_10051539
873 Ga0157372_10108466
874 Ga0157372_10461416
875 Ga0157372_10798523
876 Ga0157375_10004745
877 Ga0157375_10013323
878 Ga0157375_10025603
879 Ga0157375_10035797
880 Ga0157375_10055146
881 Ga0157375_10056304
882 Ga0157375_10107476
883 Ga0157375_10130832
884 Ga0157375_10143811
885 Ga0157375_10452066
886 Ga0157375_10619434
887 Ga0157375_10793840
888 Ga0163163_10000348
889 Ga0163163_10000752
890 Ga0163163_10063516
891 Ga0163163_10160485
892 Ga0163163_10188170
893 Ga0163163_10500156
894 Ga0157380_10003484
895 Ga0157380_10011917
896 Ga0157380_10361860
897 Ga0157380_10380759
898 Ga0157377_10001155
899 Ga0157377_10008430
900 Ga0157377_10067790
901 Ga0157377_10164409
902 Ga0157377_10172715
903 Ga0157379_10047283
904 Ga0157379_10164435
905 Ga0157376_10000381
906 Ga0157376_10030198
907 Ga0157376_10079741
908 Ga0157376_10081778
909 Ga0157376_10210767
910 Ga0157376_10255728
911 Ga0157376_10453753
912 Ga0157376_10506622
913 Ga0163161_10019724
914 Ga0163161_10053033
915 Ga0163161_10053472
916 Ga0163161_10055024
917 Ga0163161_10210665
918 Ga0163161_10217298
919 Ga0209646_1006014
920 Ga0207426_1000052
921 Ga0207697_10056128
922 Ga0207656_10006843
923 Ga0207682_10033580
924 Ga0207710_10007530
925 Ga0207688_10033019
926 Ga0207688_10065776
927 Ga0207680_10000014
928 Ga0207680_10019434
929 Ga0207680_10083245
930 Ga0207680_10128926
931 Ga0207647_10065934
932 Ga0207645_10000949
933 Ga0207645_10003750
934 Ga0207645_10008195
935 Ga0207645_10053554
936 Ga0207645_10077273
937 Ga0207643_10028393
938 Ga0207654_10002095
939 Ga0207654_10009042
940 Ga0207707_10002312
941 Ga0207707_10093075
942 Ga0207695_10127357
943 Ga0207671_10000746
944 Ga0207671_10113496
945 Ga0207660_10003846
946 Ga0207662_10282167
947 Ga0207662_10389547
948 Ga0207657_10013150
949 Ga0207649_10003070
950 Ga0207649_10012025
951 Ga0207652_10180463
952 Ga0207681_10012913
953 Ga0207681_10120589
954 Ga0207650_10140506
955 Ga0207650_10167289
956 Ga0207650_10190750
957 Ga0207650_10442526
958 Ga0207659_10052858
959 Ga0207659_10299853
960 Ga0207687_10064062
961 Ga0207644_10079998
962 Ga0207644_10156315
963 Ga0207706_10022124
964 Ga0207706_10031196
965 Ga0207706_10248285
966 Ga0207706_10449531
967 Ga0207686_10000998
968 Ga0207670_10116038
969 Ga0207669_10143214
970 Ga0207669_10200998
971 Ga0207704_10004208
972 Ga0207704_10150264
973 Ga0207691_10000037
974 Ga0207691_10009239
975 Ga0207691_10024267
976 Ga0207691_10073733
977 Ga0207691_10117353
978 Ga0207691_10118813
979 Ga0207691_10246929
980 Ga0207691_10325454
981 Ga0207691_10333752
982 Ga0207711_10386713
983 Ga0207689_10001749
984 Ga0207689_10025654
985 Ga0207689_10033411
986 Ga0207689_10074464
987 Ga0207689_10220044
988 Ga0207689_10552991
989 Ga0207661_10000840
990 Ga0207661_10136241
991 Ga0207679_10101550
992 Ga0207679_10119168
993 Ga0207679_10157702
994 Ga0207679_10246208
995 Ga0207679_10313765
996 Ga0207667_10038615
997 Ga0207667_10059510
998 Ga0207667_10230113
999 Ga0207651_10000443
1000 Ga0207651_10038917
1001 Ga0207651_10105832
1002 Ga0207651_10121906
1003 Ga0207712_10002419
1004 Ga0207712_10010419
1005 Ga0207712_10011005
1006 Ga0207712_10011230
1007 Ga0207712_10013226
1008 Ga0207712_10031999
1009 Ga0207712_10043666
1010 Ga0207712_10211910
1011 Ga0207668_10001307
1012 Ga0207668_10283472
1013 Ga0207658_10000629
1014 Ga0207658_10013187
1015 Ga0207658_10035097
1016 Ga0207677_10004861
1017 Ga0207677_10031065
1018 Ga0207677_10034992
1019 Ga0207677_10401047
1020 Ga0207703_10004145
1021 Ga0207703_10036672
1022 Ga0207703_10076041
1023 Ga0207703_10108561
1024 Ga0207639_10004235
1025 Ga0207639_10016611
1026 Ga0207639_10025857
1027 Ga0207639_10167312
1028 Ga0207678_10107753
1029 Ga0207678_10274469
1030 Ga0207641_10000015
1031 Ga0207641_10000637
1032 Ga0207641_10052991
1033 Ga0207641_10110439
1034 Ga0207641_10165931
1035 Ga0207641_10204080
1036 Ga0207641_10340521
1037 Ga0207648_10001276
1038 Ga0207648_10054525
1039 Ga0207648_10080004
1040 Ga0207648_10082472
1041 Ga0207648_10106154
1042 Ga0207648_10208016
1043 Ga0207676_10002535
1044 Ga0207676_10035998
1045 Ga0207676_10066001
1046 Ga0207676_10374613
1047 Ga0207676_10412562
1048 Ga0207676_10513945
1049 Ga0207674_10005270
1050 Ga0207674_10006323
1051 Ga0207674_10061581
1052 Ga0207674_10102190
1053 Ga0207675_100000791
1054 Ga0207675_100044239
1055 Ga0207675_100112585
1056 Ga0207675_100158154
1057 Ga0207675_100170713
1058 Ga0207675_100889104
1059 Ga0207683_10062554
1060 Ga0207683_10070857
1061 Ga0207683_10144708
1062 Ga0207683_10244261
1063 Ga0207683_10354323
1064 Ga0207698_10135195
1065 Ga0207698_10179524
1066 Ga0207428_10066477
1067 Ga0268266_10004818
1068 Ga0268266_10009526
1069 Ga0268266_10592044
1070 Ga0268265_10066828
1071 Ga0268265_10127373
1072 Ga0268264_10001958
1073 Ga0268264_10004239
1074 Ga0268264_10027800
1075 Ga0268264_10037450
1076 Ga0268264_10103879
1077 Ga0307515_10000118
1078 Ga0265327_10000115
1079 Ga0265327_10000191
1080 Ga0265327_10020243
1081 Ga0307408_100023469
1082 Ga0307412_10034881
1083 Ga0307414_10032027
1084 Ga0373955_0037148
1085 Ga0373927_0080637
1086 Ga0373933_0094894
1087 Ga0373937_0021247
1088 Ga0373937_0118797
1089 Ga0373937_0226722
1090 Ga0395899_0227135
1091 Ga0395900_0154554
1092 Ga0395905_0018342
1093 Ga0395905_0134474
1094 Ga0395905_0220288
1095 Ga0436365_1313174
1096 Ga0439439_0044158
1097 Ga0439442_007475
1098 Ga0439449_0055673
1099 Ga0450899_002619
1100 Ga0466972_0015584
1101 Ga0466972_0131704
1102 Ga0453683_0082157
1103 Ga0453684_0367965
1104 Ga0466957_0003931
1105 Ga0466967_0020593
1106 Ga0495592_0111839
1107 Ga0495629_0104248
1108 Ga0495608_0292099
1109 Ga0495618_0017235
1110 Ga0495628_0105920
1111 Ga0495630_0089673
1112 Ga0495630_0125914
1113 Ga0495630_0422218
1114 Ga0495643_0027257
1115 Ga0495652_0158688
1116 Ga0495586_0084640
1117 Ga0495587_0119783
1118 Ga0495667_0170404
1119 Ga0495635_0162836
1120 Ga0495658_0047968
1121 Ga0495672_0055635
1122 Ga0495680_0115725
1123 Ga0495684_0123035
1124 Ga0495684_0135040
1125 Ga0495684_0294114
1126 Ga0495686_0029011
1127 Ga0495686_0045820
1128 Ga0496108_0052353
1129 Ga0496109_0028678
1130 Ga0496110_0028886
1131 Ga0496110_0045652
1132 Ga0496110_0420155
1133 Ga0496114_0727231
1134 Ga0501298_003351
1135 Ga0501299_004745
1136 Ga0501031_0009209
1137 Ga0501032_0010337
1138 Ga0501034_0051308
1139 Ga0501036_0022513
1140 Ga0501036_0043239
1141 Ga0501037_0025030
1142 Ga0501037_0147757
1143 Ga0501038_0056967
1144 Ga0501039_0171528
1145 Ga0501043_0008277
1146 Ga0501043_0022394
1147 Ga0501046_0018347
1148 Ga0501046_0029613
1149 Ga0501070_0014914
1150 Ga0501071_0174442
1151 Ga0501073_0097903
1152 Ga0501201_000090
1153 Ga0501202_001429
1154 Ga0501207_002113
1155 Ga0501223_002173
1156 Ga0501223_020352
1157 Ga0501224_005729
1158 Ga0501235_016263
1159 Ga0501242_005019
1160 Ga0501243_001888
1161 Ga0501252_002112
1162 Ga0501259_002933
1163 Ga0501259_003440
1164 Ga0501261_001676
1165 Ga0501261_009464
1166 Ga0501225_0005657
1167 Ga0501234_009604
1168 Ga0501245_000616
1169 Ga0501245_003198
1170 Ga0501079_0042018
1171 Ga0501080_0052618
1172 Ga0501241_015578
1173 Ga0501263_004495
1174 Ga0501266_010981
1175 Ga0501268_028616
1176 Ga0501270_004792
1177 Ga0501283_029082
1178 Ga0501035_0039542
1179 Ga0501044_0009683
1180 Ga0501044_0015662
1181 Ga0501044_0058388
1182 nmdc:mga05p37_589631_c1
1183 nmdc:mga05p37_86408_c1
1184 nmdc:mga09592_2970_c1
1185 nmdc:mga09592_89883_c1
1186 nmdc:mga06r32_62591_c1
1187 nmdc:mga08y16_273522_c1
1188 nmdc:mga08y16_34266_c1
1189 nmdc:mga08y16_40429_c1
1190 Ga0495619_0006408
1191 Ga0500578_0066488
1192 Ga0500636_0033291
1193 Ga0501084_0354991
1194 Ga0501082_0110247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

63

290

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8201 44 285
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.8094 44 290
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8048 44 278
7cj9-assembly4.cif.gz_H crystal structure of n-terminal his-tagged d-allulose 3-epimerase from methylomonas sp. with additional c-terminal residues 0.7915 44 290
3kws-assembly1.cif.gz_B crystal structure of putative sugar isomerase (yp_001305149.1) from parabacteroides distasonis atcc 8503 at 1.68 a resolution 0.7849 44 291
ID Description Score Start End Superfamily
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8354 44 290 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8294 44 287 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8246 44 291 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8128 44 290 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8008 46 285 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A3M0YU05-F1-model_v4 Hydroxypyruvate isomerase 0.9452 43 294 GO:0016853
AF-A0A3D4TDJ3-F1-model_v4 Hydroxypyruvate isomerase 0.942 45 294 GO:0016853
AF-A0A4P5T792-F1-model_v4 Hydroxypyruvate isomerase 0.9389 44 294 GO:0016853
AF-A0A3D4TDJ3-F1-model_v4 Hydroxypyruvate isomerase 0.9383 45 294 GO:0016853
AF-A0A5C6C4F0-F1-model_v4 Hydroxypyruvate isomerase (EC 5.3.1.22) 0.9379 42 294 GO:0008903

Map