F467645

General Info

Members Datasets Scaffolds Average Seq Length
597 312 1192 106

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100000352|Ga0068864_10000035233
Length 125
Sequence MDREPRVRYRAGQARGAWLMAWVWLVIGGLFEVGFTTCLRHVDSFRNIPWTLGFLASVALSMGLLEVASRSIPMGTAYAVWGGIGALGTVIVGIAWYQEPASLPRLLLILGVVACIAGLKLTAGR

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
183 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
186 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
187 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
191 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
242 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
279 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
280 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
288 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
295 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
298 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
299 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
300 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
301 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
302 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
303 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
305 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
306 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
307 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
308 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
309 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
310 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
311 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
312 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0.67
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.37
Nodule 0.34
Rhizoplane 3.18
Rhizosphere 80.74
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100000352 3300005618 Bacteria 40434
2 JGI24736J21556_1019606 3300001904 Bacteria 1067
3 JGI24741J21665_1002301 3300001915 Bacteria 5024
4 JGI24741J21665_1047714 3300001915 Bacteria 630
5 JGI24740J21852_10012217 3300001979 Bacteria 3242
6 JGI24737J22298_10000396 3300001990 Bacteria 14833
7 JGI24735J21928_10133204 3300002067 Bacteria 717
8 JGI24742J22300_10102598 3300002244 Bacteria 554
9 JGI25165J46597_1000065 3300003214 Bacteria 199761
10 rootH1_10225339 3300003323 Bacteria 2417
11 Ga0055525_1000144 3300003759 Bacteria 98575
12 Ga0055542_1000177 3300003762 Bacteria 78838
13 Ga0055529_1000350 3300003763 Bacteria 51011
14 Ga0055530_10000072 3300003791 Bacteria 85675
15 Ga0055531_10000114 3300003794 Bacteria 88453
16 Ga0065165_1006176 3300005262 Bacteria 6394
17 Ga0065165_1020829 3300005262 Bacteria 2295
18 Ga0065165_1140737 3300005262 Bacteria 570
19 Ga0065714_10103338 3300005288 Bacteria 1605
20 Ga0065707_10415222 3300005295 Bacteria 837
21 Ga0070658_10000003 3300005327 Bacteria 465963
22 Ga0070658_10742410 3300005327 Bacteria 852
23 Ga0070658_11200466 3300005327 Bacteria 659
24 Ga0070676_10016535 3300005328 Bacteria 4080
25 Ga0070676_10648735 3300005328 Bacteria 766
26 Ga0070683_100897458 3300005329 Bacteria 850
27 Ga0070670_100001053 3300005331 Bacteria 21912
28 Ga0070670_100714230 3300005331 Bacteria 902
29 Ga0070677_10036893 3300005333 Bacteria 1904
30 Ga0070677_10541096 3300005333 Bacteria 637
31 Ga0070666_10077145 3300005335 Bacteria 2274
32 Ga0070682_100190927 3300005337 Bacteria 1438
33 Ga0070660_100002551 3300005339 Bacteria 12486
34 Ga0070660_100029820 3300005339 Bacteria 4090
35 Ga0070660_100041841 3300005339 Bacteria 3494
36 Ga0070660_100202111 3300005339 Bacteria 1612
37 Ga0070660_100730299 3300005339 Bacteria 831
38 Ga0070689_101289142 3300005340 Bacteria 658
39 Ga0070661_100000113 3300005344 Bacteria 67566
40 Ga0070661_100008232 3300005344 Bacteria 7195
41 Ga0070661_100107965 3300005344 Bacteria 2076
42 Ga0070661_100343102 3300005344 Bacteria 1170
43 Ga0070661_100577684 3300005344 Bacteria 907
44 Ga0070668_100000056 3300005347 Bacteria 70052
45 Ga0070669_100014279 3300005353 Bacteria 5651
46 Ga0070669_100044837 3300005353 Bacteria 3222
47 Ga0070669_100236958 3300005353 Bacteria 1448
48 Ga0070675_100052628 3300005354 Bacteria 3348
49 Ga0070675_100316916 3300005354 Bacteria 1377
50 Ga0070675_100379172 3300005354 Bacteria 1258
51 Ga0070671_100000601 3300005355 Bacteria 25698
52 Ga0070671_100443998 3300005355 Bacteria 1113
53 Ga0070674_100003119 3300005356 Bacteria 9231
54 Ga0070674_100028641 3300005356 Bacteria 3659
55 Ga0070673_100229067 3300005364 Bacteria 1611
56 Ga0070659_100027847 3300005366 Bacteria 4357
57 Ga0070659_100029300 3300005366 Bacteria 4254
58 Ga0070659_100029669 3300005366 Bacteria 4227
59 Ga0070659_101817737 3300005366 Bacteria 546
60 Ga0070667_100000215 3300005367 Bacteria 67317
61 Ga0070667_100005459 3300005367 Bacteria 10620
62 Ga0070667_100062360 3300005367 Bacteria 3158
63 Ga0070667_100839575 3300005367 Bacteria 854
64 Ga0070714_101794055 3300005435 Bacteria 599
65 Ga0070700_101037604 3300005441 Bacteria 676
66 Ga0070663_100229097 3300005455 Bacteria 1462
67 Ga0070663_100539552 3300005455 Bacteria 973
68 Ga0070663_100868490 3300005455 Bacteria 777
69 Ga0070663_101223855 3300005455 Bacteria 660
70 Ga0070678_100000062 3300005456 Bacteria 39682
71 Ga0070678_100126035 3300005456 Bacteria 2027
72 Ga0070662_100394431 3300005457 Bacteria 1141
73 Ga0070662_100415300 3300005457 Bacteria 1112
74 Ga0070662_100488143 3300005457 Bacteria 1026
75 Ga0070681_10092271 3300005458 Bacteria 2977
76 Ga0068867_100330417 3300005459 Bacteria 1266
77 Ga0070679_101088089 3300005530 Bacteria 744
78 Ga0068853_100456201 3300005539 Bacteria 1203
79 Ga0068853_100496244 3300005539 Bacteria 1152
80 Ga0068853_101336409 3300005539 Bacteria 693
81 Ga0070672_100306487 3300005543 Bacteria 1347
82 Ga0070672_100498781 3300005543 Bacteria 1053
83 Ga0070672_101017348 3300005543 Bacteria 735
84 Ga0070696_100596241 3300005546 Bacteria 890
85 Ga0070665_100000257 3300005548 Bacteria 87607
86 Ga0070665_100007143 3300005548 Bacteria 11356
87 Ga0070665_100947593 3300005548 Bacteria 873
88 Ga0068855_101664574 3300005563 Bacteria 651
89 Ga0070664_100024101 3300005564 Bacteria 5031
90 Ga0068857_100207517 3300005577 Bacteria 1787
91 Ga0068857_100399032 3300005577 Bacteria 1280
92 Ga0068857_102149920 3300005577 Bacteria 548
93 Ga0068854_100014422 3300005578 Bacteria 5211
94 Ga0068854_100018019 3300005578 Bacteria 4734
95 Ga0068856_100189685 3300005614 Bacteria 2069
96 Ga0068856_100342950 3300005614 Bacteria 1512
97 Ga0068852_100560698 3300005616 Bacteria 1143
98 Ga0068852_100570564 3300005616 Bacteria 1133
99 Ga0068852_100724883 3300005616 Bacteria 1005
100 Ga0068859_101327437 3300005617 Bacteria 793
101 Ga0068864_100002862 3300005618 Bacteria 14259
102 Ga0068864_102058321 3300005618 Bacteria 577
103 Ga0068861_100076201 3300005719 Bacteria 2613
104 Ga0068861_100532762 3300005719 Bacteria 1067
105 Ga0068851_10040461 3300005834 Bacteria 2342
106 Ga0068851_10285810 3300005834 Bacteria 944
107 Ga0068863_100007196 3300005841 Bacteria 10916
108 Ga0068863_100067486 3300005841 Bacteria 3383
109 Ga0068863_101527283 3300005841 Bacteria 676
110 Ga0068863_102638950 3300005841 Bacteria 511
111 Ga0068858_100000132 3300005842 Bacteria 77767
112 Ga0068858_100000444 3300005842 Bacteria 43311
113 Ga0068860_100000049 3300005843 Bacteria 208782
114 Ga0068860_100007900 3300005843 Bacteria 10619
115 Ga0068860_100058133 3300005843 Bacteria 3676
116 Ga0068860_102128909 3300005843 Bacteria 582
117 Ga0068862_100003201 3300005844 Bacteria 14186
118 Ga0075369_10038248 3300006186 Bacteria 2047
119 Ga0075366_10069175 3300006195 Bacteria 2101
120 Ga0068871_100104728 3300006358 Bacteria 2373
121 Ga0068865_100355287 3300006881 Bacteria 1188
122 Ga0097620_101327583 3300006931 Bacteria 793
123 Ga0079104_1047134 3300006946 Bacteria 976
124 Ga0105240_10015064 3300009093 Bacteria 10525
125 Ga0105240_10278201 3300009093 Bacteria 1924
126 Ga0105240_10451165 3300009093 Bacteria 1439
127 Ga0105240_11845007 3300009093 Bacteria 630
128 Ga0111539_10165127 3300009094 Bacteria 2589
129 Ga0105245_10008344 3300009098 Bacteria 9053
130 Ga0105245_10692273 3300009098 Bacteria 1052
131 Ga0105243_10000180 3300009148 Bacteria 73474
132 Ga0105243_10056295 3300009148 Bacteria 3126
133 Ga0105243_11016098 3300009148 Bacteria 833
134 Ga0105241_10000907 3300009174 Bacteria 22391
135 Ga0105241_10048235 3300009174 Bacteria 3240
136 Ga0105241_11044736 3300009174 Bacteria 766
137 Ga0105241_11730802 3300009174 Bacteria 608
138 Ga0105242_11650717 3300009176 Bacteria 676
139 Ga0105248_10004622 3300009177 Bacteria 15222
140 Ga0105248_10010024 3300009177 Bacteria 10432
141 Ga0105248_10417994 3300009177 Bacteria 1510
142 Ga0105248_12371394 3300009177 Bacteria 604
143 Ga0105237_10181506 3300009545 Bacteria 2105
144 Ga0105237_11106934 3300009545 Bacteria 799
145 Ga0105237_12554711 3300009545 Bacteria 521
146 Ga0105237_12554719 3300009545 Bacteria 521
147 Ga0105238_10152896 3300009551 Bacteria 2282
148 Ga0105238_10403163 3300009551 Bacteria 1361
149 Ga0105238_11801713 3300009551 Bacteria 644
150 Ga0105249_13415406 3300009553 Bacteria 511
151 Ga0105239_10248457 3300010375 Bacteria 1998
152 Ga0105239_10629855 3300010375 Bacteria 1224
153 Ga0105239_11006881 3300010375 Bacteria 958
154 Ga0105239_11011803 3300010375 Bacteria 956
155 Ga0105246_10093912 3300011119 Bacteria 2168
156 Ga0157373_10014410 3300013100 Bacteria 5796
157 Ga0157373_10040161 3300013100 Bacteria 3349
158 Ga0157373_10312746 3300013100 Unclassified 1116
159 Ga0157373_10583642 3300013100 Bacteria 813
160 Ga0157373_10852228 3300013100 Bacteria 674
161 Ga0157371_10000110 3300013102 Bacteria 124933
162 Ga0157371_10036828 3300013102 Bacteria 3503
163 Ga0157371_10279560 3300013102 Bacteria 1206
164 Ga0157370_10485121 3300013104 Bacteria 1136
165 Ga0157370_10619723 3300013104 Bacteria 990
166 Ga0157370_10646026 3300013104 Bacteria 967
167 Ga0157370_11103336 3300013104 Unclassified 717
168 Ga0157370_11383026 3300013104 Bacteria 633
169 Ga0157370_11456554 3300013104 Bacteria 616
170 Ga0157370_11968954 3300013104 Bacteria 524
171 Ga0157369_10000751 3300013105 Bacteria 41778
172 Ga0157369_10012896 3300013105 Bacteria 9475
173 Ga0157369_10169727 3300013105 Bacteria 2299
174 Ga0157369_11100131 3300013105 Bacteria 812
175 Ga0157369_11634417 3300013105 Bacteria 655
176 Ga0157369_11971922 3300013105 Unclassified 592
177 Ga0157369_12334079 3300013105 Bacteria 542
178 Ga0157374_10046026 3300013296 Bacteria 4039
179 Ga0163162_10003520 3300013306 Bacteria 14982
180 Ga0163162_10466288 3300013306 Bacteria 1394
181 Ga0163162_13229973 3300013306 Bacteria 523
182 Ga0157372_10134825 3300013307 Bacteria 2843
183 Ga0157372_10253089 3300013307 Bacteria 2045
184 Ga0157372_10344368 3300013307 Bacteria 1736
185 Ga0157372_11048107 3300013307 Bacteria 944
186 Ga0157372_11870457 3300013307 Bacteria 690
187 Ga0157372_12690739 3300013307 Bacteria 571
188 Ga0157380_11687674 3300014326 Bacteria 691
189 Ga0157380_13368751 3300014326 Bacteria 511
190 Ga0182008_10240257 3300014497 Bacteria 932
191 Ga0157376_11667802 3300014969 Bacteria 672
192 Ga0197907_10444849 3300020069 Bacteria 667
193 Ga0206354_10118545 3300020081 Bacteria 1515
194 Ga0206353_11409418 3300020082 Bacteria 3019
195 Ga0154015_1447161 3300020610 Unclassified 528
196 Ga0213873_10000057 3300021358 Bacteria 24447
197 Ga0213876_10000021 3300021384 Bacteria 260105
198 Ga0213876_10000473 3300021384 Bacteria 32032
199 Ga0213876_10012578 3300021384 Bacteria 4503
200 Ga0209674_105941 3300025226 Bacteria 1729
201 Ga0209563_100130 3300025230 Bacteria 98627
202 Ga0209437_102317 3300025233 Bacteria 3736
203 Ga0209646_1038831 3300025246 Bacteria 607
204 Ga0209026_1016978 3300025250 Bacteria 1170
205 Ga0209026_1046000 3300025250 Bacteria 627
206 Ga0209148_1000008 3300025254 Bacteria 1504371
207 Ga0209233_1000107 3300025261 Bacteria 267399
208 Ga0209455_1000002 3300025272 Bacteria 1505459
209 Ga0209455_1010997 3300025272 Bacteria 2258
210 Ga0209455_1056729 3300025272 Bacteria 526
211 Ga0209050_1000209 3300025298 Bacteria 130884
212 Ga0209257_1000027 3300025304 Bacteria 703541
213 Ga0207697_10071803 3300025315 Bacteria 1451
214 Ga0207697_10078237 3300025315 Bacteria 1391
215 Ga0207656_10005165 3300025321 Bacteria 4592
216 Ga0207656_10324980 3300025321 Bacteria 765
217 Ga0207682_10024490 3300025893 Bacteria 2390
218 Ga0207682_10278487 3300025893 Bacteria 782
219 Ga0207688_10043214 3300025901 Bacteria 2509
220 Ga0207680_10011910 3300025903 Bacteria 4414
221 Ga0207680_10355105 3300025903 Bacteria 1030
222 Ga0207647_10015260 3300025904 Bacteria 5273
223 Ga0207647_10023260 3300025904 Bacteria 4101
224 Ga0207645_10034794 3300025907 Bacteria 3236
225 Ga0207645_10312475 3300025907 Bacteria 1047
226 Ga0207705_10000005 3300025909 Bacteria 673478
227 Ga0207705_10000033 3300025909 Bacteria 223997
228 Ga0207705_10163427 3300025909 Bacteria 1673
229 Ga0207654_10000742 3300025911 Bacteria 18103
230 Ga0207707_10073708 3300025912 Bacteria 2977
231 Ga0207695_10010995 3300025913 Bacteria 10996
232 Ga0207695_10014575 3300025913 Bacteria 9299
233 Ga0207695_10112859 3300025913 Bacteria 2695
234 Ga0207671_10024442 3300025914 Bacteria 4544
235 Ga0207671_10028124 3300025914 Bacteria 4203
236 Ga0207671_10708194 3300025914 Bacteria 801
237 Ga0207657_10000530 3300025919 Bacteria 40507
238 Ga0207657_10002753 3300025919 Bacteria 18925
239 Ga0207657_10077709 3300025919 Bacteria 2797
240 Ga0207657_10508302 3300025919 Bacteria 944
241 Ga0207657_11137629 3300025919 Bacteria 595
242 Ga0207649_10000089 3300025920 Bacteria 76923
243 Ga0207649_10000414 3300025920 Bacteria 31530
244 Ga0207649_10000848 3300025920 Bacteria 19645
245 Ga0207649_10219244 3300025920 Bacteria 1354
246 Ga0207652_10000008 3300025921 Bacteria 286698
247 Ga0207694_10018395 3300025924 Bacteria 5281
248 Ga0207694_10099574 3300025924 Bacteria 2302
249 Ga0207694_10105903 3300025924 Bacteria 2233
250 Ga0207694_10564019 3300025924 Bacteria 956
251 Ga0207694_11058125 3300025924 Bacteria 687
252 Ga0207650_10237903 3300025925 Bacteria 1471
253 Ga0207650_10273210 3300025925 Bacteria 1374
254 Ga0207659_10074272 3300025926 Bacteria 2492
255 Ga0207659_10266824 3300025926 Bacteria 1395
256 Ga0207659_11675730 3300025926 Bacteria 542
257 Ga0207687_10039290 3300025927 Bacteria 3239
258 Ga0207687_10487409 3300025927 Bacteria 1027
259 Ga0207644_10765387 3300025931 Bacteria 807
260 Ga0207690_10001819 3300025932 Bacteria 13084
261 Ga0207690_10036335 3300025932 Bacteria 3189
262 Ga0207690_10055877 3300025932 Bacteria 2660
263 Ga0207690_10118320 3300025932 Bacteria 1920
264 Ga0207690_11428567 3300025932 Bacteria 578
265 Ga0207706_10216759 3300025933 Bacteria 1677
266 Ga0207706_10364098 3300025933 Bacteria 1256
267 Ga0207706_10409958 3300025933 Bacteria 1174
268 Ga0207709_10000146 3300025935 Bacteria 98521
269 Ga0207709_10297654 3300025935 Unclassified 1198
270 Ga0207670_11816548 3300025936 Bacteria 518
271 Ga0207669_10000840 3300025937 Bacteria 13126
272 Ga0207669_10001770 3300025937 Bacteria 9160
273 Ga0207669_10601633 3300025937 Bacteria 894
274 Ga0207704_11058839 3300025938 Bacteria 688
275 Ga0207691_10928400 3300025940 Bacteria 728
276 Ga0207691_10944459 3300025940 Bacteria 721
277 Ga0207711_10003263 3300025941 Bacteria 14119
278 Ga0207711_10005768 3300025941 Bacteria 10458
279 Ga0207711_11965989 3300025941 Bacteria 528
280 Ga0207689_10420578 3300025942 Bacteria 1115
281 Ga0207661_10859251 3300025944 Bacteria 835
282 Ga0207661_11257305 3300025944 Bacteria 681
283 Ga0207679_10629377 3300025945 Bacteria 969
284 Ga0207667_10000001 3300025949 Bacteria 1178522
285 Ga0207667_10144473 3300025949 Bacteria 2449
286 Ga0207667_10358395 3300025949 Unclassified 1487
287 Ga0207667_10599311 3300025949 Bacteria 1111
288 Ga0207651_10605968 3300025960 Bacteria 958
289 Ga0207668_10035128 3300025972 Bacteria 3335
290 Ga0207640_10001120 3300025981 Bacteria 14773
291 Ga0207640_10002112 3300025981 Bacteria 10675
292 Ga0207640_10017983 3300025981 Bacteria 4146
293 Ga0207640_10136887 3300025981 Bacteria 1779
294 Ga0207658_10000014 3300025986 Bacteria 218248
295 Ga0207658_10001094 3300025986 Bacteria 21877
296 Ga0207658_10143799 3300025986 Bacteria 1934
297 Ga0207703_10000753 3300026035 Bacteria 31952
298 Ga0207703_10008493 3300026035 Bacteria 8115
299 Ga0207703_10781401 3300026035 Bacteria 911
300 Ga0207639_10003628 3300026041 Bacteria 10366
301 Ga0207639_10106842 3300026041 Bacteria 2273
302 Ga0207639_10619126 3300026041 Bacteria 999
303 Ga0207678_10002255 3300026067 Bacteria 17461
304 Ga0207678_10248309 3300026067 Bacteria 1524
305 Ga0207678_10875655 3300026067 Bacteria 794
306 Ga0207702_10003541 3300026078 Bacteria 14213
307 Ga0207702_10017748 3300026078 Bacteria 5890
308 Ga0207702_10275687 3300026078 Bacteria 1588
309 Ga0207641_10000545 3300026088 Bacteria 42249
310 Ga0207641_10065566 3300026088 Bacteria 3107
311 Ga0207641_10102007 3300026088 Bacteria 2529
312 Ga0207648_10461812 3300026089 Bacteria 1157
313 Ga0207676_10001198 3300026095 Bacteria 19470
314 Ga0207676_10001939 3300026095 Bacteria 15104
315 Ga0207676_11747378 3300026095 Bacteria 620
316 Ga0207674_10014537 3300026116 Bacteria 8691
317 Ga0207674_10065063 3300026116 Bacteria 3676
318 Ga0207674_10403254 3300026116 Bacteria 1321
319 Ga0207674_10624184 3300026116 Bacteria 1041
320 Ga0207674_10972085 3300026116 Bacteria 818
321 Ga0207675_100022883 3300026118 Bacteria 5813
322 Ga0207675_101953333 3300026118 Bacteria 605
323 Ga0207683_10001627 3300026121 Bacteria 20148
324 Ga0207683_10540028 3300026121 Bacteria 1078
325 Ga0207698_10016477 3300026142 Bacteria 4982
326 Ga0207698_10226666 3300026142 Bacteria 1693
327 Ga0209281_1047302 3300027111 Bacteria 698
328 Ga0209974_10095925 3300027876 Bacteria 1032
329 Ga0268266_10000036 3300028379 Bacteria 348910
330 Ga0268266_10000558 3300028379 Bacteria 51887
331 Ga0268266_10858443 3300028379 Bacteria 877
332 Ga0268266_12100398 3300028379 Bacteria 538
333 Ga0268265_10989997 3300028380 Bacteria 830
334 Ga0268264_10000121 3300028381 Bacteria 190368
335 Ga0268264_10005031 3300028381 Bacteria 11184
336 Ga0268264_10008726 3300028381 Bacteria 8413
337 Ga0307517_10092162 3300028786 Bacteria 2468
338 Ga0307517_10154410 3300028786 Bacteria 1563
339 Ga0307515_10763416 3300028794 Bacteria 587
340 Ga0265327_10152784 3300031251 Bacteria 1071
341 Ga0307513_10188936 3300031456 Bacteria 1914
342 Ga0307513_10472493 3300031456 Bacteria 975
343 Ga0307509_10210579 3300031507 Bacteria 1769
344 Ga0307408_100867685 3300031548 Bacteria 824
345 Ga0307508_10003647 3300031616 Bacteria 15437
346 Ga0307405_10455993 3300031731 Bacteria 1015
347 Ga0307413_10697366 3300031824 Unclassified 843
348 Ga0307413_11179688 3300031824 Bacteria 665
349 Ga0307413_11380668 3300031824 Bacteria 619
350 Ga0307410_10009358 3300031852 Bacteria 5492
351 Ga0307410_10220712 3300031852 Bacteria 1458
352 Ga0307407_10331139 3300031903 Bacteria 1072
353 Ga0307412_10000639 3300031911 Bacteria 20384
354 Ga0307412_10175300 3300031911 Bacteria 1607
355 Ga0307412_10211052 3300031911 Bacteria 1481
356 Ga0307409_100294173 3300031995 Bacteria 1507
357 Ga0307409_100658018 3300031995 Bacteria 1042
358 Ga0307409_101066275 3300031995 Bacteria 828
359 Ga0307409_101447382 3300031995 Bacteria 714
360 Ga0307416_100728687 3300032002 Bacteria 1083
361 Ga0307416_103657058 3300032002 Bacteria 515
362 Ga0307414_10017315 3300032004 Bacteria 4405
363 Ga0307414_10357779 3300032004 Bacteria 1255
364 Ga0307414_10842249 3300032004 Bacteria 838
365 Ga0307411_10017187 3300032005 Bacteria 4113
366 Ga0307411_10048056 3300032005 Bacteria 2763
367 Ga0307411_10110913 3300032005 Bacteria 1963
368 Ga0307411_10342998 3300032005 Bacteria 1215
369 Ga0307411_10608838 3300032005 Bacteria 940
370 Ga0307411_10759551 3300032005 Bacteria 850
371 Ga0307411_10787529 3300032005 Bacteria 836
372 Ga0307510_10007749 3300033180 Bacteria 12806
373 Ga0307510_10038792 3300033180 Bacteria 5260
374 Ga0395899_0017557 3300037312 Bacteria 5452
375 Ga0395899_0299572 3300037312 Unclassified 1088
376 Ga0395899_0305056 3300037312 Bacteria 1076
377 Ga0395899_0324733 3300037312 Bacteria 1035
378 Ga0395900_0037286 3300037418 Bacteria 5013
379 Ga0395900_0450993 3300037418 Unclassified 1242
380 Ga0395900_1426467 3300037418 Bacteria 605
381 Ga0395898_0072332 3300037466 Bacteria 3331
382 Ga0395898_0348363 3300037466 Unclassified 1412
383 Ga0395898_0358508 3300037466 Unclassified 1390
384 Ga0395898_0939034 3300037466 Bacteria 802
385 Ga0395905_0029645 3300037471 Bacteria 5157
386 Ga0395905_0524173 3300037471 Bacteria 1085
387 Ga0395901_0026221 3300038443 Bacteria 5983
388 Ga0395901_0224541 3300038443 Bacteria 1962
389 Ga0395901_0282672 3300038443 Bacteria 1724
390 Ga0395901_0314507 3300038443 Bacteria 1621
391 Ga0395901_0594046 3300038443 Bacteria 1117
392 Ga0436365_0007432 3300039437 Bacteria 19428
393 Ga0436365_1679513 3300039437 Bacteria 25305
394 Ga0436362_0599901 3300039453 Bacteria 16755
395 Ga0436362_0867572 3300039453 Bacteria 1123
396 Ga0439439_0191265 3300041406 Bacteria 592
397 Ga0439461_0000268 3300041410 Bacteria 7489
398 Ga0439466_0128301 3300041411 Bacteria 781
399 Ga0439465_0001627 3300041413 Bacteria 7310
400 Ga0439465_0175144 3300041413 Bacteria 774
401 Ga0451795_0094860 3300041456 Bacteria 864
402 Ga0451795_0847864 3300041456 Bacteria 994
403 Ga0451798_0742830 3300041458 Bacteria 538
404 Ga0451835_1158114 3300041492 Bacteria 512
405 Ga0451853_2346328 3300041512 Bacteria 956
406 Ga0451853_3826442 3300041512 Bacteria 553
407 Ga0439431_0001189 3300041997 Bacteria 5700
408 Ga0439442_004498 3300042002 Bacteria 2772
409 Ga0439443_000653 3300042003 Bacteria 3304
410 Ga0439445_0001911 3300042004 Bacteria 4594
411 Ga0439445_0228395 3300042004 Bacteria 553
412 Ga0439448_0123069 3300042005 Bacteria 891
413 Ga0439432_002558 3300042006 Bacteria 6854
414 Ga0439449_0014361 3300042007 Bacteria 2977
415 Ga0439452_014387 3300042010 Bacteria 2200
416 Ga0439462_0000114 3300042015 Bacteria 12626
417 Ga0439446_0018899 3300042156 Bacteria 1935
418 Ga0439434_0001068 3300042435 Bacteria 7940
419 Ga0466969_0001853 3300044656 Bacteria 11305
420 Ga0466969_0119946 3300044656 Bacteria 1225
421 Ga0466973_0121129 3300044659 Bacteria 2154
422 Ga0466966_0000021 3300044684 Bacteria 116714
423 Ga0466966_0002694 3300044684 Bacteria 11641
424 Ga0466966_0435190 3300044684 Bacteria 788
425 Ga0466961_0031132 3300044693 Bacteria 3429
426 Ga0466961_0429311 3300044693 Bacteria 800
427 Ga0466963_0003898 3300044694 Bacteria 8615
428 Ga0466963_0251074 3300044694 Bacteria 1241
429 Ga0466963_0255224 3300044694 Bacteria 1231
430 Ga0453684_1478323 3300044712 Bacteria 702
431 Ga0466971_0031444 3300044719 Bacteria 2376
432 Ga0466971_0286994 3300044719 Bacteria 788
433 Ga0466968_0047252 3300044735 Bacteria 1829
434 Ga0466970_0005690 3300044765 Bacteria 6191
435 Ga0466970_0127237 3300044765 Bacteria 1398
436 Ga0466957_0001481 3300044842 Bacteria 12314
437 Ga0466957_0272093 3300044842 Bacteria 1131
438 Ga0466959_0163910 3300045049 Bacteria 1561
439 Ga0466959_0530616 3300045049 Bacteria 794
440 Ga0466958_0024167 3300045836 Bacteria 3574
441 Ga0466967_0166334 3300045976 Bacteria 2073
442 Ga0495617_022814 3300046452 Bacteria 2117
443 Ga0495638_0000261 3300046460 Bacteria 70934
444 Ga0495650_0000428 3300046471 Bacteria 68082
445 Ga0495639_0329244 3300046475 Bacteria 765
446 Ga0495662_0619205 3300046476 Bacteria 529
447 Ga0495584_0054106 3300046491 Bacteria 2020
448 Ga0495585_0228372 3300046492 Bacteria 936
449 Ga0495596_0040394 3300046500 Bacteria 1842
450 Ga0495583_0000613 3300046506 Bacteria 48224
451 Ga0495583_0011890 3300046506 Bacteria 4967
452 Ga0495583_0015290 3300046506 Bacteria 4179
453 Ga0495583_0315011 3300046506 Bacteria 620
454 Ga0495620_0189674 3300046515 Bacteria 793
455 Ga0495631_0006887 3300046518 Bacteria 5832
456 Ga0495631_0042472 3300046518 Bacteria 2009
457 Ga0495631_0292627 3300046518 Bacteria 693
458 Ga0495632_0495382 3300046519 Bacteria 527
459 Ga0495637_0021305 3300046520 Bacteria 2974
460 Ga0495643_0008004 3300046522 Bacteria 6740
461 Ga0495643_0312041 3300046522 Bacteria 713
462 Ga0495648_0048754 3300046524 Bacteria 2604
463 Ga0495648_0050703 3300046524 Bacteria 2534
464 Ga0495648_0156341 3300046524 Bacteria 1183
465 Ga0495663_0003409 3300046525 Bacteria 4587
466 Ga0495663_0013879 3300046525 Bacteria 2253
467 Ga0495587_0040142 3300046536 Bacteria 2799
468 Ga0495597_0052134 3300046542 Bacteria 1802
469 Ga0495622_0030415 3300046557 Bacteria 2523
470 Ga0495633_0007087 3300046558 Bacteria 6519
471 Ga0495633_0170842 3300046558 Bacteria 1002
472 Ga0495668_0000431 3300046616 Bacteria 54273
473 Ga0495668_0224693 3300046616 Bacteria 1028
474 Ga0495668_0501641 3300046616 Bacteria 669
475 Ga0495668_0591246 3300046616 Bacteria 613
476 Ga0495611_0003831 3300046648 Bacteria 6563
477 Ga0495625_0007949 3300046660 Bacteria 9115
478 Ga0495625_0034392 3300046660 Bacteria 3741
479 Ga0495625_0035952 3300046660 Bacteria 3645
480 Ga0495625_0065087 3300046660 Bacteria 2570
481 Ga0495625_0118002 3300046660 Bacteria 1808
482 Ga0495625_0170013 3300046660 Bacteria 1456
483 Ga0495625_0444515 3300046660 Bacteria 802
484 Ga0495661_0291629 3300046665 Unclassified 819
485 Ga0495669_0000129 3300046684 Bacteria 48558
486 Ga0495670_0000017 3300046691 Bacteria 120427
487 Ga0495670_0027265 3300046691 Bacteria 2830
488 Ga0495670_0039893 3300046691 Bacteria 2342
489 Ga0495649_0075908 3300046694 Bacteria 1799
490 Ga0495600_0000473 3300046809 Bacteria 20935
491 Ga0495660_0031882 3300046810 Bacteria 2961
492 Ga0495660_0421396 3300046810 Bacteria 581
493 Ga0495683_0002152 3300047323 Bacteria 12115
494 Ga0495683_0053848 3300047323 Bacteria 2006
495 Ga0495687_000109 3300047443 Bacteria 125648
496 Ga0495677_0002522 3300047445 Bacteria 7164
497 Ga0495677_0106174 3300047445 Bacteria 1065
498 Ga0495673_0018930 3300047469 Bacteria 3461
499 Ga0495681_0185460 3300047470 Bacteria 852
500 Ga0495681_0235840 3300047470 Bacteria 728
501 Ga0495686_0000834 3300047472 Bacteria 39641
502 Ga0495686_0002087 3300047472 Bacteria 19651
503 Ga0495686_0010872 3300047472 Bacteria 6446
504 Ga0496100_0498180 3300048903 Bacteria 938
505 Ga0496101_0228050 3300048904 Bacteria 1447
506 Ga0496102_0000329 3300048905 Bacteria 59006
507 Ga0496103_0000164 3300048906 Bacteria 70089
508 Ga0496103_0638201 3300048906 Bacteria 677
509 Ga0496103_1023203 3300048906 Bacteria 514
510 Ga0496104_0022855 3300048907 Bacteria 5745
511 Ga0496105_0002759 3300048908 Bacteria 12822
512 Ga0496110_0052298 3300048913 Bacteria 3590
513 Ga0496113_0252047 3300048916 Bacteria 1409
514 Ga0496114_0084693 3300048917 Bacteria 2685
515 Ga0496115_0000174 3300048918 Bacteria 59745
516 Ga0496115_0000969 3300048918 Bacteria 20841
517 Ga0496115_0265226 3300048918 Bacteria 1412
518 Ga0496115_0473633 3300048918 Bacteria 1009
519 Ga0496116_0013506 3300048919 Bacteria 6577
520 Ga0496117_0000432 3300048920 Bacteria 69975
521 Ga0496117_0315307 3300048920 Bacteria 822
522 Ga0496118_0000127 3300048921 Bacteria 135377
523 Ga0496119_0013030 3300048922 Bacteria 6674
524 Ga0496119_0492598 3300048922 Bacteria 571
525 Ga0496120_0040718 3300048923 Bacteria 2728
526 Ga0496120_0163603 3300048923 Bacteria 1107
527 Ga0496121_0001042 3300048924 Bacteria 49414
528 Ga0496121_0001517 3300048924 Bacteria 38977
529 Ga0496121_0018140 3300048924 Bacteria 7119
530 Ga0496121_0029640 3300048924 Bacteria 5052
531 Ga0496122_0116075 3300048925 Bacteria 1742
532 Ga0496123_0011937 3300048926 Bacteria 7460
533 Ga0496123_0047705 3300048926 Bacteria 2890
534 Ga0496123_0120379 3300048926 Bacteria 1478
535 Ga0496124_0000011 3300048927 Bacteria 524145
536 Ga0496124_0000597 3300048927 Bacteria 60724
537 Ga0496124_0004920 3300048927 Bacteria 15340
538 Ga0496124_0103197 3300048927 Bacteria 2307
539 Ga0496125_0000426 3300048928 Bacteria 78122
540 Ga0496125_0110497 3300048928 Bacteria 1993
541 Ga0496126_0001322 3300048929 Bacteria 39417
542 Ga0496126_0123958 3300048929 Bacteria 2238
543 Ga0501031_0263830 3300049568 Bacteria 1119
544 Ga0501032_0096871 3300049569 Bacteria 1955
545 Ga0501034_0225491 3300049571 Bacteria 1825
546 Ga0501034_0495701 3300049571 Bacteria 1135
547 Ga0501034_0669442 3300049571 Bacteria 938
548 Ga0501034_0894041 3300049571 Bacteria 776
549 Ga0501036_0641819 3300049572 Bacteria 879
550 Ga0501043_0005628 3300049579 Bacteria 10089
551 Ga0501043_0482165 3300049579 Bacteria 928
552 Ga0501046_0323508 3300049580 Bacteria 1123
553 Ga0501047_0000976 3300049581 Bacteria 28788
554 Ga0501047_0882519 3300049581 Bacteria 708
555 Ga0501048_0033006 3300049582 Bacteria 3741
556 Ga0501073_1078655 3300049589 Bacteria 552
557 Ga0501240_002464 3300049673 Bacteria 1968
558 Ga0501257_084360 3300049686 Bacteria 822
559 Ga0501219_014556 3300049703 Bacteria 629
560 Ga0501035_0085938 3300049822 Bacteria 2772
561 Ga0501035_0808572 3300049822 Bacteria 748
562 nmdc:mga0k408_125349_c1 3300050493 Bacteria 1523
563 nmdc:mga0k408_47351_c1 3300050493 Bacteria 2485
564 nmdc:mga07m45_316455_c1 3300050496 Bacteria 907
565 nmdc:mga0qj67_16843_c1 3300050509 Bacteria 5550
566 Ga0500610_0000099 3300053079 Bacteria 25819
567 Ga0495655_0019954 3300053083 Bacteria 1497
568 Ga0500643_003860 3300053087 Bacteria 6975
569 Ga0500647_0126631 3300053091 Bacteria 1206
570 Ga0500641_0391264 3300053096 Bacteria 549
571 Ga0500562_074128 3300053108 Bacteria 919
572 Ga0500595_002483 3300053119 Bacteria 9125
573 Ga0500642_0000318 3300053130 Bacteria 16788
574 Ga0500658_0014470 3300053134 Bacteria 2921
575 Ga0500559_0021187 3300053136 Bacteria 2753
576 Ga0500559_0047881 3300053136 Bacteria 1878
577 Ga0500559_0542328 3300053136 Bacteria 531
578 Ga0500568_0019688 3300053139 Bacteria 2927
579 Ga0500616_0036222 3300053153 Bacteria 2678
580 Ga0500619_100861 3300053154 Bacteria 979
581 Ga0500627_0285775 3300053158 Bacteria 723
582 Ga0500636_0004458 3300053177 Bacteria 7925
583 Ga0500611_044565 3300053727 Bacteria 989
584 Ga0500645_000001 3300053730 Bacteria 455558
585 Ga0500596_004319 3300053735 Bacteria 2615
586 Ga0500587_002251 3300053739 Bacteria 2750
587 Ga0466962_0028120 3300061719 Bacteria 2694
588 Ga0466962_0080166 3300061719 Bacteria 1560
589 2600228316 2599185359 Bacteria 4772316
590 2643728430 2643221541 Bacteria 5498788
591 2644042392 2643221606 Bacteria 5588032
592 2644392030 2643221671 Bacteria 5496681
593 2879165432 2879163058 Bacteria 4223965
594 2885432276 2885429604 Bacteria 3642894
595 2928531236 2928526807 Bacteria 4760224
596 2928970503 2928968154 Bacteria 4633371
597 Ga0068864_100000352
598 JGI24736J21556_1019606
599 JGI24741J21665_1002301
600 JGI24741J21665_1047714
601 JGI24740J21852_10012217
602 JGI24737J22298_10000396
603 JGI24735J21928_10133204
604 JGI24742J22300_10102598
605 JGI25165J46597_1000065
606 rootH1_10225339
607 Ga0055525_1000144
608 Ga0055542_1000177
609 Ga0055529_1000350
610 Ga0055530_10000072
611 Ga0055531_10000114
612 Ga0065165_1006176
613 Ga0065165_1020829
614 Ga0065165_1140737
615 Ga0065714_10103338
616 Ga0065707_10415222
617 Ga0070658_10000003
618 Ga0070658_10742410
619 Ga0070658_11200466
620 Ga0070676_10016535
621 Ga0070676_10648735
622 Ga0070683_100897458
623 Ga0070670_100001053
624 Ga0070670_100714230
625 Ga0070677_10036893
626 Ga0070677_10541096
627 Ga0070666_10077145
628 Ga0070682_100190927
629 Ga0070660_100002551
630 Ga0070660_100029820
631 Ga0070660_100041841
632 Ga0070660_100202111
633 Ga0070660_100730299
634 Ga0070689_101289142
635 Ga0070661_100000113
636 Ga0070661_100008232
637 Ga0070661_100107965
638 Ga0070661_100343102
639 Ga0070661_100577684
640 Ga0070668_100000056
641 Ga0070669_100014279
642 Ga0070669_100044837
643 Ga0070669_100236958
644 Ga0070675_100052628
645 Ga0070675_100316916
646 Ga0070675_100379172
647 Ga0070671_100000601
648 Ga0070671_100443998
649 Ga0070674_100003119
650 Ga0070674_100028641
651 Ga0070673_100229067
652 Ga0070659_100027847
653 Ga0070659_100029300
654 Ga0070659_100029669
655 Ga0070659_101817737
656 Ga0070667_100000215
657 Ga0070667_100005459
658 Ga0070667_100062360
659 Ga0070667_100839575
660 Ga0070714_101794055
661 Ga0070700_101037604
662 Ga0070663_100229097
663 Ga0070663_100539552
664 Ga0070663_100868490
665 Ga0070663_101223855
666 Ga0070678_100000062
667 Ga0070678_100126035
668 Ga0070662_100394431
669 Ga0070662_100415300
670 Ga0070662_100488143
671 Ga0070681_10092271
672 Ga0068867_100330417
673 Ga0070679_101088089
674 Ga0068853_100456201
675 Ga0068853_100496244
676 Ga0068853_101336409
677 Ga0070672_100306487
678 Ga0070672_100498781
679 Ga0070672_101017348
680 Ga0070696_100596241
681 Ga0070665_100000257
682 Ga0070665_100007143
683 Ga0070665_100947593
684 Ga0068855_101664574
685 Ga0070664_100024101
686 Ga0068857_100207517
687 Ga0068857_100399032
688 Ga0068857_102149920
689 Ga0068854_100014422
690 Ga0068854_100018019
691 Ga0068856_100189685
692 Ga0068856_100342950
693 Ga0068852_100560698
694 Ga0068852_100570564
695 Ga0068852_100724883
696 Ga0068859_101327437
697 Ga0068864_100002862
698 Ga0068864_102058321
699 Ga0068861_100076201
700 Ga0068861_100532762
701 Ga0068851_10040461
702 Ga0068851_10285810
703 Ga0068863_100007196
704 Ga0068863_100067486
705 Ga0068863_101527283
706 Ga0068863_102638950
707 Ga0068858_100000132
708 Ga0068858_100000444
709 Ga0068860_100000049
710 Ga0068860_100007900
711 Ga0068860_100058133
712 Ga0068860_102128909
713 Ga0068862_100003201
714 Ga0075369_10038248
715 Ga0075366_10069175
716 Ga0068871_100104728
717 Ga0068865_100355287
718 Ga0097620_101327583
719 Ga0079104_1047134
720 Ga0105240_10015064
721 Ga0105240_10278201
722 Ga0105240_10451165
723 Ga0105240_11845007
724 Ga0111539_10165127
725 Ga0105245_10008344
726 Ga0105245_10692273
727 Ga0105243_10000180
728 Ga0105243_10056295
729 Ga0105243_11016098
730 Ga0105241_10000907
731 Ga0105241_10048235
732 Ga0105241_11044736
733 Ga0105241_11730802
734 Ga0105242_11650717
735 Ga0105248_10004622
736 Ga0105248_10010024
737 Ga0105248_10417994
738 Ga0105248_12371394
739 Ga0105237_10181506
740 Ga0105237_11106934
741 Ga0105237_12554711
742 Ga0105237_12554719
743 Ga0105238_10152896
744 Ga0105238_10403163
745 Ga0105238_11801713
746 Ga0105249_13415406
747 Ga0105239_10248457
748 Ga0105239_10629855
749 Ga0105239_11006881
750 Ga0105239_11011803
751 Ga0105246_10093912
752 Ga0157373_10014410
753 Ga0157373_10040161
754 Ga0157373_10312746
755 Ga0157373_10583642
756 Ga0157373_10852228
757 Ga0157371_10000110
758 Ga0157371_10036828
759 Ga0157371_10279560
760 Ga0157370_10485121
761 Ga0157370_10619723
762 Ga0157370_10646026
763 Ga0157370_11103336
764 Ga0157370_11383026
765 Ga0157370_11456554
766 Ga0157370_11968954
767 Ga0157369_10000751
768 Ga0157369_10012896
769 Ga0157369_10169727
770 Ga0157369_11100131
771 Ga0157369_11634417
772 Ga0157369_11971922
773 Ga0157369_12334079
774 Ga0157374_10046026
775 Ga0163162_10003520
776 Ga0163162_10466288
777 Ga0163162_13229973
778 Ga0157372_10134825
779 Ga0157372_10253089
780 Ga0157372_10344368
781 Ga0157372_11048107
782 Ga0157372_11870457
783 Ga0157372_12690739
784 Ga0157380_11687674
785 Ga0157380_13368751
786 Ga0182008_10240257
787 Ga0157376_11667802
788 Ga0197907_10444849
789 Ga0206354_10118545
790 Ga0206353_11409418
791 Ga0154015_1447161
792 Ga0213873_10000057
793 Ga0213876_10000021
794 Ga0213876_10000473
795 Ga0213876_10012578
796 Ga0209674_105941
797 Ga0209563_100130
798 Ga0209437_102317
799 Ga0209646_1038831
800 Ga0209026_1016978
801 Ga0209026_1046000
802 Ga0209148_1000008
803 Ga0209233_1000107
804 Ga0209455_1000002
805 Ga0209455_1010997
806 Ga0209455_1056729
807 Ga0209050_1000209
808 Ga0209257_1000027
809 Ga0207697_10071803
810 Ga0207697_10078237
811 Ga0207656_10005165
812 Ga0207656_10324980
813 Ga0207682_10024490
814 Ga0207682_10278487
815 Ga0207688_10043214
816 Ga0207680_10011910
817 Ga0207680_10355105
818 Ga0207647_10015260
819 Ga0207647_10023260
820 Ga0207645_10034794
821 Ga0207645_10312475
822 Ga0207705_10000005
823 Ga0207705_10000033
824 Ga0207705_10163427
825 Ga0207654_10000742
826 Ga0207707_10073708
827 Ga0207695_10010995
828 Ga0207695_10014575
829 Ga0207695_10112859
830 Ga0207671_10024442
831 Ga0207671_10028124
832 Ga0207671_10708194
833 Ga0207657_10000530
834 Ga0207657_10002753
835 Ga0207657_10077709
836 Ga0207657_10508302
837 Ga0207657_11137629
838 Ga0207649_10000089
839 Ga0207649_10000414
840 Ga0207649_10000848
841 Ga0207649_10219244
842 Ga0207652_10000008
843 Ga0207694_10018395
844 Ga0207694_10099574
845 Ga0207694_10105903
846 Ga0207694_10564019
847 Ga0207694_11058125
848 Ga0207650_10237903
849 Ga0207650_10273210
850 Ga0207659_10074272
851 Ga0207659_10266824
852 Ga0207659_11675730
853 Ga0207687_10039290
854 Ga0207687_10487409
855 Ga0207644_10765387
856 Ga0207690_10001819
857 Ga0207690_10036335
858 Ga0207690_10055877
859 Ga0207690_10118320
860 Ga0207690_11428567
861 Ga0207706_10216759
862 Ga0207706_10364098
863 Ga0207706_10409958
864 Ga0207709_10000146
865 Ga0207709_10297654
866 Ga0207670_11816548
867 Ga0207669_10000840
868 Ga0207669_10001770
869 Ga0207669_10601633
870 Ga0207704_11058839
871 Ga0207691_10928400
872 Ga0207691_10944459
873 Ga0207711_10003263
874 Ga0207711_10005768
875 Ga0207711_11965989
876 Ga0207689_10420578
877 Ga0207661_10859251
878 Ga0207661_11257305
879 Ga0207679_10629377
880 Ga0207667_10000001
881 Ga0207667_10144473
882 Ga0207667_10358395
883 Ga0207667_10599311
884 Ga0207651_10605968
885 Ga0207668_10035128
886 Ga0207640_10001120
887 Ga0207640_10002112
888 Ga0207640_10017983
889 Ga0207640_10136887
890 Ga0207658_10000014
891 Ga0207658_10001094
892 Ga0207658_10143799
893 Ga0207703_10000753
894 Ga0207703_10008493
895 Ga0207703_10781401
896 Ga0207639_10003628
897 Ga0207639_10106842
898 Ga0207639_10619126
899 Ga0207678_10002255
900 Ga0207678_10248309
901 Ga0207678_10875655
902 Ga0207702_10003541
903 Ga0207702_10017748
904 Ga0207702_10275687
905 Ga0207641_10000545
906 Ga0207641_10065566
907 Ga0207641_10102007
908 Ga0207648_10461812
909 Ga0207676_10001198
910 Ga0207676_10001939
911 Ga0207676_11747378
912 Ga0207674_10014537
913 Ga0207674_10065063
914 Ga0207674_10403254
915 Ga0207674_10624184
916 Ga0207674_10972085
917 Ga0207675_100022883
918 Ga0207675_101953333
919 Ga0207683_10001627
920 Ga0207683_10540028
921 Ga0207698_10016477
922 Ga0207698_10226666
923 Ga0209281_1047302
924 Ga0209974_10095925
925 Ga0268266_10000036
926 Ga0268266_10000558
927 Ga0268266_10858443
928 Ga0268266_12100398
929 Ga0268265_10989997
930 Ga0268264_10000121
931 Ga0268264_10005031
932 Ga0268264_10008726
933 Ga0307517_10092162
934 Ga0307517_10154410
935 Ga0307515_10763416
936 Ga0265327_10152784
937 Ga0307513_10188936
938 Ga0307513_10472493
939 Ga0307509_10210579
940 Ga0307408_100867685
941 Ga0307508_10003647
942 Ga0307405_10455993
943 Ga0307413_10697366
944 Ga0307413_11179688
945 Ga0307413_11380668
946 Ga0307410_10009358
947 Ga0307410_10220712
948 Ga0307407_10331139
949 Ga0307412_10000639
950 Ga0307412_10175300
951 Ga0307412_10211052
952 Ga0307409_100294173
953 Ga0307409_100658018
954 Ga0307409_101066275
955 Ga0307409_101447382
956 Ga0307416_100728687
957 Ga0307416_103657058
958 Ga0307414_10017315
959 Ga0307414_10357779
960 Ga0307414_10842249
961 Ga0307411_10017187
962 Ga0307411_10048056
963 Ga0307411_10110913
964 Ga0307411_10342998
965 Ga0307411_10608838
966 Ga0307411_10759551
967 Ga0307411_10787529
968 Ga0307510_10007749
969 Ga0307510_10038792
970 Ga0395899_0017557
971 Ga0395899_0299572
972 Ga0395899_0305056
973 Ga0395899_0324733
974 Ga0395900_0037286
975 Ga0395900_0450993
976 Ga0395900_1426467
977 Ga0395898_0072332
978 Ga0395898_0348363
979 Ga0395898_0358508
980 Ga0395898_0939034
981 Ga0395905_0029645
982 Ga0395905_0524173
983 Ga0395901_0026221
984 Ga0395901_0224541
985 Ga0395901_0282672
986 Ga0395901_0314507
987 Ga0395901_0594046
988 Ga0436365_0007432
989 Ga0436365_1679513
990 Ga0436362_0599901
991 Ga0436362_0867572
992 Ga0439439_0191265
993 Ga0439461_0000268
994 Ga0439466_0128301
995 Ga0439465_0001627
996 Ga0439465_0175144
997 Ga0451795_0094860
998 Ga0451795_0847864
999 Ga0451798_0742830
1000 Ga0451835_1158114
1001 Ga0451853_2346328
1002 Ga0451853_3826442
1003 Ga0439431_0001189
1004 Ga0439442_004498
1005 Ga0439443_000653
1006 Ga0439445_0001911
1007 Ga0439445_0228395
1008 Ga0439448_0123069
1009 Ga0439432_002558
1010 Ga0439449_0014361
1011 Ga0439452_014387
1012 Ga0439462_0000114
1013 Ga0439446_0018899
1014 Ga0439434_0001068
1015 Ga0466969_0001853
1016 Ga0466969_0119946
1017 Ga0466973_0121129
1018 Ga0466966_0000021
1019 Ga0466966_0002694
1020 Ga0466966_0435190
1021 Ga0466961_0031132
1022 Ga0466961_0429311
1023 Ga0466963_0003898
1024 Ga0466963_0251074
1025 Ga0466963_0255224
1026 Ga0453684_1478323
1027 Ga0466971_0031444
1028 Ga0466971_0286994
1029 Ga0466968_0047252
1030 Ga0466970_0005690
1031 Ga0466970_0127237
1032 Ga0466957_0001481
1033 Ga0466957_0272093
1034 Ga0466959_0163910
1035 Ga0466959_0530616
1036 Ga0466958_0024167
1037 Ga0466967_0166334
1038 Ga0495617_022814
1039 Ga0495638_0000261
1040 Ga0495650_0000428
1041 Ga0495639_0329244
1042 Ga0495662_0619205
1043 Ga0495584_0054106
1044 Ga0495585_0228372
1045 Ga0495596_0040394
1046 Ga0495583_0000613
1047 Ga0495583_0011890
1048 Ga0495583_0015290
1049 Ga0495583_0315011
1050 Ga0495620_0189674
1051 Ga0495631_0006887
1052 Ga0495631_0042472
1053 Ga0495631_0292627
1054 Ga0495632_0495382
1055 Ga0495637_0021305
1056 Ga0495643_0008004
1057 Ga0495643_0312041
1058 Ga0495648_0048754
1059 Ga0495648_0050703
1060 Ga0495648_0156341
1061 Ga0495663_0003409
1062 Ga0495663_0013879
1063 Ga0495587_0040142
1064 Ga0495597_0052134
1065 Ga0495622_0030415
1066 Ga0495633_0007087
1067 Ga0495633_0170842
1068 Ga0495668_0000431
1069 Ga0495668_0224693
1070 Ga0495668_0501641
1071 Ga0495668_0591246
1072 Ga0495611_0003831
1073 Ga0495625_0007949
1074 Ga0495625_0034392
1075 Ga0495625_0035952
1076 Ga0495625_0065087
1077 Ga0495625_0118002
1078 Ga0495625_0170013
1079 Ga0495625_0444515
1080 Ga0495661_0291629
1081 Ga0495669_0000129
1082 Ga0495670_0000017
1083 Ga0495670_0027265
1084 Ga0495670_0039893
1085 Ga0495649_0075908
1086 Ga0495600_0000473
1087 Ga0495660_0031882
1088 Ga0495660_0421396
1089 Ga0495683_0002152
1090 Ga0495683_0053848
1091 Ga0495687_000109
1092 Ga0495677_0002522
1093 Ga0495677_0106174
1094 Ga0495673_0018930
1095 Ga0495681_0185460
1096 Ga0495681_0235840
1097 Ga0495686_0000834
1098 Ga0495686_0002087
1099 Ga0495686_0010872
1100 Ga0496100_0498180
1101 Ga0496101_0228050
1102 Ga0496102_0000329
1103 Ga0496103_0000164
1104 Ga0496103_0638201
1105 Ga0496103_1023203
1106 Ga0496104_0022855
1107 Ga0496105_0002759
1108 Ga0496110_0052298
1109 Ga0496113_0252047
1110 Ga0496114_0084693
1111 Ga0496115_0000174
1112 Ga0496115_0000969
1113 Ga0496115_0265226
1114 Ga0496115_0473633
1115 Ga0496116_0013506
1116 Ga0496117_0000432
1117 Ga0496117_0315307
1118 Ga0496118_0000127
1119 Ga0496119_0013030
1120 Ga0496119_0492598
1121 Ga0496120_0040718
1122 Ga0496120_0163603
1123 Ga0496121_0001042
1124 Ga0496121_0001517
1125 Ga0496121_0018140
1126 Ga0496121_0029640
1127 Ga0496122_0116075
1128 Ga0496123_0011937
1129 Ga0496123_0047705
1130 Ga0496123_0120379
1131 Ga0496124_0000011
1132 Ga0496124_0000597
1133 Ga0496124_0004920
1134 Ga0496124_0103197
1135 Ga0496125_0000426
1136 Ga0496125_0110497
1137 Ga0496126_0001322
1138 Ga0496126_0123958
1139 Ga0501031_0263830
1140 Ga0501032_0096871
1141 Ga0501034_0225491
1142 Ga0501034_0495701
1143 Ga0501034_0669442
1144 Ga0501034_0894041
1145 Ga0501036_0641819
1146 Ga0501043_0005628
1147 Ga0501043_0482165
1148 Ga0501046_0323508
1149 Ga0501047_0000976
1150 Ga0501047_0882519
1151 Ga0501048_0033006
1152 Ga0501073_1078655
1153 Ga0501240_002464
1154 Ga0501257_084360
1155 Ga0501219_014556
1156 Ga0501035_0085938
1157 Ga0501035_0808572
1158 nmdc:mga0k408_125349_c1
1159 nmdc:mga0k408_47351_c1
1160 nmdc:mga07m45_316455_c1
1161 nmdc:mga0qj67_16843_c1
1162 Ga0500610_0000099
1163 Ga0495655_0019954
1164 Ga0500643_003860
1165 Ga0500647_0126631
1166 Ga0500641_0391264
1167 Ga0500562_074128
1168 Ga0500595_002483
1169 Ga0500642_0000318
1170 Ga0500658_0014470
1171 Ga0500559_0021187
1172 Ga0500559_0047881
1173 Ga0500559_0542328
1174 Ga0500568_0019688
1175 Ga0500616_0036222
1176 Ga0500619_100861
1177 Ga0500627_0285775
1178 Ga0500636_0004458
1179 Ga0500611_044565
1180 Ga0500645_000001
1181 Ga0500596_004319
1182 Ga0500587_002251
1183 Ga0466962_0028120
1184 Ga0466962_0080166
1185 2600228316
1186 2643728430
1187 2644042392
1188 2644392030
1189 2879165432
1190 2885432276
1191 2928531236
1192 2928970503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

20

113

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8251 13 106
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.7511 13 108
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.7489 13 106
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7126 12 105
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7113 12 111
ID Description Score Start End Superfamily
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9018 14 109 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8662 12 107 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8453 12 102 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8224 14 109 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8222 12 111 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A6P1NFC8-F1-model_v4 Guanidinium exporter 0.9175 13 109 GO:0005886
GO:0022857
AF-A0A3G1L1L5-F1-model_v4 Multidrug efflux SMR transporter 0.9136 13 111 GO:0005886
GO:0022857
AF-A0A5C5QJQ1-F1-model_v4 deleted 0.9134 13 111
AF-A0A4R9CJI3-F1-model_v4 deleted 0.9106 14 110
AF-A0A4S8EW50-F1-model_v4 Uncharacterized protein 0.9098 13 107 GO:0005886
GO:0022857

Map