F467648

General Info

Members Datasets Scaffolds Average Seq Length
597 267 597 358

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10132952|Ga0070717_101329522
Length 412
Sequence MLSRPQQGGFLVLRRNLSSYRTLEHLASAPVTLPPPSTTATPPIAPLPAPAILAPVRFPLSWLLEHASAPIRYRAMTEVARLPSQSADRLSFLPFTHRAALMLAMLQSTDGTWNHSMLTVPAVRAEHFEGVGTISAVRRLLEYGWDRETPPLLLARRILFRLLAEDEDPEWLFEFGAKGPADEDAARRGRAILREAAAAALAQAGYEGDPRLRGAAKRIIERVVGYLRSPLAQKPFVRVGNQHVLAAEAAPPSMFALLMLAYMPLFRTEHHDAMDRLYQHLAQPLPRQEPVQLCGQKVMAQPHLVLGDLLANRNVADADVPFAMMWLELVARLGFMRRNENWSKLFDRFLDDRDQDGVWHPHKGMTVARSANPIVWPFYPLEENLSGDERWADVTFRLGLIARVIGRTIEIA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
235 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
236 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
237 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
238 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
239 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
244 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
245 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
249 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
250 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
251 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
252 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.17
Rhizosphere 98.66
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10279081 2162886012 Unclassified 1590
2 Ga0065712_10107274 3300005290 Bacteria 1899
3 Ga0065715_10092603 3300005293 Bacteria 5031
4 Ga0065715_10132560 3300005293 Unclassified 1988
5 Ga0065707_10086002 3300005295 Bacteria 5725
6 Ga0070658_10004216 3300005327 Bacteria 11768
7 Ga0070658_10047772 3300005327 Bacteria 3463
8 Ga0070658_10111999 3300005327 Bacteria 2262
9 Ga0070676_10037765 3300005328 Unclassified 2786
10 Ga0070676_10067316 3300005328 Bacteria 2141
11 Ga0070683_100001402 3300005329 Bacteria 18509
12 Ga0070683_100005334 3300005329 Bacteria 10718
13 Ga0070683_100058907 3300005329 Bacteria 3568
14 Ga0070683_100073623 3300005329 Bacteria 3190
15 Ga0070683_100091202 3300005329 Bacteria 2861
16 Ga0070683_100137009 3300005329 Bacteria 2318
17 Ga0070690_100031738 3300005330 Unclassified 3293
18 Ga0070670_100005229 3300005331 Bacteria 10927
19 Ga0070670_100012450 3300005331 Bacteria 7279
20 Ga0070670_100024335 3300005331 Bacteria 5207
21 Ga0070670_100028999 3300005331 Bacteria 4763
22 Ga0070670_100057976 3300005331 Unclassified 3324
23 Ga0068869_100001049 3300005334 Bacteria 16102
24 Ga0068869_100027103 3300005334 Bacteria 3993
25 Ga0070666_10031908 3300005335 Bacteria 3479
26 Ga0070666_10092775 3300005335 Bacteria 2076
27 Ga0070680_100000211 3300005336 Bacteria 38342
28 Ga0070680_100002193 3300005336 Bacteria 14397
29 Ga0070680_100002464 3300005336 Bacteria 13711
30 Ga0070680_100002688 3300005336 Bacteria 13181
31 Ga0070680_100011383 3300005336 Bacteria 6879
32 Ga0070680_100036579 3300005336 Bacteria 3966
33 Ga0070680_100095170 3300005336 Unclassified 2468
34 Ga0070680_100168995 3300005336 Bacteria 1839
35 Ga0070680_100188902 3300005336 Bacteria 1736
36 Ga0070682_100000790 3300005337 Bacteria 18593
37 Ga0070682_100001451 3300005337 Bacteria 13334
38 Ga0070682_100010720 3300005337 Bacteria 5212
39 Ga0070682_100016215 3300005337 Bacteria 4329
40 Ga0068868_100265507 3300005338 Bacteria 1449
41 Ga0070660_100006624 3300005339 Bacteria 8037
42 Ga0070660_100077782 3300005339 Bacteria 2600
43 Ga0070689_100022167 3300005340 Bacteria 4739
44 Ga0070689_100184804 3300005340 Bacteria 1695
45 Ga0070687_100001962 3300005343 Bacteria 7523
46 Ga0070687_100013033 3300005343 Bacteria 3692
47 Ga0070661_100000965 3300005344 Bacteria 20487
48 Ga0070661_100004675 3300005344 Bacteria 9429
49 Ga0070661_100004701 3300005344 Bacteria 9400
50 Ga0070661_100033959 3300005344 Unclassified 3698
51 Ga0070661_100049438 3300005344 Bacteria 3078
52 Ga0070661_100140097 3300005344 Bacteria 1822
53 Ga0070661_100141228 3300005344 Bacteria 1815
54 Ga0070692_10003678 3300005345 Bacteria 6275
55 Ga0070692_10020119 3300005345 Bacteria 3232
56 Ga0070668_100159543 3300005347 Bacteria 1829
57 Ga0070669_100002801 3300005353 Bacteria 12586
58 Ga0070669_100012282 3300005353 Bacteria 6077
59 Ga0070669_100120633 3300005353 Bacteria 2000
60 Ga0070675_100001287 3300005354 Bacteria 18342
61 Ga0070675_100011812 3300005354 Bacteria 6843
62 Ga0070675_100038842 3300005354 Bacteria 3882
63 Ga0070675_100042358 3300005354 Bacteria 3720
64 Ga0070675_100258840 3300005354 Bacteria 1524
65 Ga0070671_100024347 3300005355 Unclassified 4955
66 Ga0070671_100050572 3300005355 Bacteria 3456
67 Ga0070674_100245600 3300005356 Unclassified 1404
68 Ga0070673_100076469 3300005364 Bacteria 2703
69 Ga0070673_100129174 3300005364 Bacteria 2118
70 Ga0070673_100295373 3300005364 Bacteria 1425
71 Ga0070688_100005871 3300005365 Bacteria 6496
72 Ga0070659_100003646 3300005366 Bacteria 10969
73 Ga0070659_100004835 3300005366 Bacteria 9622
74 Ga0070659_100013565 3300005366 Bacteria 6069
75 Ga0070659_100022685 3300005366 Bacteria 4794
76 Ga0070659_100335729 3300005366 Unclassified 1266
77 Ga0070667_100008417 3300005367 Bacteria 8557
78 Ga0070667_100067093 3300005367 Unclassified 3049
79 Ga0070703_10013658 3300005406 Bacteria 2308
80 Ga0070714_100012956 3300005435 Bacteria 6669
81 Ga0070714_100077656 3300005435 Bacteria 2884
82 Ga0070711_100172282 3300005439 Bacteria 1650
83 Ga0070708_100000849 3300005445 Bacteria 22993
84 Ga0070708_100018454 3300005445 Bacteria 5839
85 Ga0070663_100076849 3300005455 Bacteria 2443
86 Ga0070662_100000424 3300005457 Bacteria 25043
87 Ga0070662_100042621 3300005457 Bacteria 3242
88 Ga0070662_100178612 3300005457 Bacteria 1672
89 Ga0070681_10002407 3300005458 Bacteria 17106
90 Ga0070681_10005269 3300005458 Bacteria 12487
91 Ga0070681_10005393 3300005458 Bacteria 12347
92 Ga0070681_10008249 3300005458 Bacteria 10193
93 Ga0070681_10023997 3300005458 Bacteria 6140
94 Ga0070681_10321787 3300005458 Bacteria 1456
95 Ga0068867_100014698 3300005459 Bacteria 5547
96 Ga0070685_10022157 3300005466 Bacteria 3459
97 Ga0070685_10040313 3300005466 Bacteria 2657
98 Ga0070685_10135584 3300005466 Unclassified 1544
99 Ga0070706_100035147 3300005467 Bacteria 4627
100 Ga0070706_100092829 3300005467 Bacteria 2800
101 Ga0070707_100002115 3300005468 Bacteria 19017
102 Ga0070707_100095400 3300005468 Bacteria 2881
103 Ga0070707_100109433 3300005468 Unclassified 2680
104 Ga0070707_100122482 3300005468 Bacteria 2525
105 Ga0070707_100203054 3300005468 Bacteria 1932
106 Ga0070698_100015754 3300005471 Bacteria 7985
107 Ga0070698_100023353 3300005471 Bacteria 6464
108 Ga0070699_100016562 3300005518 Bacteria 6327
109 Ga0070699_100020754 3300005518 Bacteria 5666
110 Ga0070679_100000085 3300005530 Bacteria 70740
111 Ga0070679_100000355 3300005530 Bacteria 39034
112 Ga0070679_100002038 3300005530 Bacteria 18142
113 Ga0070679_100002972 3300005530 Bacteria 15467
114 Ga0070679_100003613 3300005530 Bacteria 14133
115 Ga0070679_100004960 3300005530 Bacteria 12285
116 Ga0070679_100032603 3300005530 Bacteria 5154
117 Ga0070679_100035763 3300005530 Bacteria 4927
118 Ga0070679_100155728 3300005530 Bacteria 2260
119 Ga0070684_100001085 3300005535 Bacteria 19504
120 Ga0070684_100002564 3300005535 Bacteria 13418
121 Ga0070684_100007288 3300005535 Bacteria 8599
122 Ga0070684_100010548 3300005535 Bacteria 7325
123 Ga0070684_100025041 3300005535 Bacteria 5011
124 Ga0070684_100098467 3300005535 Bacteria 2609
125 Ga0070684_100142985 3300005535 Bacteria 2164
126 Ga0070684_100162472 3300005535 Bacteria 2027
127 Ga0070697_100097679 3300005536 Bacteria 2437
128 Ga0068853_100038666 3300005539 Bacteria 4065
129 Ga0068853_100051795 3300005539 Unclassified 3534
130 Ga0068853_100130969 3300005539 Bacteria 2245
131 Ga0070672_100014501 3300005543 Bacteria 5587
132 Ga0070672_100185686 3300005543 Unclassified 1734
133 Ga0070695_100008476 3300005545 Bacteria 6100
134 Ga0070695_100090258 3300005545 Bacteria 2044
135 Ga0070696_100004808 3300005546 Bacteria 9029
136 Ga0068855_100001420 3300005563 Bacteria 29751
137 Ga0068855_100007089 3300005563 Bacteria 13596
138 Ga0068855_100026460 3300005563 Bacteria 6939
139 Ga0068855_100034889 3300005563 Bacteria 5995
140 Ga0068855_100048604 3300005563 Bacteria 5006
141 Ga0068855_100216579 3300005563 Bacteria 2149
142 Ga0070664_100000313 3300005564 Bacteria 35339
143 Ga0070664_100002171 3300005564 Bacteria 15749
144 Ga0070664_100005882 3300005564 Bacteria 9903
145 Ga0070664_100028013 3300005564 Bacteria 4685
146 Ga0070664_100040470 3300005564 Unclassified 3929
147 Ga0070664_100058501 3300005564 Bacteria 3278
148 Ga0070664_100073209 3300005564 Unclassified 2939
149 Ga0070664_100210528 3300005564 Unclassified 1737
150 Ga0068857_100000179 3300005577 Bacteria 40362
151 Ga0068857_100000495 3300005577 Bacteria 28278
152 Ga0068857_100008030 3300005577 Bacteria 9102
153 Ga0068857_100011370 3300005577 Bacteria 7743
154 Ga0068857_100039204 3300005577 Bacteria 4195
155 Ga0068857_100064552 3300005577 Bacteria 3255
156 Ga0068857_100249439 3300005577 Bacteria 1627
157 Ga0068854_100009904 3300005578 Bacteria 6166
158 Ga0068854_100056769 3300005578 Bacteria 2823
159 Ga0068854_100120090 3300005578 Bacteria 1994
160 Ga0068856_100003777 3300005614 Bacteria 15169
161 Ga0070702_100018912 3300005615 Bacteria 3581
162 Ga0068852_100020098 3300005616 Bacteria 5304
163 Ga0068852_100022032 3300005616 Bacteria 5100
164 Ga0068852_100025845 3300005616 Bacteria 4764
165 Ga0068852_100167219 3300005616 Unclassified 2058
166 Ga0068859_100021114 3300005617 Bacteria 6534
167 Ga0068859_100069586 3300005617 Bacteria 3554
168 Ga0068864_100008261 3300005618 Bacteria 8586
169 Ga0068864_100014535 3300005618 Bacteria 6540
170 Ga0068866_10004619 3300005718 Bacteria 5646
171 Ga0068861_100007253 3300005719 Bacteria 7597
172 Ga0068851_10029991 3300005834 Bacteria 2695
173 Ga0068870_10031641 3300005840 Unclassified 2682
174 Ga0068863_100079094 3300005841 Bacteria 3114
175 Ga0068863_100128028 3300005841 Bacteria 2423
176 Ga0068858_100027021 3300005842 Bacteria 5330
177 Ga0068858_100050059 3300005842 Unclassified 3867
178 Ga0068860_100012629 3300005843 Bacteria 8311
179 Ga0068860_100037303 3300005843 Bacteria 4653
180 Ga0068862_100037198 3300005844 Bacteria 4125
181 Ga0070717_10132952 3300006028 Unclassified 2141
182 Ga0070716_100093868 3300006173 Bacteria 1822
183 Ga0070712_100218371 3300006175 Bacteria 1508
184 Ga0068871_100034443 3300006358 Bacteria 4018
185 Ga0068871_100193081 3300006358 Bacteria 1755
186 Ga0075428_100393821 3300006844 Bacteria 1485
187 Ga0075430_100002736 3300006846 Bacteria 14720
188 Ga0075430_100009941 3300006846 Bacteria 8046
189 Ga0075430_100056995 3300006846 Bacteria 3286
190 Ga0075430_100193614 3300006846 Bacteria 1689
191 Ga0075431_100055741 3300006847 Bacteria 4078
192 Ga0075431_100330921 3300006847 Unclassified 1534
193 Ga0075433_10021167 3300006852 Bacteria 5450
194 Ga0075434_100017657 3300006871 Bacteria 6877
195 Ga0068865_100019525 3300006881 Bacteria 4386
196 Ga0068865_100213199 3300006881 Unclassified 1506
197 Ga0075436_100009980 3300006914 Bacteria 6496
198 Ga0075436_100016778 3300006914 Bacteria 5013
199 Ga0075436_100021637 3300006914 Bacteria 4414
200 Ga0097620_100021115 3300006931 Bacteria 6534
201 Ga0097620_100069590 3300006931 Bacteria 3554
202 Ga0075435_100008656 3300007076 Bacteria 7316
203 Ga0099795_10003411 3300007788 Bacteria 3928
204 Ga0105240_10124670 3300009093 Bacteria 3097
205 Ga0105240_10152084 3300009093 Unclassified 2755
206 Ga0105240_10275034 3300009093 Bacteria 1937
207 Ga0111539_10036945 3300009094 Bacteria 5902
208 Ga0105245_10024020 3300009098 Bacteria 5351
209 Ga0105245_10042292 3300009098 Bacteria 4065
210 Ga0105245_10048195 3300009098 Bacteria 3811
211 Ga0105245_10062529 3300009098 Bacteria 3359
212 Ga0114129_10012586 3300009147 Bacteria 12048
213 Ga0105241_10057235 3300009174 Unclassified 2990
214 Ga0105241_10071396 3300009174 Unclassified 2695
215 Ga0105241_10183727 3300009174 Bacteria 1736
216 Ga0105242_10040329 3300009176 Bacteria 3763
217 Ga0105248_10011861 3300009177 Bacteria 9615
218 Ga0105248_10019314 3300009177 Bacteria 7541
219 Ga0105248_10026436 3300009177 Bacteria 6457
220 Ga0105248_10153149 3300009177 Bacteria 2601
221 Ga0105248_10261374 3300009177 Unclassified 1949
222 Ga0105237_10046545 3300009545 Bacteria 4363
223 Ga0105237_10121199 3300009545 Unclassified 2610
224 Ga0105238_10061051 3300009551 Bacteria 3773
225 Ga0105238_10068486 3300009551 Bacteria 3550
226 Ga0105238_10149251 3300009551 Bacteria 2313
227 Ga0105238_10278908 3300009551 Bacteria 1652
228 Ga0105249_10006039 3300009553 Bacteria 10494
229 Ga0105249_10060953 3300009553 Bacteria 3462
230 Ga0105249_10133713 3300009553 Bacteria 2371
231 Ga0099796_10001176 3300010159 Bacteria 5079
232 Ga0105239_10053701 3300010375 Bacteria 4419
233 Ga0105246_10001757 3300011119 Bacteria 12961
234 Ga0157373_10037965 3300013100 Bacteria 3451
235 Ga0157373_10117608 3300013100 Bacteria 1868
236 Ga0157371_10011933 3300013102 Bacteria 6663
237 Ga0157371_10133390 3300013102 Bacteria 1767
238 Ga0157370_10131534 3300013104 Unclassified 2334
239 Ga0157370_10205822 3300013104 Unclassified 1824
240 Ga0157369_10021605 3300013105 Bacteria 7197
241 Ga0157369_10109205 3300013105 Bacteria 2941
242 Ga0157369_10154431 3300013105 Bacteria 2425
243 Ga0157369_10238699 3300013105 Bacteria 1899
244 Ga0157369_10302341 3300013105 Bacteria 1664
245 Ga0157369_10314072 3300013105 Bacteria 1629
246 Ga0157374_10024538 3300013296 Bacteria 5407
247 Ga0157374_10032088 3300013296 Unclassified 4780
248 Ga0157374_10075153 3300013296 Bacteria 3193
249 Ga0157374_10216611 3300013296 Bacteria 1878
250 Ga0157378_10002336 3300013297 Bacteria 16841
251 Ga0157378_10023731 3300013297 Bacteria 5395
252 Ga0157378_10099905 3300013297 Bacteria 2648
253 Ga0157378_10139188 3300013297 Bacteria 2253
254 Ga0157378_10163930 3300013297 Bacteria 2080
255 Ga0163162_10002048 3300013306 Bacteria 18939
256 Ga0157372_10003799 3300013307 Bacteria 16216
257 Ga0157372_10021660 3300013307 Bacteria 6948
258 Ga0157372_10025111 3300013307 Bacteria 6476
259 Ga0157372_10036633 3300013307 Bacteria 5408
260 Ga0157372_10038903 3300013307 Bacteria 5249
261 Ga0157372_10047871 3300013307 Bacteria 4752
262 Ga0157372_10134245 3300013307 Bacteria 2849
263 Ga0157372_10168563 3300013307 Bacteria 2533
264 Ga0157372_10203259 3300013307 Bacteria 2295
265 Ga0157372_10269240 3300013307 Unclassified 1979
266 Ga0157375_10005804 3300013308 Bacteria 10743
267 Ga0157375_10008124 3300013308 Bacteria 9183
268 Ga0157375_10162236 3300013308 Unclassified 2378
269 Ga0163163_10002127 3300014325 Bacteria 16729
270 Ga0163163_10073490 3300014325 Bacteria 3410
271 Ga0163163_10150316 3300014325 Bacteria 2373
272 Ga0163163_10385663 3300014325 Bacteria 1459
273 Ga0157377_10011964 3300014745 Bacteria 4350
274 Ga0157377_10193262 3300014745 Bacteria 1287
275 Ga0157379_10007606 3300014968 Bacteria 9379
276 Ga0182007_10015980 3300015262 Bacteria 2781
277 Ga0163161_10012618 3300017792 Bacteria 5871
278 Ga0206353_11062776 3300020082 Bacteria 1588
279 Ga0207697_10005401 3300025315 Bacteria 5942
280 Ga0207642_10043498 3300025899 Bacteria 1981
281 Ga0207645_10001996 3300025907 Bacteria 16406
282 Ga0207645_10063986 3300025907 Bacteria 2350
283 Ga0207645_10076616 3300025907 Bacteria 2142
284 Ga0207643_10020267 3300025908 Unclassified 3649
285 Ga0207705_10002919 3300025909 Bacteria 13064
286 Ga0207705_10013095 3300025909 Bacteria 5985
287 Ga0207654_10021822 3300025911 Unclassified 3410
288 Ga0207707_10000303 3300025912 Bacteria 51777
289 Ga0207707_10000872 3300025912 Bacteria 29454
290 Ga0207707_10002037 3300025912 Bacteria 18342
291 Ga0207707_10019607 3300025912 Bacteria 5902
292 Ga0207707_10039036 3300025912 Bacteria 4150
293 Ga0207707_10041828 3300025912 Bacteria 4001
294 Ga0207707_10069981 3300025912 Bacteria 3058
295 Ga0207695_10022331 3300025913 Bacteria 7187
296 Ga0207695_10067295 3300025913 Bacteria 3675
297 Ga0207695_10172476 3300025913 Unclassified 2088
298 Ga0207671_10063170 3300025914 Unclassified 2751
299 Ga0207671_10162167 3300025914 Unclassified 1732
300 Ga0207693_10088255 3300025915 Unclassified 2431
301 Ga0207660_10001634 3300025917 Bacteria 15030
302 Ga0207660_10011842 3300025917 Bacteria 5687
303 Ga0207660_10016634 3300025917 Bacteria 4873
304 Ga0207660_10022288 3300025917 Bacteria 4267
305 Ga0207662_10001793 3300025918 Bacteria 10538
306 Ga0207662_10003880 3300025918 Bacteria 7782
307 Ga0207657_10013223 3300025919 Bacteria 8100
308 Ga0207657_10043399 3300025919 Bacteria 3961
309 Ga0207657_10046442 3300025919 Bacteria 3803
310 Ga0207657_10062627 3300025919 Bacteria 3184
311 Ga0207649_10002406 3300025920 Bacteria 10487
312 Ga0207649_10011144 3300025920 Bacteria 4948
313 Ga0207649_10036228 3300025920 Bacteria 2970
314 Ga0207649_10042157 3300025920 Unclassified 2783
315 Ga0207649_10059317 3300025920 Bacteria 2400
316 Ga0207649_10071532 3300025920 Bacteria 2216
317 Ga0207652_10000526 3300025921 Bacteria 38877
318 Ga0207652_10002073 3300025921 Bacteria 17266
319 Ga0207652_10002917 3300025921 Bacteria 14310
320 Ga0207652_10005853 3300025921 Bacteria 9959
321 Ga0207652_10034175 3300025921 Bacteria 4284
322 Ga0207646_10048666 3300025922 Unclassified 3800
323 Ga0207646_10123672 3300025922 Bacteria 2326
324 Ga0207681_10012803 3300025923 Bacteria 5184
325 Ga0207681_10013491 3300025923 Bacteria 5058
326 Ga0207681_10033533 3300025923 Bacteria 3367
327 Ga0207694_10062333 3300025924 Bacteria 2903
328 Ga0207694_10087633 3300025924 Unclassified 2453
329 Ga0207694_10215448 3300025924 Bacteria 1565
330 Ga0207650_10004261 3300025925 Bacteria 9761
331 Ga0207650_10012067 3300025925 Bacteria 5957
332 Ga0207650_10057237 3300025925 Bacteria 2899
333 Ga0207650_10058215 3300025925 Bacteria 2877
334 Ga0207659_10022835 3300025926 Bacteria 4170
335 Ga0207659_10039822 3300025926 Unclassified 3281
336 Ga0207659_10060602 3300025926 Bacteria 2724
337 Ga0207687_10075709 3300025927 Bacteria 2416
338 Ga0207687_10107386 3300025927 Bacteria 2065
339 Ga0207664_10001170 3300025929 Bacteria 17446
340 Ga0207664_10026494 3300025929 Bacteria 4384
341 Ga0207664_10156640 3300025929 Bacteria 1940
342 Ga0207644_10136962 3300025931 Unclassified 1881
343 Ga0207690_10024198 3300025932 Bacteria 3801
344 Ga0207690_10024833 3300025932 Bacteria 3757
345 Ga0207690_10025295 3300025932 Bacteria 3725
346 Ga0207690_10130931 3300025932 Unclassified 1836
347 Ga0207706_10000323 3300025933 Bacteria 51731
348 Ga0207706_10016185 3300025933 Bacteria 6738
349 Ga0207706_10021738 3300025933 Bacteria 5758
350 Ga0207686_10081311 3300025934 Bacteria 2115
351 Ga0207670_10079842 3300025936 Bacteria 2285
352 Ga0207669_10032838 3300025937 Bacteria 2921
353 Ga0207669_10215795 3300025937 Unclassified 1404
354 Ga0207691_10003612 3300025940 Bacteria 15028
355 Ga0207691_10004648 3300025940 Bacteria 13296
356 Ga0207691_10057706 3300025940 Unclassified 3532
357 Ga0207711_10015445 3300025941 Bacteria 6337
358 Ga0207711_10258708 3300025941 Bacteria 1599
359 Ga0207689_10001442 3300025942 Bacteria 22737
360 Ga0207689_10019703 3300025942 Bacteria 5684
361 Ga0207689_10051357 3300025942 Bacteria 3399
362 Ga0207661_10000242 3300025944 Bacteria 35489
363 Ga0207661_10000342 3300025944 Bacteria 29828
364 Ga0207661_10004112 3300025944 Bacteria 10169
365 Ga0207661_10034692 3300025944 Bacteria 3926
366 Ga0207661_10065353 3300025944 Bacteria 2953
367 Ga0207661_10148792 3300025944 Bacteria 2022
368 Ga0207679_10000498 3300025945 Bacteria 27060
369 Ga0207679_10001124 3300025945 Bacteria 17078
370 Ga0207679_10008327 3300025945 Bacteria 6605
371 Ga0207679_10009176 3300025945 Bacteria 6325
372 Ga0207679_10018472 3300025945 Unclassified 4672
373 Ga0207679_10067805 3300025945 Bacteria 2678
374 Ga0207679_10147413 3300025945 Unclassified 1911
375 Ga0207667_10103863 3300025949 Bacteria 2930
376 Ga0207667_10122882 3300025949 Bacteria 2675
377 Ga0207667_10123187 3300025949 Unclassified 2671
378 Ga0207651_10049697 3300025960 Unclassified 2842
379 Ga0207651_10093774 3300025960 Bacteria 2205
380 Ga0207651_10255500 3300025960 Unclassified 1436
381 Ga0207712_10002381 3300025961 Bacteria 12182
382 Ga0207668_10012005 3300025972 Bacteria 5286
383 Ga0207640_10017119 3300025981 Bacteria 4233
384 Ga0207640_10083306 3300025981 Bacteria 2192
385 Ga0207640_10104183 3300025981 Bacteria 1996
386 Ga0207640_10169213 3300025981 Bacteria 1626
387 Ga0207658_10055909 3300025986 Bacteria 2927
388 Ga0207658_10183875 3300025986 Bacteria 1732
389 Ga0207677_10037705 3300026023 Bacteria 3162
390 Ga0207677_10086793 3300026023 Bacteria 2263
391 Ga0207677_10100367 3300026023 Bacteria 2128
392 Ga0207703_10070038 3300026035 Bacteria 2894
393 Ga0207639_10086232 3300026041 Unclassified 2499
394 Ga0207639_10241135 3300026041 Bacteria 1572
395 Ga0207641_10054611 3300026088 Bacteria 3390
396 Ga0207641_10089255 3300026088 Bacteria 2693
397 Ga0207641_10161084 3300026088 Bacteria 2040
398 Ga0207648_10008328 3300026089 Bacteria 10059
399 Ga0207648_10018714 3300026089 Bacteria 6264
400 Ga0207676_10020265 3300026095 Bacteria 4863
401 Ga0207676_10029857 3300026095 Bacteria 4086
402 Ga0207676_10037558 3300026095 Bacteria 3692
403 Ga0207676_10175835 3300026095 Unclassified 1869
404 Ga0207674_10000387 3300026116 Bacteria 57349
405 Ga0207674_10000842 3300026116 Bacteria 39994
406 Ga0207674_10001900 3300026116 Bacteria 26581
407 Ga0207674_10003885 3300026116 Bacteria 18191
408 Ga0207674_10019410 3300026116 Bacteria 7363
409 Ga0207674_10090003 3300026116 Bacteria 3061
410 Ga0207675_100000372 3300026118 Bacteria 43036
411 Ga0207698_10088078 3300026142 Unclassified 2531
412 Ga0207698_10162705 3300026142 Unclassified 1954
413 Ga0207698_10184811 3300026142 Unclassified 1850
414 Ga0209179_1003005 3300027512 Bacteria 2368
415 Ga0209998_10001045 3300027717 Bacteria 6943
416 Ga0268265_10021415 3300028380 Bacteria 4528
417 Ga0268265_10065843 3300028380 Bacteria 2798
418 Ga0268264_10017322 3300028381 Bacteria 5903
419 Ga0268264_10095140 3300028381 Bacteria 2577
420 Ga0307408_100213587 3300031548 Bacteria 1569
421 Ga0307405_10010806 3300031731 Bacteria 4750
422 Ga0307405_10103641 3300031731 Bacteria 1913
423 Ga0307405_10131695 3300031731 Bacteria 1729
424 Ga0307413_10082940 3300031824 Bacteria 2061
425 Ga0307410_10001914 3300031852 Bacteria 9749
426 Ga0307410_10075375 3300031852 Bacteria 2351
427 Ga0307406_10014765 3300031901 Bacteria 4500
428 Ga0307406_10061290 3300031901 Bacteria 2429
429 Ga0307406_10062487 3300031901 Unclassified 2409
430 Ga0307406_10077393 3300031901 Bacteria 2200
431 Ga0307406_10084611 3300031901 Bacteria 2118
432 Ga0307407_10000304 3300031903 Bacteria 14506
433 Ga0307407_10030242 3300031903 Bacteria 2920
434 Ga0307407_10055561 3300031903 Bacteria 2288
435 Ga0307412_10002031 3300031911 Bacteria 11248
436 Ga0307412_10004846 3300031911 Bacteria 7509
437 Ga0307412_10011032 3300031911 Bacteria 5221
438 Ga0307412_10046366 3300031911 Bacteria 2848
439 Ga0307412_10049666 3300031911 Bacteria 2765
440 Ga0307412_10099037 3300031911 Unclassified 2057
441 Ga0307409_100001171 3300031995 Bacteria 12521
442 Ga0307409_100012398 3300031995 Bacteria 5431
443 Ga0307409_100098393 3300031995 Bacteria 2419
444 Ga0307409_100128865 3300031995 Bacteria 2158
445 Ga0307416_100008551 3300032002 Bacteria 6615
446 Ga0307416_100029322 3300032002 Bacteria 4108
447 Ga0307416_100030920 3300032002 Bacteria 4024
448 Ga0307416_100069096 3300032002 Bacteria 2922
449 Ga0307416_100164578 3300032002 Bacteria 2055
450 Ga0307411_10000924 3300032005 Bacteria 11173
451 Ga0307411_10022666 3300032005 Bacteria 3702
452 Ga0307411_10037201 3300032005 Unclassified 3058
453 Ga0307411_10060132 3300032005 Bacteria 2521
454 Ga0307411_10116857 3300032005 Bacteria 1921
455 Ga0307411_10169732 3300032005 Bacteria 1644
456 Ga0307415_100002151 3300032126 Bacteria 9764
457 Ga0307415_100019164 3300032126 Bacteria 4148
458 Ga0307415_100077917 3300032126 Unclassified 2355
459 Ga0307415_100213268 3300032126 Bacteria 1542
460 Ga0373934_0000730 3300035086 Bacteria 11748
461 Ga0373953_0000876 3300035117 Bacteria 8440
462 Ga0373957_0031223 3300035120 Unclassified 1956
463 Ga0373955_0001343 3300035172 Bacteria 10443
464 Ga0373955_0040724 3300035172 Bacteria 2486
465 Ga0373924_0064900 3300035410 Unclassified 1533
466 Ga0373931_0003938 3300035691 Bacteria 6719
467 Ga0373935_0022863 3300035692 Bacteria 3838
468 Ga0373927_0046018 3300035695 Unclassified 2824
469 Ga0373927_0102956 3300035695 Bacteria 1857
470 Ga0373927_0120722 3300035695 Unclassified 1710
471 Ga0373933_0000183 3300035724 Bacteria 41364
472 Ga0373933_0028129 3300035724 Unclassified 3241
473 Ga0373937_0000101 3300036401 Bacteria 81054
474 Ga0373937_0000533 3300036401 Bacteria 34025
475 Ga0373925_0097537 3300037068 Bacteria 2254
476 Ga0436364_0274025 3300037853 Bacteria 1474
477 Ga0439446_0052595 3300042156 Bacteria 1219
478 Ga0451577_0025189 3300042876 Bacteria 5399
479 Ga0451577_0131919 3300042876 Unclassified 2242
480 Ga0453684_0039668 3300044712 Bacteria 6410
481 Ga0466967_0036446 3300045976 Bacteria 4199
482 Ga0495592_0128939 3300046454 Unclassified 1771
483 Ga0495629_0015420 3300046459 Bacteria 5488
484 Ga0495629_0085993 3300046459 Bacteria 2194
485 Ga0495651_0000911 3300046462 Bacteria 22936
486 Ga0495651_0078262 3300046462 Bacteria 2501
487 Ga0495653_0000271 3300046463 Bacteria 41959
488 Ga0495580_0011023 3300046472 Bacteria 7006
489 Ga0495580_0109690 3300046472 Unclassified 1916
490 Ga0495662_0002568 3300046476 Bacteria 9168
491 Ga0495664_0118044 3300046477 Bacteria 1604
492 Ga0495594_0003439 3300046499 Bacteria 8173
493 Ga0495596_0039657 3300046500 Unclassified 1860
494 Ga0495608_0000232 3300046511 Bacteria 40250
495 Ga0495628_0000358 3300046516 Bacteria 41642
496 Ga0495628_0011653 3300046516 Bacteria 7427
497 Ga0495628_0032366 3300046516 Bacteria 4221
498 Ga0495628_0116706 3300046516 Bacteria 2050
499 Ga0495630_0036356 3300046517 Bacteria 3681
500 Ga0495630_0056829 3300046517 Bacteria 2932
501 Ga0495652_0004164 3300046529 Bacteria 13942
502 Ga0495665_0022579 3300046531 Bacteria 3382
503 Ga0495640_0044853 3300046533 Bacteria 3071
504 Ga0495640_0100104 3300046533 Bacteria 1904
505 Ga0495586_0014366 3300046535 Bacteria 4207
506 Ga0495586_0191776 3300046535 Bacteria 1157
507 Ga0495587_0000229 3300046536 Bacteria 41448
508 Ga0495587_0003098 3300046536 Bacteria 11113
509 Ga0495587_0094779 3300046536 Unclassified 1723
510 Ga0495645_0000066 3300046543 Bacteria 73132
511 Ga0495645_0057181 3300046543 Unclassified 2832
512 Ga0495645_0158314 3300046543 Bacteria 1567
513 Ga0495667_0024824 3300046559 Bacteria 4038
514 Ga0495667_0055974 3300046559 Bacteria 2594
515 Ga0495634_0027875 3300046642 Bacteria 3926
516 Ga0495635_0000260 3300046663 Bacteria 33902
517 Ga0495635_0021470 3300046663 Bacteria 4501
518 Ga0495588_0003711 3300046674 Bacteria 6686
519 Ga0495657_0000794 3300046675 Bacteria 28070
520 Ga0495657_0112076 3300046675 Bacteria 1727
521 Ga0495599_0000280 3300046678 Bacteria 31273
522 Ga0495599_0037141 3300046678 Unclassified 3060
523 Ga0495599_0149234 3300046678 Unclassified 1448
524 Ga0495623_0000151 3300046679 Bacteria 42876
525 Ga0495623_0007045 3300046679 Bacteria 7306
526 Ga0495623_0083187 3300046679 Bacteria 1977
527 Ga0495646_0000547 3300046680 Bacteria 20285
528 Ga0495646_0065257 3300046680 Bacteria 2156
529 Ga0495613_0107300 3300046689 Bacteria 2014
530 Ga0495613_0120525 3300046689 Bacteria 1884
531 Ga0495600_0000207 3300046809 Bacteria 33867
532 Ga0495581_0038045 3300047315 Unclassified 2784
533 Ga0495604_0000633 3300047317 Bacteria 30242
534 Ga0495674_0042232 3300047319 Bacteria 4068
535 Ga0495674_0062955 3300047319 Bacteria 3228
536 Ga0495680_0041861 3300047322 Bacteria 3638
537 Ga0495680_0047098 3300047322 Bacteria 3394
538 Ga0495680_0152975 3300047322 Bacteria 1680
539 Ga0495675_0001467 3300047444 Bacteria 14265
540 Ga0495675_0007513 3300047444 Bacteria 6718
541 Ga0495675_0014533 3300047444 Bacteria 4977
542 Ga0495675_0131376 3300047444 Unclassified 1556
543 Ga0495685_049190 3300047447 Unclassified 1432
544 Ga0495684_0000428 3300047471 Bacteria 34287
545 Ga0495684_0023109 3300047471 Bacteria 4782
546 Ga0495602_0000545 3300048088 Bacteria 35134
547 Ga0496104_0220651 3300048907 Unclassified 1808
548 Ga0496105_0152252 3300048908 Unclassified 1901
549 Ga0496108_0103884 3300048911 Bacteria 2425
550 Ga0496112_0000846 3300048915 Bacteria 21835
551 Ga0496112_0117561 3300048915 Bacteria 2629
552 Ga0496113_0014546 3300048916 Bacteria 5372
553 Ga0496115_0017289 3300048918 Bacteria 5509
554 Ga0501038_0021601 3300049574 Bacteria 5776
555 Ga0501038_0051923 3300049574 Bacteria 3536
556 Ga0501038_0101527 3300049574 Bacteria 2394
557 Ga0501047_0028778 3300049581 Bacteria 5359
558 Ga0501067_0079575 3300049583 Unclassified 1816
559 Ga0501075_0069668 3300049591 Bacteria 2658
560 Ga0501076_0121273 3300049592 Unclassified 2117
561 Ga0501202_001891 3300049652 Bacteria 3437
562 Ga0501207_002545 3300049654 Unclassified 2368
563 Ga0501209_005853 3300049656 Bacteria 2251
564 Ga0501216_011208 3300049660 Bacteria 1453
565 Ga0501227_007308 3300049665 Unclassified 2366
566 Ga0501233_017174 3300049668 Bacteria 1508
567 Ga0501235_000394 3300049669 Bacteria 8378
568 Ga0501247_003929 3300049677 Bacteria 1611
569 Ga0501249_004913 3300049679 Bacteria 2727
570 Ga0501257_006527 3300049686 Unclassified 2590
571 Ga0501259_003834 3300049688 Bacteria 2391
572 Ga0501221_002958 3300049704 Unclassified 2799
573 Ga0501080_0251639 3300049742 Unclassified 1611
574 Ga0501081_0041404 3300049743 Bacteria 3155
575 Ga0501262_006853 3300049759 Bacteria 1369
576 Ga0501266_005487 3300049763 Bacteria 1576
577 Ga0501268_000450 3300049765 Bacteria 4448
578 Ga0501272_001806 3300049769 Unclassified 2080
579 Ga0501274_001599 3300049771 Bacteria 1737
580 Ga0501035_0156388 3300049822 Bacteria 1976
581 Ga0501212_000692 3300049851 Bacteria 3426
582 nmdc:mga05p37_24424_c1 3300050507 Bacteria 7345
583 nmdc:mga09592_72317_c1 3300050508 Bacteria 2928
584 nmdc:mga0qj67_112725_c1 3300050509 Bacteria 2196
585 nmdc:mga0qj67_1382_c1 3300050509 Bacteria 17005
586 nmdc:mga0qj67_84077_c1 3300050509 Unclassified 2552
587 nmdc:mga06r32_49191_c1 3300050510 Bacteria 4031
588 nmdc:mga08y16_70444_c1 3300050511 Bacteria 3645
589 nmdc:mga0n895_6143_c1 3300050512 Bacteria 10147
590 nmdc:mga0rr50_172416_c1 3300050513 Bacteria 1764
591 nmdc:mga0rr50_45706_c1 3300050513 Unclassified 3220
592 nmdc:mga08x19_26228_c1 3300050514 Bacteria 3635
593 nmdc:mga0a205_1390_c1 3300050515 Bacteria 20471
594 Ga0495601_0056482 3300053077 Unclassified 2486
595 Ga0495612_0000937 3300053078 Bacteria 11962
596 Ga0495619_0010425 3300053085 Bacteria 5848
597 Ga0501084_0026360 3300054114 Bacteria 4850

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100002688 Ga0070680_10000268814 295
2 3300005458 Ga0070681_10002407 Ga0070681_100024079 295
3 3300005530 Ga0070679_100000085 Ga0070679_1000000857 295
4 3300005327 Ga0070658_10047772 Ga0070658_100477724 304
5 3300005329 Ga0070683_100091202 Ga0070683_1000912023 304
6 3300005344 Ga0070661_100140097 Ga0070661_1001400971 304
7 3300005345 Ga0070692_10020119 Ga0070692_100201192 304
8 3300005366 Ga0070659_100022685 Ga0070659_1000226853 304
9 3300005535 Ga0070684_100002564 Ga0070684_1000025643 304
10 3300005564 Ga0070664_100005882 Ga0070664_1000058824 304
11 3300005577 Ga0068857_100039204 Ga0068857_1000392042 304
12 3300005618 Ga0068864_100014535 Ga0068864_1000145352 304
13 3300005841 Ga0068863_100128028 Ga0068863_1001280282 304
14 3300013100 Ga0157373_10117608 Ga0157373_101176081 304
15 3300013307 Ga0157372_10047871 Ga0157372_100478713 304
16 3300025920 Ga0207649_10071532 Ga0207649_100715322 304
17 3300025932 Ga0207690_10024198 Ga0207690_100241981 304
18 3300025944 Ga0207661_10034692 Ga0207661_100346921 304
19 3300025945 Ga0207679_10008327 Ga0207679_100083272 304
20 3300026088 Ga0207641_10161084 Ga0207641_101610841 304
21 3300026095 Ga0207676_10020265 Ga0207676_100202654 304
22 3300026116 Ga0207674_10019410 Ga0207674_100194104 304
23 3300037853 Ga0436364_0274025 Ga0436364_0274025_40_975 310
24 3300047444 Ga0495675_0131376 Ga0495675_0131376_182_1246 315
25 3300013102 Ga0157371_10133390 Ga0157371_101333901 317
26 3300048915 Ga0496112_0117561 Ga0496112_0117561_783_1835 317
27 3300048916 Ga0496113_0014546 Ga0496113_0014546_2295_3347 317
28 3300005336 Ga0070680_100036579 Ga0070680_1000365793 322
29 3300005336 Ga0070680_100168995 Ga0070680_1001689952 322
30 3300005530 Ga0070679_100032603 Ga0070679_1000326035 322
31 3300006914 Ga0075436_100021637 Ga0075436_1000216374 322
32 3300009174 Ga0105241_10071396 Ga0105241_100713963 322
33 3300009551 Ga0105238_10149251 Ga0105238_101492512 322
34 3300013100 Ga0157373_10037965 Ga0157373_100379652 322
35 3300013104 Ga0157370_10131534 Ga0157370_101315342 322
36 3300013105 Ga0157369_10238699 Ga0157369_102386992 322
37 3300013105 Ga0157369_10314072 Ga0157369_103140721 322
38 3300013307 Ga0157372_10168563 Ga0157372_101685633 322
39 3300025912 Ga0207707_10041828 Ga0207707_100418282 322
40 3300025913 Ga0207695_10067295 Ga0207695_100672953 322
41 3300050514 nmdc:mga08x19_26228_c1 nmdc:mga08x19_26228_c1_1340_2314 322
42 3300005563 Ga0068855_100048604 Ga0068855_1000486043 324
43 3300009545 Ga0105237_10046545 Ga0105237_100465452 324
44 3300005458 Ga0070681_10005269 Ga0070681_100052695 326
45 3300009093 Ga0105240_10275034 Ga0105240_102750342 326
46 3300013105 Ga0157369_10109205 Ga0157369_101092052 326
47 3300049574 Ga0501038_0101527 Ga0501038_0101527_565_1740 326
48 3300049591 Ga0501075_0069668 Ga0501075_0069668_96_1271 326
49 3300049743 Ga0501081_0041404 Ga0501081_0041404_362_1537 326
50 3300049822 Ga0501035_0156388 Ga0501035_0156388_780_1955 326
51 3300054114 Ga0501084_0026360 Ga0501084_0026360_2025_3200 326
52 3300005331 Ga0070670_100057976 Ga0070670_1000579765 327
53 3300005344 Ga0070661_100000965 Ga0070661_1000009656 327
54 3300005366 Ga0070659_100013565 Ga0070659_1000135652 327
55 3300005530 Ga0070679_100035763 Ga0070679_1000357632 327
56 3300005535 Ga0070684_100007288 Ga0070684_1000072885 327
57 3300005564 Ga0070664_100002171 Ga0070664_1000021717 327
58 3300005577 Ga0068857_100000179 Ga0068857_10000017927 327
59 3300013105 Ga0157369_10021605 Ga0157369_100216053 327
60 3300025912 Ga0207707_10000872 Ga0207707_1000087210 327
61 3300025922 Ga0207646_10123672 Ga0207646_101236722 327
62 3300025945 Ga0207679_10001124 Ga0207679_100011246 327
63 3300025960 Ga0207651_10255500 Ga0207651_102555001 327
64 3300026116 Ga0207674_10000842 Ga0207674_1000084226 327
65 3300009093 Ga0105240_10152084 Ga0105240_101520842 329
66 3300009551 Ga0105238_10068486 Ga0105238_100684861 329
67 3300013307 Ga0157372_10269240 Ga0157372_102692402 329
68 3300042156 Ga0439446_0052595 Ga0439446_0052595_11_1021 329
69 3300046543 Ga0495645_0057181 Ga0495645_0057181_1411_2460 329
70 3300014325 Ga0163163_10150316 Ga0163163_101503161 330
71 3300032005 Ga0307411_10116857 Ga0307411_101168572 330
72 3300049652 Ga0501202_001891 Ga0501202_001891_335_1348 331
73 3300049654 Ga0501207_002545 Ga0501207_002545_1235_2248 331
74 3300049656 Ga0501209_005853 Ga0501209_005853_756_1769 331
75 3300049660 Ga0501216_011208 Ga0501216_011208_95_1108 331
76 3300049665 Ga0501227_007308 Ga0501227_007308_685_1698 331
77 3300049668 Ga0501233_017174 Ga0501233_017174_50_1063 331
78 3300049669 Ga0501235_000394 Ga0501235_000394_2703_3716 331
79 3300049677 Ga0501247_003929 Ga0501247_003929_494_1507 331
80 3300049679 Ga0501249_004913 Ga0501249_004913_667_1680 331
81 3300049686 Ga0501257_006527 Ga0501257_006527_451_1464 331
82 3300049688 Ga0501259_003834 Ga0501259_003834_670_1683 331
83 3300049704 Ga0501221_002958 Ga0501221_002958_1610_2623 331
84 3300049759 Ga0501262_006853 Ga0501262_006853_344_1357 331
85 3300049765 Ga0501268_000450 Ga0501268_000450_2419_3432 331
86 3300049769 Ga0501272_001806 Ga0501272_001806_364_1377 331
87 3300049771 Ga0501274_001599 Ga0501274_001599_656_1669 331
88 3300049851 Ga0501212_000692 Ga0501212_000692_900_1913 331
89 3300005535 Ga0070684_100025041 Ga0070684_1000250411 332
90 3300025914 Ga0207671_10162167 Ga0207671_101621671 332
91 3300026142 Ga0207698_10184811 Ga0207698_101848112 332
92 3300031731 Ga0307405_10010806 Ga0307405_100108062 333
93 3300031901 Ga0307406_10061290 Ga0307406_100612902 333
94 3300031903 Ga0307407_10030242 Ga0307407_100302422 333
95 3300031911 Ga0307412_10004846 Ga0307412_100048466 333
96 3300031995 Ga0307409_100001171 Ga0307409_1000011719 333
97 3300031995 Ga0307409_100128865 Ga0307409_1001288652 333
98 3300032002 Ga0307416_100008551 Ga0307416_1000085514 333
99 3300032002 Ga0307416_100069096 Ga0307416_1000690962 333
100 3300032005 Ga0307411_10000924 Ga0307411_100009249 333
101 3300032126 Ga0307415_100019164 Ga0307415_1000191645 333
102 3300046454 Ga0495592_0128939 Ga0495592_0128939_74_1078 333
103 3300046533 Ga0495640_0100104 Ga0495640_0100104_733_1737 333
104 3300046535 Ga0495586_0191776 Ga0495586_0191776_139_1143 333
105 3300046559 Ga0495667_0024824 Ga0495667_0024824_2738_3742 333
106 3300047444 Ga0495675_0014533 Ga0495675_0014533_2746_3750 333
107 3300005336 Ga0070680_100002464 Ga0070680_10000246413 334
108 3300005530 Ga0070679_100002972 Ga0070679_10000297214 334
109 3300009098 Ga0105245_10042292 Ga0105245_100422923 334
110 3300025907 Ga0207645_10063986 Ga0207645_100639862 334
111 3300025921 Ga0207652_10005853 Ga0207652_100058539 334
112 3300025927 Ga0207687_10075709 Ga0207687_100757092 334
113 3300026023 Ga0207677_10100367 Ga0207677_101003672 334
114 3300031852 Ga0307410_10075375 Ga0307410_100753752 334
115 3300031901 Ga0307406_10077393 Ga0307406_100773932 334
116 3300031901 Ga0307406_10084611 Ga0307406_100846111 334
117 3300031903 Ga0307407_10055561 Ga0307407_100555611 334
118 3300031911 Ga0307412_10011032 Ga0307412_100110325 334
119 3300031911 Ga0307412_10099037 Ga0307412_100990372 334
120 3300032002 Ga0307416_100029322 Ga0307416_1000293222 334
121 3300032002 Ga0307416_100164578 Ga0307416_1001645781 334
122 3300032005 Ga0307411_10060132 Ga0307411_100601322 334
123 3300032126 Ga0307415_100077917 Ga0307415_1000779172 334
124 3300042876 Ga0451577_0025189 Ga0451577_0025189_438_1511 334
125 3300042876 Ga0451577_0131919 Ga0451577_0131919_1050_2123 334
126 3300044712 Ga0453684_0039668 Ga0453684_0039668_1249_2322 334
127 3300047315 Ga0495581_0038045 Ga0495581_0038045_147_1154 334
128 3300005293 Ga0065715_10132560 Ga0065715_101325602 335
129 3300005329 Ga0070683_100137009 Ga0070683_1001370091 335
130 3300005336 Ga0070680_100000211 Ga0070680_10000021111 335
131 3300005337 Ga0070682_100001451 Ga0070682_1000014511 335
132 3300005344 Ga0070661_100141228 Ga0070661_1001412282 335
133 3300005435 Ga0070714_100077656 Ga0070714_1000776562 335
134 3300005459 Ga0068867_100014698 Ga0068867_1000146984 335
135 3300005467 Ga0070706_100092829 Ga0070706_1000928291 335
136 3300005468 Ga0070707_100109433 Ga0070707_1001094332 335
137 3300005468 Ga0070707_100203054 Ga0070707_1002030541 335
138 3300005471 Ga0070698_100023353 Ga0070698_1000233533 335
139 3300005530 Ga0070679_100000355 Ga0070679_10000035511 335
140 3300005535 Ga0070684_100098467 Ga0070684_1000984672 335
141 3300005539 Ga0068853_100051795 Ga0068853_1000517953 335
142 3300005563 Ga0068855_100216579 Ga0068855_1002165793 335
143 3300005564 Ga0070664_100210528 Ga0070664_1002105281 335
144 3300005577 Ga0068857_100249439 Ga0068857_1002494391 335
145 3300005578 Ga0068854_100056769 Ga0068854_1000567692 335
146 3300005616 Ga0068852_100167219 Ga0068852_1001672191 335
147 3300006914 Ga0075436_100009980 Ga0075436_1000099802 335
148 3300009098 Ga0105245_10024020 Ga0105245_100240203 335
149 3300009545 Ga0105237_10121199 Ga0105237_101211992 335
150 3300013104 Ga0157370_10205822 Ga0157370_102058221 335
151 3300013296 Ga0157374_10075153 Ga0157374_100751531 335
152 3300013297 Ga0157378_10002336 Ga0157378_1000233612 335
153 3300020082 Ga0206353_11062776 Ga0206353_110627762 335
154 3300025912 Ga0207707_10000303 Ga0207707_1000030320 335
155 3300025913 Ga0207695_10172476 Ga0207695_101724762 335
156 3300025914 Ga0207671_10063170 Ga0207671_100631703 335
157 3300025917 Ga0207660_10001634 Ga0207660_1000163411 335
158 3300025917 Ga0207660_10016634 Ga0207660_100166344 335
159 3300025920 Ga0207649_10059317 Ga0207649_100593172 335
160 3300025921 Ga0207652_10000526 Ga0207652_1000052621 335
161 3300025924 Ga0207694_10215448 Ga0207694_102154482 335
162 3300025927 Ga0207687_10107386 Ga0207687_101073863 335
163 3300025937 Ga0207669_10032838 Ga0207669_100328382 335
164 3300025945 Ga0207679_10147413 Ga0207679_101474132 335
165 3300025949 Ga0207667_10123187 Ga0207667_101231872 335
166 3300025981 Ga0207640_10083306 Ga0207640_100833062 335
167 3300026041 Ga0207639_10086232 Ga0207639_100862322 335
168 3300026089 Ga0207648_10008328 Ga0207648_100083282 335
169 3300026142 Ga0207698_10162705 Ga0207698_101627052 335
170 3300027717 Ga0209998_10001045 Ga0209998_100010452 335
171 3300031548 Ga0307408_100213587 Ga0307408_1002135871 335
172 3300031731 Ga0307405_10103641 Ga0307405_101036412 335
173 3300031731 Ga0307405_10131695 Ga0307405_101316951 335
174 3300031824 Ga0307413_10082940 Ga0307413_100829402 335
175 3300031852 Ga0307410_10001914 Ga0307410_100019141 335
176 3300031901 Ga0307406_10014765 Ga0307406_100147656 335
177 3300031901 Ga0307406_10062487 Ga0307406_100624872 335
178 3300031903 Ga0307407_10000304 Ga0307407_100003045 335
179 3300031911 Ga0307412_10002031 Ga0307412_100020311 335
180 3300031911 Ga0307412_10046366 Ga0307412_100463662 335
181 3300031911 Ga0307412_10049666 Ga0307412_100496662 335
182 3300031995 Ga0307409_100012398 Ga0307409_1000123985 335
183 3300031995 Ga0307409_100098393 Ga0307409_1000983931 335
184 3300032002 Ga0307416_100030920 Ga0307416_1000309203 335
185 3300032005 Ga0307411_10022666 Ga0307411_100226662 335
186 3300032005 Ga0307411_10037201 Ga0307411_100372013 335
187 3300032126 Ga0307415_100002151 Ga0307415_1000021513 335
188 3300049574 Ga0501038_0021601 Ga0501038_0021601_2312_3322 335
189 3300049574 Ga0501038_0051923 Ga0501038_0051923_2292_3350 335
190 3300049581 Ga0501047_0028778 Ga0501047_0028778_232_1242 335
191 3300049583 Ga0501067_0079575 Ga0501067_0079575_22_1083 335
192 3300049763 Ga0501266_005487 Ga0501266_005487_172_1320 335
193 2162886012 MBSR1b_contig_10279081 MBSR1b_0775.00006140 336
194 3300005290 Ga0065712_10107274 Ga0065712_101072742 336
195 3300005293 Ga0065715_10092603 Ga0065715_100926032 336
196 3300005295 Ga0065707_10086002 Ga0065707_100860024 336
197 3300005327 Ga0070658_10004216 Ga0070658_100042166 336
198 3300005327 Ga0070658_10111999 Ga0070658_101119992 336
199 3300005328 Ga0070676_10037765 Ga0070676_100377652 336
200 3300005328 Ga0070676_10067316 Ga0070676_100673162 336
201 3300005329 Ga0070683_100001402 Ga0070683_10000140211 336
202 3300005329 Ga0070683_100005334 Ga0070683_1000053347 336
203 3300005329 Ga0070683_100058907 Ga0070683_1000589072 336
204 3300005329 Ga0070683_100073623 Ga0070683_1000736231 336
205 3300005330 Ga0070690_100031738 Ga0070690_1000317382 336
206 3300005331 Ga0070670_100005229 Ga0070670_1000052296 336
207 3300005331 Ga0070670_100012450 Ga0070670_1000124509 336
208 3300005331 Ga0070670_100024335 Ga0070670_1000243354 336
209 3300005331 Ga0070670_100028999 Ga0070670_1000289992 336
210 3300005334 Ga0068869_100001049 Ga0068869_1000010492 336
211 3300005334 Ga0068869_100027103 Ga0068869_1000271034 336
212 3300005335 Ga0070666_10031908 Ga0070666_100319083 336
213 3300005335 Ga0070666_10092775 Ga0070666_100927752 336
214 3300005336 Ga0070680_100002193 Ga0070680_10000219310 336
215 3300005336 Ga0070680_100011383 Ga0070680_1000113832 336
216 3300005336 Ga0070680_100095170 Ga0070680_1000951702 336
217 3300005336 Ga0070680_100188902 Ga0070680_1001889021 336
218 3300005337 Ga0070682_100000790 Ga0070682_1000007905 336
219 3300005337 Ga0070682_100010720 Ga0070682_1000107201 336
220 3300005337 Ga0070682_100016215 Ga0070682_1000162153 336
221 3300005338 Ga0068868_100265507 Ga0068868_1002655071 336
222 3300005339 Ga0070660_100006624 Ga0070660_1000066245 336
223 3300005339 Ga0070660_100077782 Ga0070660_1000777822 336
224 3300005340 Ga0070689_100022167 Ga0070689_1000221673 336
225 3300005340 Ga0070689_100184804 Ga0070689_1001848042 336
226 3300005343 Ga0070687_100001962 Ga0070687_1000019627 336
227 3300005343 Ga0070687_100013033 Ga0070687_1000130334 336
228 3300005344 Ga0070661_100004675 Ga0070661_1000046752 336
229 3300005344 Ga0070661_100004701 Ga0070661_1000047014 336
230 3300005344 Ga0070661_100033959 Ga0070661_1000339595 336
231 3300005344 Ga0070661_100049438 Ga0070661_1000494382 336
232 3300005345 Ga0070692_10003678 Ga0070692_100036785 336
233 3300005347 Ga0070668_100159543 Ga0070668_1001595431 336
234 3300005353 Ga0070669_100002801 Ga0070669_1000028016 336
235 3300005353 Ga0070669_100012282 Ga0070669_1000122824 336
236 3300005353 Ga0070669_100120633 Ga0070669_1001206331 336
237 3300005354 Ga0070675_100001287 Ga0070675_1000012872 336
238 3300005354 Ga0070675_100011812 Ga0070675_1000118122 336
239 3300005354 Ga0070675_100038842 Ga0070675_1000388423 336
240 3300005354 Ga0070675_100042358 Ga0070675_1000423582 336
241 3300005354 Ga0070675_100258840 Ga0070675_1002588401 336
242 3300005355 Ga0070671_100024347 Ga0070671_1000243474 336
243 3300005355 Ga0070671_100050572 Ga0070671_1000505723 336
244 3300005356 Ga0070674_100245600 Ga0070674_1002456001 336
245 3300005364 Ga0070673_100076469 Ga0070673_1000764693 336
246 3300005364 Ga0070673_100129174 Ga0070673_1001291742 336
247 3300005364 Ga0070673_100295373 Ga0070673_1002953731 336
248 3300005365 Ga0070688_100005871 Ga0070688_1000058713 336
249 3300005366 Ga0070659_100003646 Ga0070659_1000036465 336
250 3300005366 Ga0070659_100004835 Ga0070659_1000048356 336
251 3300005366 Ga0070659_100335729 Ga0070659_1003357291 336
252 3300005367 Ga0070667_100008417 Ga0070667_1000084177 336
253 3300005367 Ga0070667_100067093 Ga0070667_1000670933 336
254 3300005406 Ga0070703_10013658 Ga0070703_100136582 336
255 3300005435 Ga0070714_100012956 Ga0070714_1000129565 336
256 3300005439 Ga0070711_100172282 Ga0070711_1001722822 336
257 3300005445 Ga0070708_100000849 Ga0070708_1000008495 336
258 3300005445 Ga0070708_100018454 Ga0070708_1000184544 336
259 3300005455 Ga0070663_100076849 Ga0070663_1000768492 336
260 3300005457 Ga0070662_100000424 Ga0070662_1000004249 336
261 3300005457 Ga0070662_100042621 Ga0070662_1000426212 336
262 3300005457 Ga0070662_100178612 Ga0070662_1001786122 336
263 3300005458 Ga0070681_10005393 Ga0070681_100053939 336
264 3300005458 Ga0070681_10008249 Ga0070681_100082498 336
265 3300005458 Ga0070681_10023997 Ga0070681_100239972 336
266 3300005458 Ga0070681_10321787 Ga0070681_103217871 336
267 3300005466 Ga0070685_10022157 Ga0070685_100221572 336
268 3300005466 Ga0070685_10040313 Ga0070685_100403132 336
269 3300005466 Ga0070685_10135584 Ga0070685_101355842 336
270 3300005467 Ga0070706_100035147 Ga0070706_1000351473 336
271 3300005468 Ga0070707_100002115 Ga0070707_1000021154 336
272 3300005468 Ga0070707_100095400 Ga0070707_1000954001 336
273 3300005468 Ga0070707_100122482 Ga0070707_1001224822 336
274 3300005471 Ga0070698_100015754 Ga0070698_1000157545 336
275 3300005518 Ga0070699_100016562 Ga0070699_1000165627 336
276 3300005518 Ga0070699_100020754 Ga0070699_1000207541 336
277 3300005530 Ga0070679_100002038 Ga0070679_10000203813 336
278 3300005530 Ga0070679_100003613 Ga0070679_1000036134 336
279 3300005530 Ga0070679_100004960 Ga0070679_1000049609 336
280 3300005530 Ga0070679_100155728 Ga0070679_1001557282 336
281 3300005535 Ga0070684_100001085 Ga0070684_10000108515 336
282 3300005535 Ga0070684_100010548 Ga0070684_1000105482 336
283 3300005535 Ga0070684_100142985 Ga0070684_1001429852 336
284 3300005535 Ga0070684_100162472 Ga0070684_1001624722 336
285 3300005536 Ga0070697_100097679 Ga0070697_1000976791 336
286 3300005539 Ga0068853_100038666 Ga0068853_1000386662 336
287 3300005539 Ga0068853_100130969 Ga0068853_1001309693 336
288 3300005543 Ga0070672_100014501 Ga0070672_1000145011 336
289 3300005543 Ga0070672_100185686 Ga0070672_1001856862 336
290 3300005545 Ga0070695_100008476 Ga0070695_1000084765 336
291 3300005545 Ga0070695_100090258 Ga0070695_1000902582 336
292 3300005546 Ga0070696_100004808 Ga0070696_1000048083 336
293 3300005563 Ga0068855_100001420 Ga0068855_10000142023 336
294 3300005563 Ga0068855_100007089 Ga0068855_1000070892 336
295 3300005563 Ga0068855_100026460 Ga0068855_1000264607 336
296 3300005563 Ga0068855_100034889 Ga0068855_1000348894 336
297 3300005564 Ga0070664_100000313 Ga0070664_10000031313 336
298 3300005564 Ga0070664_100028013 Ga0070664_1000280134 336
299 3300005564 Ga0070664_100040470 Ga0070664_1000404705 336
300 3300005564 Ga0070664_100058501 Ga0070664_1000585012 336
301 3300005564 Ga0070664_100073209 Ga0070664_1000732093 336
302 3300005577 Ga0068857_100000495 Ga0068857_10000049524 336
303 3300005577 Ga0068857_100008030 Ga0068857_1000080308 336
304 3300005577 Ga0068857_100011370 Ga0068857_1000113706 336
305 3300005577 Ga0068857_100064552 Ga0068857_1000645522 336
306 3300005578 Ga0068854_100009904 Ga0068854_1000099043 336
307 3300005578 Ga0068854_100120090 Ga0068854_1001200902 336
308 3300005614 Ga0068856_100003777 Ga0068856_1000037774 336
309 3300005615 Ga0070702_100018912 Ga0070702_1000189122 336
310 3300005616 Ga0068852_100020098 Ga0068852_1000200983 336
311 3300005616 Ga0068852_100022032 Ga0068852_1000220323 336
312 3300005616 Ga0068852_100025845 Ga0068852_1000258453 336
313 3300005617 Ga0068859_100021114 Ga0068859_1000211142 336
314 3300005617 Ga0068859_100069586 Ga0068859_1000695863 336
315 3300005618 Ga0068864_100008261 Ga0068864_1000082613 336
316 3300005718 Ga0068866_10004619 Ga0068866_100046193 336
317 3300005719 Ga0068861_100007253 Ga0068861_1000072536 336
318 3300005834 Ga0068851_10029991 Ga0068851_100299912 336
319 3300005840 Ga0068870_10031641 Ga0068870_100316412 336
320 3300005841 Ga0068863_100079094 Ga0068863_1000790943 336
321 3300005842 Ga0068858_100027021 Ga0068858_1000270215 336
322 3300005842 Ga0068858_100050059 Ga0068858_1000500595 336
323 3300005843 Ga0068860_100012629 Ga0068860_1000126294 336
324 3300005843 Ga0068860_100037303 Ga0068860_1000373033 336
325 3300005844 Ga0068862_100037198 Ga0068862_1000371985 336
326 3300006028 Ga0070717_10132952 Ga0070717_101329522 336
327 3300006173 Ga0070716_100093868 Ga0070716_1000938681 336
328 3300006175 Ga0070712_100218371 Ga0070712_1002183711 336
329 3300006358 Ga0068871_100034443 Ga0068871_1000344432 336
330 3300006358 Ga0068871_100193081 Ga0068871_1001930811 336
331 3300006844 Ga0075428_100393821 Ga0075428_1003938211 336
332 3300006846 Ga0075430_100002736 Ga0075430_10000273612 336
333 3300006846 Ga0075430_100009941 Ga0075430_1000099416 336
334 3300006846 Ga0075430_100056995 Ga0075430_1000569953 336
335 3300006846 Ga0075430_100193614 Ga0075430_1001936142 336
336 3300006847 Ga0075431_100055741 Ga0075431_1000557415 336
337 3300006847 Ga0075431_100330921 Ga0075431_1003309211 336
338 3300006852 Ga0075433_10021167 Ga0075433_100211677 336
339 3300006871 Ga0075434_100017657 Ga0075434_1000176574 336
340 3300006881 Ga0068865_100019525 Ga0068865_1000195255 336
341 3300006881 Ga0068865_100213199 Ga0068865_1002131991 336
342 3300006914 Ga0075436_100016778 Ga0075436_1000167785 336
343 3300006931 Ga0097620_100021115 Ga0097620_1000211155 336
344 3300006931 Ga0097620_100069590 Ga0097620_1000695903 336
345 3300007076 Ga0075435_100008656 Ga0075435_1000086562 336
346 3300007788 Ga0099795_10003411 Ga0099795_100034113 336
347 3300009093 Ga0105240_10124670 Ga0105240_101246701 336
348 3300009094 Ga0111539_10036945 Ga0111539_100369452 336
349 3300009098 Ga0105245_10048195 Ga0105245_100481953 336
350 3300009098 Ga0105245_10062529 Ga0105245_100625292 336
351 3300009147 Ga0114129_10012586 Ga0114129_1001258610 336
352 3300009174 Ga0105241_10057235 Ga0105241_100572351 336
353 3300009174 Ga0105241_10183727 Ga0105241_101837271 336
354 3300009176 Ga0105242_10040329 Ga0105242_100403293 336
355 3300009177 Ga0105248_10011861 Ga0105248_100118617 336
356 3300009177 Ga0105248_10019314 Ga0105248_100193143 336
357 3300009177 Ga0105248_10026436 Ga0105248_100264362 336
358 3300009177 Ga0105248_10153149 Ga0105248_101531492 336
359 3300009177 Ga0105248_10261374 Ga0105248_102613741 336
360 3300009551 Ga0105238_10061051 Ga0105238_100610513 336
361 3300009551 Ga0105238_10278908 Ga0105238_102789082 336
362 3300009553 Ga0105249_10006039 Ga0105249_100060396 336
363 3300009553 Ga0105249_10060953 Ga0105249_100609532 336
364 3300009553 Ga0105249_10133713 Ga0105249_101337132 336
365 3300010159 Ga0099796_10001176 Ga0099796_100011763 336
366 3300010375 Ga0105239_10053701 Ga0105239_100537014 336
367 3300011119 Ga0105246_10001757 Ga0105246_1000175710 336
368 3300013102 Ga0157371_10011933 Ga0157371_100119332 336
369 3300013105 Ga0157369_10154431 Ga0157369_101544312 336
370 3300013105 Ga0157369_10302341 Ga0157369_103023411 336
371 3300013296 Ga0157374_10024538 Ga0157374_100245383 336
372 3300013296 Ga0157374_10032088 Ga0157374_100320883 336
373 3300013296 Ga0157374_10216611 Ga0157374_102166112 336
374 3300013297 Ga0157378_10023731 Ga0157378_100237316 336
375 3300013297 Ga0157378_10099905 Ga0157378_100999052 336
376 3300013297 Ga0157378_10139188 Ga0157378_101391882 336
377 3300013297 Ga0157378_10163930 Ga0157378_101639302 336
378 3300013306 Ga0163162_10002048 Ga0163162_1000204811 336
379 3300013307 Ga0157372_10003799 Ga0157372_100037997 336
380 3300013307 Ga0157372_10021660 Ga0157372_100216604 336
381 3300013307 Ga0157372_10025111 Ga0157372_100251115 336
382 3300013307 Ga0157372_10036633 Ga0157372_100366333 336
383 3300013307 Ga0157372_10038903 Ga0157372_100389031 336
384 3300013307 Ga0157372_10134245 Ga0157372_101342452 336
385 3300013307 Ga0157372_10203259 Ga0157372_102032593 336
386 3300013308 Ga0157375_10005804 Ga0157375_1000580414 336
387 3300013308 Ga0157375_10008124 Ga0157375_100081244 336
388 3300013308 Ga0157375_10162236 Ga0157375_101622361 336
389 3300014325 Ga0163163_10002127 Ga0163163_100021278 336
390 3300014325 Ga0163163_10073490 Ga0163163_100734902 336
391 3300014325 Ga0163163_10385663 Ga0163163_103856632 336
392 3300014745 Ga0157377_10011964 Ga0157377_100119644 336
393 3300014745 Ga0157377_10193262 Ga0157377_101932621 336
394 3300014968 Ga0157379_10007606 Ga0157379_100076065 336
395 3300015262 Ga0182007_10015980 Ga0182007_100159801 336
396 3300017792 Ga0163161_10012618 Ga0163161_100126183 336
397 3300025315 Ga0207697_10005401 Ga0207697_100054017 336
398 3300025899 Ga0207642_10043498 Ga0207642_100434982 336
399 3300025907 Ga0207645_10001996 Ga0207645_1000199610 336
400 3300025907 Ga0207645_10076616 Ga0207645_100766162 336
401 3300025908 Ga0207643_10020267 Ga0207643_100202674 336
402 3300025909 Ga0207705_10002919 Ga0207705_100029195 336
403 3300025909 Ga0207705_10013095 Ga0207705_100130953 336
404 3300025911 Ga0207654_10021822 Ga0207654_100218225 336
405 3300025912 Ga0207707_10002037 Ga0207707_100020376 336
406 3300025912 Ga0207707_10019607 Ga0207707_100196074 336
407 3300025912 Ga0207707_10039036 Ga0207707_100390362 336
408 3300025912 Ga0207707_10069981 Ga0207707_100699811 336
409 3300025913 Ga0207695_10022331 Ga0207695_100223317 336
410 3300025915 Ga0207693_10088255 Ga0207693_100882553 336
411 3300025917 Ga0207660_10011842 Ga0207660_100118422 336
412 3300025917 Ga0207660_10022288 Ga0207660_100222882 336
413 3300025918 Ga0207662_10001793 Ga0207662_1000179310 336
414 3300025918 Ga0207662_10003880 Ga0207662_100038807 336
415 3300025919 Ga0207657_10013223 Ga0207657_100132235 336
416 3300025919 Ga0207657_10043399 Ga0207657_100433994 336
417 3300025919 Ga0207657_10046442 Ga0207657_100464424 336
418 3300025919 Ga0207657_10062627 Ga0207657_100626272 336
419 3300025920 Ga0207649_10002406 Ga0207649_100024068 336
420 3300025920 Ga0207649_10011144 Ga0207649_100111442 336
421 3300025920 Ga0207649_10036228 Ga0207649_100362283 336
422 3300025920 Ga0207649_10042157 Ga0207649_100421572 336
423 3300025921 Ga0207652_10002073 Ga0207652_100020738 336
424 3300025921 Ga0207652_10002917 Ga0207652_1000291713 336
425 3300025921 Ga0207652_10034175 Ga0207652_100341754 336
426 3300025922 Ga0207646_10048666 Ga0207646_100486663 336
427 3300025923 Ga0207681_10012803 Ga0207681_100128035 336
428 3300025923 Ga0207681_10013491 Ga0207681_100134916 336
429 3300025923 Ga0207681_10033533 Ga0207681_100335331 336
430 3300025924 Ga0207694_10062333 Ga0207694_100623331 336
431 3300025924 Ga0207694_10087633 Ga0207694_100876332 336
432 3300025925 Ga0207650_10004261 Ga0207650_100042617 336
433 3300025925 Ga0207650_10012067 Ga0207650_100120672 336
434 3300025925 Ga0207650_10057237 Ga0207650_100572373 336
435 3300025925 Ga0207650_10058215 Ga0207650_100582154 336
436 3300025926 Ga0207659_10022835 Ga0207659_100228353 336
437 3300025926 Ga0207659_10039822 Ga0207659_100398223 336
438 3300025926 Ga0207659_10060602 Ga0207659_100606022 336
439 3300025929 Ga0207664_10001170 Ga0207664_100011706 336
440 3300025929 Ga0207664_10026494 Ga0207664_100264943 336
441 3300025929 Ga0207664_10156640 Ga0207664_101566402 336
442 3300025931 Ga0207644_10136962 Ga0207644_101369622 336
443 3300025932 Ga0207690_10024833 Ga0207690_100248334 336
444 3300025932 Ga0207690_10025295 Ga0207690_100252954 336
445 3300025932 Ga0207690_10130931 Ga0207690_101309311 336
446 3300025933 Ga0207706_10000323 Ga0207706_1000032326 336
447 3300025933 Ga0207706_10016185 Ga0207706_100161854 336
448 3300025933 Ga0207706_10021738 Ga0207706_100217385 336
449 3300025934 Ga0207686_10081311 Ga0207686_100813111 336
450 3300025936 Ga0207670_10079842 Ga0207670_100798422 336
451 3300025937 Ga0207669_10215795 Ga0207669_102157951 336
452 3300025940 Ga0207691_10003612 Ga0207691_100036125 336
453 3300025940 Ga0207691_10004648 Ga0207691_1000464810 336
454 3300025940 Ga0207691_10057706 Ga0207691_100577062 336
455 3300025941 Ga0207711_10015445 Ga0207711_100154456 336
456 3300025941 Ga0207711_10258708 Ga0207711_102587081 336
457 3300025942 Ga0207689_10001442 Ga0207689_1000144213 336
458 3300025942 Ga0207689_10019703 Ga0207689_100197033 336
459 3300025942 Ga0207689_10051357 Ga0207689_100513574 336
460 3300025944 Ga0207661_10000242 Ga0207661_100002428 336
461 3300025944 Ga0207661_10000342 Ga0207661_100003425 336
462 3300025944 Ga0207661_10004112 Ga0207661_100041123 336
463 3300025944 Ga0207661_10065353 Ga0207661_100653531 336
464 3300025944 Ga0207661_10148792 Ga0207661_101487922 336
465 3300025945 Ga0207679_10000498 Ga0207679_1000049812 336
466 3300025945 Ga0207679_10009176 Ga0207679_100091767 336
467 3300025945 Ga0207679_10018472 Ga0207679_100184722 336
468 3300025945 Ga0207679_10067805 Ga0207679_100678052 336
469 3300025949 Ga0207667_10103863 Ga0207667_101038632 336
470 3300025949 Ga0207667_10122882 Ga0207667_101228821 336
471 3300025960 Ga0207651_10049697 Ga0207651_100496972 336
472 3300025960 Ga0207651_10093774 Ga0207651_100937743 336
473 3300025961 Ga0207712_10002381 Ga0207712_100023816 336
474 3300025972 Ga0207668_10012005 Ga0207668_100120053 336
475 3300025981 Ga0207640_10017119 Ga0207640_100171193 336
476 3300025981 Ga0207640_10104183 Ga0207640_101041832 336
477 3300025981 Ga0207640_10169213 Ga0207640_101692131 336
478 3300025986 Ga0207658_10055909 Ga0207658_100559091 336
479 3300025986 Ga0207658_10183875 Ga0207658_101838752 336
480 3300026023 Ga0207677_10037705 Ga0207677_100377054 336
481 3300026023 Ga0207677_10086793 Ga0207677_100867932 336
482 3300026035 Ga0207703_10070038 Ga0207703_100700382 336
483 3300026041 Ga0207639_10241135 Ga0207639_102411351 336
484 3300026088 Ga0207641_10054611 Ga0207641_100546111 336
485 3300026088 Ga0207641_10089255 Ga0207641_100892551 336
486 3300026089 Ga0207648_10018714 Ga0207648_100187142 336
487 3300026095 Ga0207676_10029857 Ga0207676_100298572 336
488 3300026095 Ga0207676_10037558 Ga0207676_100375583 336
489 3300026095 Ga0207676_10175835 Ga0207676_101758352 336
490 3300026116 Ga0207674_10000387 Ga0207674_1000038712 336
491 3300026116 Ga0207674_10001900 Ga0207674_100019009 336
492 3300026116 Ga0207674_10003885 Ga0207674_100038856 336
493 3300026116 Ga0207674_10090003 Ga0207674_100900031 336
494 3300026118 Ga0207675_100000372 Ga0207675_10000037218 336
495 3300026142 Ga0207698_10088078 Ga0207698_100880782 336
496 3300027512 Ga0209179_1003005 Ga0209179_10030053 336
497 3300028380 Ga0268265_10021415 Ga0268265_100214153 336
498 3300028380 Ga0268265_10065843 Ga0268265_100658432 336
499 3300028381 Ga0268264_10017322 Ga0268264_100173224 336
500 3300028381 Ga0268264_10095140 Ga0268264_100951402 336
501 3300032005 Ga0307411_10169732 Ga0307411_101697321 336
502 3300032126 Ga0307415_100213268 Ga0307415_1002132682 336
503 3300035086 Ga0373934_0000730 Ga0373934_0000730_1320_2369 336
504 3300035117 Ga0373953_0000876 Ga0373953_0000876_4613_5626 336
505 3300035120 Ga0373957_0031223 Ga0373957_0031223_160_1209 336
506 3300035172 Ga0373955_0001343 Ga0373955_0001343_764_1777 336
507 3300035172 Ga0373955_0040724 Ga0373955_0040724_64_1113 336
508 3300035410 Ga0373924_0064900 Ga0373924_0064900_286_1335 336
509 3300035691 Ga0373931_0003938 Ga0373931_0003938_5576_6664 336
510 3300035692 Ga0373935_0022863 Ga0373935_0022863_2693_3787 336
511 3300035695 Ga0373927_0046018 Ga0373927_0046018_1788_2801 336
512 3300035695 Ga0373927_0102956 Ga0373927_0102956_367_1440 336
513 3300035695 Ga0373927_0120722 Ga0373927_0120722_395_1468 336
514 3300035724 Ga0373933_0000183 Ga0373933_0000183_8591_9604 336
515 3300035724 Ga0373933_0028129 Ga0373933_0028129_908_1957 336
516 3300036401 Ga0373937_0000101 Ga0373937_0000101_72081_73130 336
517 3300036401 Ga0373937_0000533 Ga0373937_0000533_31751_32764 336
518 3300037068 Ga0373925_0097537 Ga0373925_0097537_610_1683 336
519 3300045976 Ga0466967_0036446 Ga0466967_0036446_950_2011 336
520 3300046459 Ga0495629_0015420 Ga0495629_0015420_751_1764 336
521 3300046459 Ga0495629_0085993 Ga0495629_0085993_688_1809 336
522 3300046462 Ga0495651_0000911 Ga0495651_0000911_12523_13536 336
523 3300046462 Ga0495651_0078262 Ga0495651_0078262_955_2076 336
524 3300046463 Ga0495653_0000271 Ga0495653_0000271_9207_10220 336
525 3300046472 Ga0495580_0011023 Ga0495580_0011023_2821_3834 336
526 3300046472 Ga0495580_0109690 Ga0495580_0109690_614_1687 336
527 3300046476 Ga0495662_0002568 Ga0495662_0002568_2361_3482 336
528 3300046477 Ga0495664_0118044 Ga0495664_0118044_112_1245 336
529 3300046499 Ga0495594_0003439 Ga0495594_0003439_402_1454 336
530 3300046500 Ga0495596_0039657 Ga0495596_0039657_737_1813 336
531 3300046511 Ga0495608_0000232 Ga0495608_0000232_24887_25900 336
532 3300046516 Ga0495628_0000358 Ga0495628_0000358_31765_32778 336
533 3300046516 Ga0495628_0011653 Ga0495628_0011653_3130_4179 336
534 3300046516 Ga0495628_0032366 Ga0495628_0032366_741_1862 336
535 3300046516 Ga0495628_0116706 Ga0495628_0116706_574_1707 336
536 3300046517 Ga0495630_0036356 Ga0495630_0036356_2318_3439 336
537 3300046517 Ga0495630_0056829 Ga0495630_0056829_1333_2346 336
538 3300046529 Ga0495652_0004164 Ga0495652_0004164_6470_7483 336
539 3300046531 Ga0495665_0022579 Ga0495665_0022579_1206_2279 336
540 3300046533 Ga0495640_0044853 Ga0495640_0044853_1030_2151 336
541 3300046535 Ga0495586_0014366 Ga0495586_0014366_2376_3497 336
542 3300046536 Ga0495587_0000229 Ga0495587_0000229_31702_32715 336
543 3300046536 Ga0495587_0003098 Ga0495587_0003098_480_1529 336
544 3300046536 Ga0495587_0094779 Ga0495587_0094779_468_1589 336
545 3300046543 Ga0495645_0000066 Ga0495645_0000066_11746_12795 336
546 3300046543 Ga0495645_0158314 Ga0495645_0158314_423_1556 336
547 3300046559 Ga0495667_0055974 Ga0495667_0055974_852_1865 336
548 3300046642 Ga0495634_0027875 Ga0495634_0027875_757_1878 336
549 3300046663 Ga0495635_0000260 Ga0495635_0000260_31762_32775 336
550 3300046663 Ga0495635_0021470 Ga0495635_0021470_1666_2799 336
551 3300046674 Ga0495588_0003711 Ga0495588_0003711_3072_4130 336
552 3300046675 Ga0495657_0000794 Ga0495657_0000794_8795_9808 336
553 3300046675 Ga0495657_0112076 Ga0495657_0112076_35_1156 336
554 3300046678 Ga0495599_0000280 Ga0495599_0000280_28999_30012 336
555 3300046678 Ga0495599_0037141 Ga0495599_0037141_781_1830 336
556 3300046678 Ga0495599_0149234 Ga0495599_0149234_304_1377 336
557 3300046679 Ga0495623_0000151 Ga0495623_0000151_10096_11109 336
558 3300046679 Ga0495623_0007045 Ga0495623_0007045_3851_4900 336
559 3300046679 Ga0495623_0083187 Ga0495623_0083187_570_1691 336
560 3300046680 Ga0495646_0000547 Ga0495646_0000547_4144_5157 336
561 3300046680 Ga0495646_0065257 Ga0495646_0065257_379_1500 336
562 3300046689 Ga0495613_0107300 Ga0495613_0107300_393_1514 336
563 3300046689 Ga0495613_0120525 Ga0495613_0120525_134_1267 336
564 3300046809 Ga0495600_0000207 Ga0495600_0000207_24927_25940 336
565 3300047317 Ga0495604_0000633 Ga0495604_0000633_10755_11768 336
566 3300047319 Ga0495674_0042232 Ga0495674_0042232_2632_3753 336
567 3300047319 Ga0495674_0062955 Ga0495674_0062955_657_1790 336
568 3300047322 Ga0495680_0041861 Ga0495680_0041861_669_1802 336
569 3300047322 Ga0495680_0047098 Ga0495680_0047098_1095_2108 336
570 3300047322 Ga0495680_0152975 Ga0495680_0152975_320_1441 336
571 3300047444 Ga0495675_0001467 Ga0495675_0001467_8545_9558 336
572 3300047444 Ga0495675_0007513 Ga0495675_0007513_4115_5164 336
573 3300047447 Ga0495685_049190 Ga0495685_049190_54_1130 336
574 3300047471 Ga0495684_0000428 Ga0495684_0000428_1486_2499 336
575 3300047471 Ga0495684_0023109 Ga0495684_0023109_2314_3327 336
576 3300048088 Ga0495602_0000545 Ga0495602_0000545_31825_32838 336
577 3300048907 Ga0496104_0220651 Ga0496104_0220651_297_1310 336
578 3300048908 Ga0496105_0152252 Ga0496105_0152252_303_1355 336
579 3300048911 Ga0496108_0103884 Ga0496108_0103884_597_1658 336
580 3300048915 Ga0496112_0000846 Ga0496112_0000846_228_1316 336
581 3300048918 Ga0496115_0017289 Ga0496115_0017289_2137_3165 336
582 3300049592 Ga0501076_0121273 Ga0501076_0121273_627_1802 336
583 3300049742 Ga0501080_0251639 Ga0501080_0251639_335_1510 336
584 3300050507 nmdc:mga05p37_24424_c1 nmdc:mga05p37_24424_c1_1526_2587 336
585 3300050508 nmdc:mga09592_72317_c1 nmdc:mga09592_72317_c1_348_1409 336
586 3300050509 nmdc:mga0qj67_112725_c1 nmdc:mga0qj67_112725_c1_199_1332 336
587 3300050509 nmdc:mga0qj67_1382_c1 nmdc:mga0qj67_1382_c1_2081_3211 336
588 3300050509 nmdc:mga0qj67_84077_c1 nmdc:mga0qj67_84077_c1_696_1904 336
589 3300050510 nmdc:mga06r32_49191_c1 nmdc:mga06r32_49191_c1_455_1663 336
590 3300050511 nmdc:mga08y16_70444_c1 nmdc:mga08y16_70444_c1_1266_2327 336
591 3300050512 nmdc:mga0n895_6143_c1 nmdc:mga0n895_6143_c1_69_1130 336
592 3300050513 nmdc:mga0rr50_172416_c1 nmdc:mga0rr50_172416_c1_625_1638 336
593 3300050513 nmdc:mga0rr50_45706_c1 nmdc:mga0rr50_45706_c1_206_1264 336
594 3300050515 nmdc:mga0a205_1390_c1 nmdc:mga0a205_1390_c1_6305_7366 336
595 3300053077 Ga0495601_0056482 Ga0495601_0056482_250_1263 336
596 3300053078 Ga0495612_0000937 Ga0495612_0000937_1756_2769 336
597 3300053085 Ga0495619_0010425 Ga0495619_0010425_716_1729 336

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sqc-assembly3.cif.gz_C squalene-hopene cyclase 0.5029 23 222
6o60-assembly1.cif.gz_B crystal structure of ggtase3-fbxl2-skp1 complex 0.4927 23 224
3c72-assembly1.cif.gz_B engineered rabggtase in complex with a peptidomimetic inhibitor 0.4844 23 257
1gxo-assembly1.cif.gz_A mutant d189a of family 10 polysaccharide lyase from cellvibrio cellulosa in complex with trigalaturonic acid 0.4457 20 204
8enu-assembly1.cif.gz_H structure of the c3bb proconvertase in complex with lufaxin 0.4422 58 321
ID Description Score Start End Superfamily
af_A0A1D6LG90_353_536_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.5608 25 196 1.50.10.20
af_Q4DDP3_167_393_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.5156 58 209 2.60.40.1230
af_Q9URV2_1077_1221_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5074 59 191 1.25.10.10
1h35A01 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.4749 24 332 1.50.10.20
af_A0A1D6LG90_353_536_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.4595 25 196 1.50.10.20
ID Description Score Start End GO Terms
AF-A0A2V7RYQ0-F1-model_v4 Uncharacterized protein 0.9785 153 336
AF-A0A2V7RYQ0-F1-model_v4 Uncharacterized protein 0.9733 153 336
AF-A0A2V7SZ84-F1-model_v4 Uncharacterized protein 0.973 42 336
AF-A0A7Y5QND2-F1-model_v4 Uncharacterized protein 0.9695 21 336
AF-A0A2V7EFG4-F1-model_v4 Uncharacterized protein 0.9692 100 336

Feature Viewer

pLDDT pTM Quality
89.24 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map