F467648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 597 | 267 | 597 | 358 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10132952|Ga0070717_101329522 |
| Length | 412 |
| Sequence | MLSRPQQGGFLVLRRNLSSYRTLEHLASAPVTLPPPSTTATPPIAPLPAPAILAPVRFPLSWLLEHASAPIRYRAMTEVARLPSQSADRLSFLPFTHRAALMLAMLQSTDGTWNHSMLTVPAVRAEHFEGVGTISAVRRLLEYGWDRETPPLLLARRILFRLLAEDEDPEWLFEFGAKGPADEDAARRGRAILREAAAAALAQAGYEGDPRLRGAAKRIIERVVGYLRSPLAQKPFVRVGNQHVLAAEAAPPSMFALLMLAYMPLFRTEHHDAMDRLYQHLAQPLPRQEPVQLCGQKVMAQPHLVLGDLLANRNVADADVPFAMMWLELVARLGFMRRNENWSKLFDRFLDDRDQDGVWHPHKGMTVARSANPIVWPFYPLEENLSGDERWADVTFRLGLIARVIGRTIEIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 184 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 235 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 236 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 237 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 238 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 242 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 244 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 245 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 250 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 252 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.17 |
| Rhizosphere | 98.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_10279081 | 2162886012 | Unclassified | 1590 |
| 2 | Ga0065712_10107274 | 3300005290 | Bacteria | 1899 |
| 3 | Ga0065715_10092603 | 3300005293 | Bacteria | 5031 |
| 4 | Ga0065715_10132560 | 3300005293 | Unclassified | 1988 |
| 5 | Ga0065707_10086002 | 3300005295 | Bacteria | 5725 |
| 6 | Ga0070658_10004216 | 3300005327 | Bacteria | 11768 |
| 7 | Ga0070658_10047772 | 3300005327 | Bacteria | 3463 |
| 8 | Ga0070658_10111999 | 3300005327 | Bacteria | 2262 |
| 9 | Ga0070676_10037765 | 3300005328 | Unclassified | 2786 |
| 10 | Ga0070676_10067316 | 3300005328 | Bacteria | 2141 |
| 11 | Ga0070683_100001402 | 3300005329 | Bacteria | 18509 |
| 12 | Ga0070683_100005334 | 3300005329 | Bacteria | 10718 |
| 13 | Ga0070683_100058907 | 3300005329 | Bacteria | 3568 |
| 14 | Ga0070683_100073623 | 3300005329 | Bacteria | 3190 |
| 15 | Ga0070683_100091202 | 3300005329 | Bacteria | 2861 |
| 16 | Ga0070683_100137009 | 3300005329 | Bacteria | 2318 |
| 17 | Ga0070690_100031738 | 3300005330 | Unclassified | 3293 |
| 18 | Ga0070670_100005229 | 3300005331 | Bacteria | 10927 |
| 19 | Ga0070670_100012450 | 3300005331 | Bacteria | 7279 |
| 20 | Ga0070670_100024335 | 3300005331 | Bacteria | 5207 |
| 21 | Ga0070670_100028999 | 3300005331 | Bacteria | 4763 |
| 22 | Ga0070670_100057976 | 3300005331 | Unclassified | 3324 |
| 23 | Ga0068869_100001049 | 3300005334 | Bacteria | 16102 |
| 24 | Ga0068869_100027103 | 3300005334 | Bacteria | 3993 |
| 25 | Ga0070666_10031908 | 3300005335 | Bacteria | 3479 |
| 26 | Ga0070666_10092775 | 3300005335 | Bacteria | 2076 |
| 27 | Ga0070680_100000211 | 3300005336 | Bacteria | 38342 |
| 28 | Ga0070680_100002193 | 3300005336 | Bacteria | 14397 |
| 29 | Ga0070680_100002464 | 3300005336 | Bacteria | 13711 |
| 30 | Ga0070680_100002688 | 3300005336 | Bacteria | 13181 |
| 31 | Ga0070680_100011383 | 3300005336 | Bacteria | 6879 |
| 32 | Ga0070680_100036579 | 3300005336 | Bacteria | 3966 |
| 33 | Ga0070680_100095170 | 3300005336 | Unclassified | 2468 |
| 34 | Ga0070680_100168995 | 3300005336 | Bacteria | 1839 |
| 35 | Ga0070680_100188902 | 3300005336 | Bacteria | 1736 |
| 36 | Ga0070682_100000790 | 3300005337 | Bacteria | 18593 |
| 37 | Ga0070682_100001451 | 3300005337 | Bacteria | 13334 |
| 38 | Ga0070682_100010720 | 3300005337 | Bacteria | 5212 |
| 39 | Ga0070682_100016215 | 3300005337 | Bacteria | 4329 |
| 40 | Ga0068868_100265507 | 3300005338 | Bacteria | 1449 |
| 41 | Ga0070660_100006624 | 3300005339 | Bacteria | 8037 |
| 42 | Ga0070660_100077782 | 3300005339 | Bacteria | 2600 |
| 43 | Ga0070689_100022167 | 3300005340 | Bacteria | 4739 |
| 44 | Ga0070689_100184804 | 3300005340 | Bacteria | 1695 |
| 45 | Ga0070687_100001962 | 3300005343 | Bacteria | 7523 |
| 46 | Ga0070687_100013033 | 3300005343 | Bacteria | 3692 |
| 47 | Ga0070661_100000965 | 3300005344 | Bacteria | 20487 |
| 48 | Ga0070661_100004675 | 3300005344 | Bacteria | 9429 |
| 49 | Ga0070661_100004701 | 3300005344 | Bacteria | 9400 |
| 50 | Ga0070661_100033959 | 3300005344 | Unclassified | 3698 |
| 51 | Ga0070661_100049438 | 3300005344 | Bacteria | 3078 |
| 52 | Ga0070661_100140097 | 3300005344 | Bacteria | 1822 |
| 53 | Ga0070661_100141228 | 3300005344 | Bacteria | 1815 |
| 54 | Ga0070692_10003678 | 3300005345 | Bacteria | 6275 |
| 55 | Ga0070692_10020119 | 3300005345 | Bacteria | 3232 |
| 56 | Ga0070668_100159543 | 3300005347 | Bacteria | 1829 |
| 57 | Ga0070669_100002801 | 3300005353 | Bacteria | 12586 |
| 58 | Ga0070669_100012282 | 3300005353 | Bacteria | 6077 |
| 59 | Ga0070669_100120633 | 3300005353 | Bacteria | 2000 |
| 60 | Ga0070675_100001287 | 3300005354 | Bacteria | 18342 |
| 61 | Ga0070675_100011812 | 3300005354 | Bacteria | 6843 |
| 62 | Ga0070675_100038842 | 3300005354 | Bacteria | 3882 |
| 63 | Ga0070675_100042358 | 3300005354 | Bacteria | 3720 |
| 64 | Ga0070675_100258840 | 3300005354 | Bacteria | 1524 |
| 65 | Ga0070671_100024347 | 3300005355 | Unclassified | 4955 |
| 66 | Ga0070671_100050572 | 3300005355 | Bacteria | 3456 |
| 67 | Ga0070674_100245600 | 3300005356 | Unclassified | 1404 |
| 68 | Ga0070673_100076469 | 3300005364 | Bacteria | 2703 |
| 69 | Ga0070673_100129174 | 3300005364 | Bacteria | 2118 |
| 70 | Ga0070673_100295373 | 3300005364 | Bacteria | 1425 |
| 71 | Ga0070688_100005871 | 3300005365 | Bacteria | 6496 |
| 72 | Ga0070659_100003646 | 3300005366 | Bacteria | 10969 |
| 73 | Ga0070659_100004835 | 3300005366 | Bacteria | 9622 |
| 74 | Ga0070659_100013565 | 3300005366 | Bacteria | 6069 |
| 75 | Ga0070659_100022685 | 3300005366 | Bacteria | 4794 |
| 76 | Ga0070659_100335729 | 3300005366 | Unclassified | 1266 |
| 77 | Ga0070667_100008417 | 3300005367 | Bacteria | 8557 |
| 78 | Ga0070667_100067093 | 3300005367 | Unclassified | 3049 |
| 79 | Ga0070703_10013658 | 3300005406 | Bacteria | 2308 |
| 80 | Ga0070714_100012956 | 3300005435 | Bacteria | 6669 |
| 81 | Ga0070714_100077656 | 3300005435 | Bacteria | 2884 |
| 82 | Ga0070711_100172282 | 3300005439 | Bacteria | 1650 |
| 83 | Ga0070708_100000849 | 3300005445 | Bacteria | 22993 |
| 84 | Ga0070708_100018454 | 3300005445 | Bacteria | 5839 |
| 85 | Ga0070663_100076849 | 3300005455 | Bacteria | 2443 |
| 86 | Ga0070662_100000424 | 3300005457 | Bacteria | 25043 |
| 87 | Ga0070662_100042621 | 3300005457 | Bacteria | 3242 |
| 88 | Ga0070662_100178612 | 3300005457 | Bacteria | 1672 |
| 89 | Ga0070681_10002407 | 3300005458 | Bacteria | 17106 |
| 90 | Ga0070681_10005269 | 3300005458 | Bacteria | 12487 |
| 91 | Ga0070681_10005393 | 3300005458 | Bacteria | 12347 |
| 92 | Ga0070681_10008249 | 3300005458 | Bacteria | 10193 |
| 93 | Ga0070681_10023997 | 3300005458 | Bacteria | 6140 |
| 94 | Ga0070681_10321787 | 3300005458 | Bacteria | 1456 |
| 95 | Ga0068867_100014698 | 3300005459 | Bacteria | 5547 |
| 96 | Ga0070685_10022157 | 3300005466 | Bacteria | 3459 |
| 97 | Ga0070685_10040313 | 3300005466 | Bacteria | 2657 |
| 98 | Ga0070685_10135584 | 3300005466 | Unclassified | 1544 |
| 99 | Ga0070706_100035147 | 3300005467 | Bacteria | 4627 |
| 100 | Ga0070706_100092829 | 3300005467 | Bacteria | 2800 |
| 101 | Ga0070707_100002115 | 3300005468 | Bacteria | 19017 |
| 102 | Ga0070707_100095400 | 3300005468 | Bacteria | 2881 |
| 103 | Ga0070707_100109433 | 3300005468 | Unclassified | 2680 |
| 104 | Ga0070707_100122482 | 3300005468 | Bacteria | 2525 |
| 105 | Ga0070707_100203054 | 3300005468 | Bacteria | 1932 |
| 106 | Ga0070698_100015754 | 3300005471 | Bacteria | 7985 |
| 107 | Ga0070698_100023353 | 3300005471 | Bacteria | 6464 |
| 108 | Ga0070699_100016562 | 3300005518 | Bacteria | 6327 |
| 109 | Ga0070699_100020754 | 3300005518 | Bacteria | 5666 |
| 110 | Ga0070679_100000085 | 3300005530 | Bacteria | 70740 |
| 111 | Ga0070679_100000355 | 3300005530 | Bacteria | 39034 |
| 112 | Ga0070679_100002038 | 3300005530 | Bacteria | 18142 |
| 113 | Ga0070679_100002972 | 3300005530 | Bacteria | 15467 |
| 114 | Ga0070679_100003613 | 3300005530 | Bacteria | 14133 |
| 115 | Ga0070679_100004960 | 3300005530 | Bacteria | 12285 |
| 116 | Ga0070679_100032603 | 3300005530 | Bacteria | 5154 |
| 117 | Ga0070679_100035763 | 3300005530 | Bacteria | 4927 |
| 118 | Ga0070679_100155728 | 3300005530 | Bacteria | 2260 |
| 119 | Ga0070684_100001085 | 3300005535 | Bacteria | 19504 |
| 120 | Ga0070684_100002564 | 3300005535 | Bacteria | 13418 |
| 121 | Ga0070684_100007288 | 3300005535 | Bacteria | 8599 |
| 122 | Ga0070684_100010548 | 3300005535 | Bacteria | 7325 |
| 123 | Ga0070684_100025041 | 3300005535 | Bacteria | 5011 |
| 124 | Ga0070684_100098467 | 3300005535 | Bacteria | 2609 |
| 125 | Ga0070684_100142985 | 3300005535 | Bacteria | 2164 |
| 126 | Ga0070684_100162472 | 3300005535 | Bacteria | 2027 |
| 127 | Ga0070697_100097679 | 3300005536 | Bacteria | 2437 |
| 128 | Ga0068853_100038666 | 3300005539 | Bacteria | 4065 |
| 129 | Ga0068853_100051795 | 3300005539 | Unclassified | 3534 |
| 130 | Ga0068853_100130969 | 3300005539 | Bacteria | 2245 |
| 131 | Ga0070672_100014501 | 3300005543 | Bacteria | 5587 |
| 132 | Ga0070672_100185686 | 3300005543 | Unclassified | 1734 |
| 133 | Ga0070695_100008476 | 3300005545 | Bacteria | 6100 |
| 134 | Ga0070695_100090258 | 3300005545 | Bacteria | 2044 |
| 135 | Ga0070696_100004808 | 3300005546 | Bacteria | 9029 |
| 136 | Ga0068855_100001420 | 3300005563 | Bacteria | 29751 |
| 137 | Ga0068855_100007089 | 3300005563 | Bacteria | 13596 |
| 138 | Ga0068855_100026460 | 3300005563 | Bacteria | 6939 |
| 139 | Ga0068855_100034889 | 3300005563 | Bacteria | 5995 |
| 140 | Ga0068855_100048604 | 3300005563 | Bacteria | 5006 |
| 141 | Ga0068855_100216579 | 3300005563 | Bacteria | 2149 |
| 142 | Ga0070664_100000313 | 3300005564 | Bacteria | 35339 |
| 143 | Ga0070664_100002171 | 3300005564 | Bacteria | 15749 |
| 144 | Ga0070664_100005882 | 3300005564 | Bacteria | 9903 |
| 145 | Ga0070664_100028013 | 3300005564 | Bacteria | 4685 |
| 146 | Ga0070664_100040470 | 3300005564 | Unclassified | 3929 |
| 147 | Ga0070664_100058501 | 3300005564 | Bacteria | 3278 |
| 148 | Ga0070664_100073209 | 3300005564 | Unclassified | 2939 |
| 149 | Ga0070664_100210528 | 3300005564 | Unclassified | 1737 |
| 150 | Ga0068857_100000179 | 3300005577 | Bacteria | 40362 |
| 151 | Ga0068857_100000495 | 3300005577 | Bacteria | 28278 |
| 152 | Ga0068857_100008030 | 3300005577 | Bacteria | 9102 |
| 153 | Ga0068857_100011370 | 3300005577 | Bacteria | 7743 |
| 154 | Ga0068857_100039204 | 3300005577 | Bacteria | 4195 |
| 155 | Ga0068857_100064552 | 3300005577 | Bacteria | 3255 |
| 156 | Ga0068857_100249439 | 3300005577 | Bacteria | 1627 |
| 157 | Ga0068854_100009904 | 3300005578 | Bacteria | 6166 |
| 158 | Ga0068854_100056769 | 3300005578 | Bacteria | 2823 |
| 159 | Ga0068854_100120090 | 3300005578 | Bacteria | 1994 |
| 160 | Ga0068856_100003777 | 3300005614 | Bacteria | 15169 |
| 161 | Ga0070702_100018912 | 3300005615 | Bacteria | 3581 |
| 162 | Ga0068852_100020098 | 3300005616 | Bacteria | 5304 |
| 163 | Ga0068852_100022032 | 3300005616 | Bacteria | 5100 |
| 164 | Ga0068852_100025845 | 3300005616 | Bacteria | 4764 |
| 165 | Ga0068852_100167219 | 3300005616 | Unclassified | 2058 |
| 166 | Ga0068859_100021114 | 3300005617 | Bacteria | 6534 |
| 167 | Ga0068859_100069586 | 3300005617 | Bacteria | 3554 |
| 168 | Ga0068864_100008261 | 3300005618 | Bacteria | 8586 |
| 169 | Ga0068864_100014535 | 3300005618 | Bacteria | 6540 |
| 170 | Ga0068866_10004619 | 3300005718 | Bacteria | 5646 |
| 171 | Ga0068861_100007253 | 3300005719 | Bacteria | 7597 |
| 172 | Ga0068851_10029991 | 3300005834 | Bacteria | 2695 |
| 173 | Ga0068870_10031641 | 3300005840 | Unclassified | 2682 |
| 174 | Ga0068863_100079094 | 3300005841 | Bacteria | 3114 |
| 175 | Ga0068863_100128028 | 3300005841 | Bacteria | 2423 |
| 176 | Ga0068858_100027021 | 3300005842 | Bacteria | 5330 |
| 177 | Ga0068858_100050059 | 3300005842 | Unclassified | 3867 |
| 178 | Ga0068860_100012629 | 3300005843 | Bacteria | 8311 |
| 179 | Ga0068860_100037303 | 3300005843 | Bacteria | 4653 |
| 180 | Ga0068862_100037198 | 3300005844 | Bacteria | 4125 |
| 181 | Ga0070717_10132952 | 3300006028 | Unclassified | 2141 |
| 182 | Ga0070716_100093868 | 3300006173 | Bacteria | 1822 |
| 183 | Ga0070712_100218371 | 3300006175 | Bacteria | 1508 |
| 184 | Ga0068871_100034443 | 3300006358 | Bacteria | 4018 |
| 185 | Ga0068871_100193081 | 3300006358 | Bacteria | 1755 |
| 186 | Ga0075428_100393821 | 3300006844 | Bacteria | 1485 |
| 187 | Ga0075430_100002736 | 3300006846 | Bacteria | 14720 |
| 188 | Ga0075430_100009941 | 3300006846 | Bacteria | 8046 |
| 189 | Ga0075430_100056995 | 3300006846 | Bacteria | 3286 |
| 190 | Ga0075430_100193614 | 3300006846 | Bacteria | 1689 |
| 191 | Ga0075431_100055741 | 3300006847 | Bacteria | 4078 |
| 192 | Ga0075431_100330921 | 3300006847 | Unclassified | 1534 |
| 193 | Ga0075433_10021167 | 3300006852 | Bacteria | 5450 |
| 194 | Ga0075434_100017657 | 3300006871 | Bacteria | 6877 |
| 195 | Ga0068865_100019525 | 3300006881 | Bacteria | 4386 |
| 196 | Ga0068865_100213199 | 3300006881 | Unclassified | 1506 |
| 197 | Ga0075436_100009980 | 3300006914 | Bacteria | 6496 |
| 198 | Ga0075436_100016778 | 3300006914 | Bacteria | 5013 |
| 199 | Ga0075436_100021637 | 3300006914 | Bacteria | 4414 |
| 200 | Ga0097620_100021115 | 3300006931 | Bacteria | 6534 |
| 201 | Ga0097620_100069590 | 3300006931 | Bacteria | 3554 |
| 202 | Ga0075435_100008656 | 3300007076 | Bacteria | 7316 |
| 203 | Ga0099795_10003411 | 3300007788 | Bacteria | 3928 |
| 204 | Ga0105240_10124670 | 3300009093 | Bacteria | 3097 |
| 205 | Ga0105240_10152084 | 3300009093 | Unclassified | 2755 |
| 206 | Ga0105240_10275034 | 3300009093 | Bacteria | 1937 |
| 207 | Ga0111539_10036945 | 3300009094 | Bacteria | 5902 |
| 208 | Ga0105245_10024020 | 3300009098 | Bacteria | 5351 |
| 209 | Ga0105245_10042292 | 3300009098 | Bacteria | 4065 |
| 210 | Ga0105245_10048195 | 3300009098 | Bacteria | 3811 |
| 211 | Ga0105245_10062529 | 3300009098 | Bacteria | 3359 |
| 212 | Ga0114129_10012586 | 3300009147 | Bacteria | 12048 |
| 213 | Ga0105241_10057235 | 3300009174 | Unclassified | 2990 |
| 214 | Ga0105241_10071396 | 3300009174 | Unclassified | 2695 |
| 215 | Ga0105241_10183727 | 3300009174 | Bacteria | 1736 |
| 216 | Ga0105242_10040329 | 3300009176 | Bacteria | 3763 |
| 217 | Ga0105248_10011861 | 3300009177 | Bacteria | 9615 |
| 218 | Ga0105248_10019314 | 3300009177 | Bacteria | 7541 |
| 219 | Ga0105248_10026436 | 3300009177 | Bacteria | 6457 |
| 220 | Ga0105248_10153149 | 3300009177 | Bacteria | 2601 |
| 221 | Ga0105248_10261374 | 3300009177 | Unclassified | 1949 |
| 222 | Ga0105237_10046545 | 3300009545 | Bacteria | 4363 |
| 223 | Ga0105237_10121199 | 3300009545 | Unclassified | 2610 |
| 224 | Ga0105238_10061051 | 3300009551 | Bacteria | 3773 |
| 225 | Ga0105238_10068486 | 3300009551 | Bacteria | 3550 |
| 226 | Ga0105238_10149251 | 3300009551 | Bacteria | 2313 |
| 227 | Ga0105238_10278908 | 3300009551 | Bacteria | 1652 |
| 228 | Ga0105249_10006039 | 3300009553 | Bacteria | 10494 |
| 229 | Ga0105249_10060953 | 3300009553 | Bacteria | 3462 |
| 230 | Ga0105249_10133713 | 3300009553 | Bacteria | 2371 |
| 231 | Ga0099796_10001176 | 3300010159 | Bacteria | 5079 |
| 232 | Ga0105239_10053701 | 3300010375 | Bacteria | 4419 |
| 233 | Ga0105246_10001757 | 3300011119 | Bacteria | 12961 |
| 234 | Ga0157373_10037965 | 3300013100 | Bacteria | 3451 |
| 235 | Ga0157373_10117608 | 3300013100 | Bacteria | 1868 |
| 236 | Ga0157371_10011933 | 3300013102 | Bacteria | 6663 |
| 237 | Ga0157371_10133390 | 3300013102 | Bacteria | 1767 |
| 238 | Ga0157370_10131534 | 3300013104 | Unclassified | 2334 |
| 239 | Ga0157370_10205822 | 3300013104 | Unclassified | 1824 |
| 240 | Ga0157369_10021605 | 3300013105 | Bacteria | 7197 |
| 241 | Ga0157369_10109205 | 3300013105 | Bacteria | 2941 |
| 242 | Ga0157369_10154431 | 3300013105 | Bacteria | 2425 |
| 243 | Ga0157369_10238699 | 3300013105 | Bacteria | 1899 |
| 244 | Ga0157369_10302341 | 3300013105 | Bacteria | 1664 |
| 245 | Ga0157369_10314072 | 3300013105 | Bacteria | 1629 |
| 246 | Ga0157374_10024538 | 3300013296 | Bacteria | 5407 |
| 247 | Ga0157374_10032088 | 3300013296 | Unclassified | 4780 |
| 248 | Ga0157374_10075153 | 3300013296 | Bacteria | 3193 |
| 249 | Ga0157374_10216611 | 3300013296 | Bacteria | 1878 |
| 250 | Ga0157378_10002336 | 3300013297 | Bacteria | 16841 |
| 251 | Ga0157378_10023731 | 3300013297 | Bacteria | 5395 |
| 252 | Ga0157378_10099905 | 3300013297 | Bacteria | 2648 |
| 253 | Ga0157378_10139188 | 3300013297 | Bacteria | 2253 |
| 254 | Ga0157378_10163930 | 3300013297 | Bacteria | 2080 |
| 255 | Ga0163162_10002048 | 3300013306 | Bacteria | 18939 |
| 256 | Ga0157372_10003799 | 3300013307 | Bacteria | 16216 |
| 257 | Ga0157372_10021660 | 3300013307 | Bacteria | 6948 |
| 258 | Ga0157372_10025111 | 3300013307 | Bacteria | 6476 |
| 259 | Ga0157372_10036633 | 3300013307 | Bacteria | 5408 |
| 260 | Ga0157372_10038903 | 3300013307 | Bacteria | 5249 |
| 261 | Ga0157372_10047871 | 3300013307 | Bacteria | 4752 |
| 262 | Ga0157372_10134245 | 3300013307 | Bacteria | 2849 |
| 263 | Ga0157372_10168563 | 3300013307 | Bacteria | 2533 |
| 264 | Ga0157372_10203259 | 3300013307 | Bacteria | 2295 |
| 265 | Ga0157372_10269240 | 3300013307 | Unclassified | 1979 |
| 266 | Ga0157375_10005804 | 3300013308 | Bacteria | 10743 |
| 267 | Ga0157375_10008124 | 3300013308 | Bacteria | 9183 |
| 268 | Ga0157375_10162236 | 3300013308 | Unclassified | 2378 |
| 269 | Ga0163163_10002127 | 3300014325 | Bacteria | 16729 |
| 270 | Ga0163163_10073490 | 3300014325 | Bacteria | 3410 |
| 271 | Ga0163163_10150316 | 3300014325 | Bacteria | 2373 |
| 272 | Ga0163163_10385663 | 3300014325 | Bacteria | 1459 |
| 273 | Ga0157377_10011964 | 3300014745 | Bacteria | 4350 |
| 274 | Ga0157377_10193262 | 3300014745 | Bacteria | 1287 |
| 275 | Ga0157379_10007606 | 3300014968 | Bacteria | 9379 |
| 276 | Ga0182007_10015980 | 3300015262 | Bacteria | 2781 |
| 277 | Ga0163161_10012618 | 3300017792 | Bacteria | 5871 |
| 278 | Ga0206353_11062776 | 3300020082 | Bacteria | 1588 |
| 279 | Ga0207697_10005401 | 3300025315 | Bacteria | 5942 |
| 280 | Ga0207642_10043498 | 3300025899 | Bacteria | 1981 |
| 281 | Ga0207645_10001996 | 3300025907 | Bacteria | 16406 |
| 282 | Ga0207645_10063986 | 3300025907 | Bacteria | 2350 |
| 283 | Ga0207645_10076616 | 3300025907 | Bacteria | 2142 |
| 284 | Ga0207643_10020267 | 3300025908 | Unclassified | 3649 |
| 285 | Ga0207705_10002919 | 3300025909 | Bacteria | 13064 |
| 286 | Ga0207705_10013095 | 3300025909 | Bacteria | 5985 |
| 287 | Ga0207654_10021822 | 3300025911 | Unclassified | 3410 |
| 288 | Ga0207707_10000303 | 3300025912 | Bacteria | 51777 |
| 289 | Ga0207707_10000872 | 3300025912 | Bacteria | 29454 |
| 290 | Ga0207707_10002037 | 3300025912 | Bacteria | 18342 |
| 291 | Ga0207707_10019607 | 3300025912 | Bacteria | 5902 |
| 292 | Ga0207707_10039036 | 3300025912 | Bacteria | 4150 |
| 293 | Ga0207707_10041828 | 3300025912 | Bacteria | 4001 |
| 294 | Ga0207707_10069981 | 3300025912 | Bacteria | 3058 |
| 295 | Ga0207695_10022331 | 3300025913 | Bacteria | 7187 |
| 296 | Ga0207695_10067295 | 3300025913 | Bacteria | 3675 |
| 297 | Ga0207695_10172476 | 3300025913 | Unclassified | 2088 |
| 298 | Ga0207671_10063170 | 3300025914 | Unclassified | 2751 |
| 299 | Ga0207671_10162167 | 3300025914 | Unclassified | 1732 |
| 300 | Ga0207693_10088255 | 3300025915 | Unclassified | 2431 |
| 301 | Ga0207660_10001634 | 3300025917 | Bacteria | 15030 |
| 302 | Ga0207660_10011842 | 3300025917 | Bacteria | 5687 |
| 303 | Ga0207660_10016634 | 3300025917 | Bacteria | 4873 |
| 304 | Ga0207660_10022288 | 3300025917 | Bacteria | 4267 |
| 305 | Ga0207662_10001793 | 3300025918 | Bacteria | 10538 |
| 306 | Ga0207662_10003880 | 3300025918 | Bacteria | 7782 |
| 307 | Ga0207657_10013223 | 3300025919 | Bacteria | 8100 |
| 308 | Ga0207657_10043399 | 3300025919 | Bacteria | 3961 |
| 309 | Ga0207657_10046442 | 3300025919 | Bacteria | 3803 |
| 310 | Ga0207657_10062627 | 3300025919 | Bacteria | 3184 |
| 311 | Ga0207649_10002406 | 3300025920 | Bacteria | 10487 |
| 312 | Ga0207649_10011144 | 3300025920 | Bacteria | 4948 |
| 313 | Ga0207649_10036228 | 3300025920 | Bacteria | 2970 |
| 314 | Ga0207649_10042157 | 3300025920 | Unclassified | 2783 |
| 315 | Ga0207649_10059317 | 3300025920 | Bacteria | 2400 |
| 316 | Ga0207649_10071532 | 3300025920 | Bacteria | 2216 |
| 317 | Ga0207652_10000526 | 3300025921 | Bacteria | 38877 |
| 318 | Ga0207652_10002073 | 3300025921 | Bacteria | 17266 |
| 319 | Ga0207652_10002917 | 3300025921 | Bacteria | 14310 |
| 320 | Ga0207652_10005853 | 3300025921 | Bacteria | 9959 |
| 321 | Ga0207652_10034175 | 3300025921 | Bacteria | 4284 |
| 322 | Ga0207646_10048666 | 3300025922 | Unclassified | 3800 |
| 323 | Ga0207646_10123672 | 3300025922 | Bacteria | 2326 |
| 324 | Ga0207681_10012803 | 3300025923 | Bacteria | 5184 |
| 325 | Ga0207681_10013491 | 3300025923 | Bacteria | 5058 |
| 326 | Ga0207681_10033533 | 3300025923 | Bacteria | 3367 |
| 327 | Ga0207694_10062333 | 3300025924 | Bacteria | 2903 |
| 328 | Ga0207694_10087633 | 3300025924 | Unclassified | 2453 |
| 329 | Ga0207694_10215448 | 3300025924 | Bacteria | 1565 |
| 330 | Ga0207650_10004261 | 3300025925 | Bacteria | 9761 |
| 331 | Ga0207650_10012067 | 3300025925 | Bacteria | 5957 |
| 332 | Ga0207650_10057237 | 3300025925 | Bacteria | 2899 |
| 333 | Ga0207650_10058215 | 3300025925 | Bacteria | 2877 |
| 334 | Ga0207659_10022835 | 3300025926 | Bacteria | 4170 |
| 335 | Ga0207659_10039822 | 3300025926 | Unclassified | 3281 |
| 336 | Ga0207659_10060602 | 3300025926 | Bacteria | 2724 |
| 337 | Ga0207687_10075709 | 3300025927 | Bacteria | 2416 |
| 338 | Ga0207687_10107386 | 3300025927 | Bacteria | 2065 |
| 339 | Ga0207664_10001170 | 3300025929 | Bacteria | 17446 |
| 340 | Ga0207664_10026494 | 3300025929 | Bacteria | 4384 |
| 341 | Ga0207664_10156640 | 3300025929 | Bacteria | 1940 |
| 342 | Ga0207644_10136962 | 3300025931 | Unclassified | 1881 |
| 343 | Ga0207690_10024198 | 3300025932 | Bacteria | 3801 |
| 344 | Ga0207690_10024833 | 3300025932 | Bacteria | 3757 |
| 345 | Ga0207690_10025295 | 3300025932 | Bacteria | 3725 |
| 346 | Ga0207690_10130931 | 3300025932 | Unclassified | 1836 |
| 347 | Ga0207706_10000323 | 3300025933 | Bacteria | 51731 |
| 348 | Ga0207706_10016185 | 3300025933 | Bacteria | 6738 |
| 349 | Ga0207706_10021738 | 3300025933 | Bacteria | 5758 |
| 350 | Ga0207686_10081311 | 3300025934 | Bacteria | 2115 |
| 351 | Ga0207670_10079842 | 3300025936 | Bacteria | 2285 |
| 352 | Ga0207669_10032838 | 3300025937 | Bacteria | 2921 |
| 353 | Ga0207669_10215795 | 3300025937 | Unclassified | 1404 |
| 354 | Ga0207691_10003612 | 3300025940 | Bacteria | 15028 |
| 355 | Ga0207691_10004648 | 3300025940 | Bacteria | 13296 |
| 356 | Ga0207691_10057706 | 3300025940 | Unclassified | 3532 |
| 357 | Ga0207711_10015445 | 3300025941 | Bacteria | 6337 |
| 358 | Ga0207711_10258708 | 3300025941 | Bacteria | 1599 |
| 359 | Ga0207689_10001442 | 3300025942 | Bacteria | 22737 |
| 360 | Ga0207689_10019703 | 3300025942 | Bacteria | 5684 |
| 361 | Ga0207689_10051357 | 3300025942 | Bacteria | 3399 |
| 362 | Ga0207661_10000242 | 3300025944 | Bacteria | 35489 |
| 363 | Ga0207661_10000342 | 3300025944 | Bacteria | 29828 |
| 364 | Ga0207661_10004112 | 3300025944 | Bacteria | 10169 |
| 365 | Ga0207661_10034692 | 3300025944 | Bacteria | 3926 |
| 366 | Ga0207661_10065353 | 3300025944 | Bacteria | 2953 |
| 367 | Ga0207661_10148792 | 3300025944 | Bacteria | 2022 |
| 368 | Ga0207679_10000498 | 3300025945 | Bacteria | 27060 |
| 369 | Ga0207679_10001124 | 3300025945 | Bacteria | 17078 |
| 370 | Ga0207679_10008327 | 3300025945 | Bacteria | 6605 |
| 371 | Ga0207679_10009176 | 3300025945 | Bacteria | 6325 |
| 372 | Ga0207679_10018472 | 3300025945 | Unclassified | 4672 |
| 373 | Ga0207679_10067805 | 3300025945 | Bacteria | 2678 |
| 374 | Ga0207679_10147413 | 3300025945 | Unclassified | 1911 |
| 375 | Ga0207667_10103863 | 3300025949 | Bacteria | 2930 |
| 376 | Ga0207667_10122882 | 3300025949 | Bacteria | 2675 |
| 377 | Ga0207667_10123187 | 3300025949 | Unclassified | 2671 |
| 378 | Ga0207651_10049697 | 3300025960 | Unclassified | 2842 |
| 379 | Ga0207651_10093774 | 3300025960 | Bacteria | 2205 |
| 380 | Ga0207651_10255500 | 3300025960 | Unclassified | 1436 |
| 381 | Ga0207712_10002381 | 3300025961 | Bacteria | 12182 |
| 382 | Ga0207668_10012005 | 3300025972 | Bacteria | 5286 |
| 383 | Ga0207640_10017119 | 3300025981 | Bacteria | 4233 |
| 384 | Ga0207640_10083306 | 3300025981 | Bacteria | 2192 |
| 385 | Ga0207640_10104183 | 3300025981 | Bacteria | 1996 |
| 386 | Ga0207640_10169213 | 3300025981 | Bacteria | 1626 |
| 387 | Ga0207658_10055909 | 3300025986 | Bacteria | 2927 |
| 388 | Ga0207658_10183875 | 3300025986 | Bacteria | 1732 |
| 389 | Ga0207677_10037705 | 3300026023 | Bacteria | 3162 |
| 390 | Ga0207677_10086793 | 3300026023 | Bacteria | 2263 |
| 391 | Ga0207677_10100367 | 3300026023 | Bacteria | 2128 |
| 392 | Ga0207703_10070038 | 3300026035 | Bacteria | 2894 |
| 393 | Ga0207639_10086232 | 3300026041 | Unclassified | 2499 |
| 394 | Ga0207639_10241135 | 3300026041 | Bacteria | 1572 |
| 395 | Ga0207641_10054611 | 3300026088 | Bacteria | 3390 |
| 396 | Ga0207641_10089255 | 3300026088 | Bacteria | 2693 |
| 397 | Ga0207641_10161084 | 3300026088 | Bacteria | 2040 |
| 398 | Ga0207648_10008328 | 3300026089 | Bacteria | 10059 |
| 399 | Ga0207648_10018714 | 3300026089 | Bacteria | 6264 |
| 400 | Ga0207676_10020265 | 3300026095 | Bacteria | 4863 |
| 401 | Ga0207676_10029857 | 3300026095 | Bacteria | 4086 |
| 402 | Ga0207676_10037558 | 3300026095 | Bacteria | 3692 |
| 403 | Ga0207676_10175835 | 3300026095 | Unclassified | 1869 |
| 404 | Ga0207674_10000387 | 3300026116 | Bacteria | 57349 |
| 405 | Ga0207674_10000842 | 3300026116 | Bacteria | 39994 |
| 406 | Ga0207674_10001900 | 3300026116 | Bacteria | 26581 |
| 407 | Ga0207674_10003885 | 3300026116 | Bacteria | 18191 |
| 408 | Ga0207674_10019410 | 3300026116 | Bacteria | 7363 |
| 409 | Ga0207674_10090003 | 3300026116 | Bacteria | 3061 |
| 410 | Ga0207675_100000372 | 3300026118 | Bacteria | 43036 |
| 411 | Ga0207698_10088078 | 3300026142 | Unclassified | 2531 |
| 412 | Ga0207698_10162705 | 3300026142 | Unclassified | 1954 |
| 413 | Ga0207698_10184811 | 3300026142 | Unclassified | 1850 |
| 414 | Ga0209179_1003005 | 3300027512 | Bacteria | 2368 |
| 415 | Ga0209998_10001045 | 3300027717 | Bacteria | 6943 |
| 416 | Ga0268265_10021415 | 3300028380 | Bacteria | 4528 |
| 417 | Ga0268265_10065843 | 3300028380 | Bacteria | 2798 |
| 418 | Ga0268264_10017322 | 3300028381 | Bacteria | 5903 |
| 419 | Ga0268264_10095140 | 3300028381 | Bacteria | 2577 |
| 420 | Ga0307408_100213587 | 3300031548 | Bacteria | 1569 |
| 421 | Ga0307405_10010806 | 3300031731 | Bacteria | 4750 |
| 422 | Ga0307405_10103641 | 3300031731 | Bacteria | 1913 |
| 423 | Ga0307405_10131695 | 3300031731 | Bacteria | 1729 |
| 424 | Ga0307413_10082940 | 3300031824 | Bacteria | 2061 |
| 425 | Ga0307410_10001914 | 3300031852 | Bacteria | 9749 |
| 426 | Ga0307410_10075375 | 3300031852 | Bacteria | 2351 |
| 427 | Ga0307406_10014765 | 3300031901 | Bacteria | 4500 |
| 428 | Ga0307406_10061290 | 3300031901 | Bacteria | 2429 |
| 429 | Ga0307406_10062487 | 3300031901 | Unclassified | 2409 |
| 430 | Ga0307406_10077393 | 3300031901 | Bacteria | 2200 |
| 431 | Ga0307406_10084611 | 3300031901 | Bacteria | 2118 |
| 432 | Ga0307407_10000304 | 3300031903 | Bacteria | 14506 |
| 433 | Ga0307407_10030242 | 3300031903 | Bacteria | 2920 |
| 434 | Ga0307407_10055561 | 3300031903 | Bacteria | 2288 |
| 435 | Ga0307412_10002031 | 3300031911 | Bacteria | 11248 |
| 436 | Ga0307412_10004846 | 3300031911 | Bacteria | 7509 |
| 437 | Ga0307412_10011032 | 3300031911 | Bacteria | 5221 |
| 438 | Ga0307412_10046366 | 3300031911 | Bacteria | 2848 |
| 439 | Ga0307412_10049666 | 3300031911 | Bacteria | 2765 |
| 440 | Ga0307412_10099037 | 3300031911 | Unclassified | 2057 |
| 441 | Ga0307409_100001171 | 3300031995 | Bacteria | 12521 |
| 442 | Ga0307409_100012398 | 3300031995 | Bacteria | 5431 |
| 443 | Ga0307409_100098393 | 3300031995 | Bacteria | 2419 |
| 444 | Ga0307409_100128865 | 3300031995 | Bacteria | 2158 |
| 445 | Ga0307416_100008551 | 3300032002 | Bacteria | 6615 |
| 446 | Ga0307416_100029322 | 3300032002 | Bacteria | 4108 |
| 447 | Ga0307416_100030920 | 3300032002 | Bacteria | 4024 |
| 448 | Ga0307416_100069096 | 3300032002 | Bacteria | 2922 |
| 449 | Ga0307416_100164578 | 3300032002 | Bacteria | 2055 |
| 450 | Ga0307411_10000924 | 3300032005 | Bacteria | 11173 |
| 451 | Ga0307411_10022666 | 3300032005 | Bacteria | 3702 |
| 452 | Ga0307411_10037201 | 3300032005 | Unclassified | 3058 |
| 453 | Ga0307411_10060132 | 3300032005 | Bacteria | 2521 |
| 454 | Ga0307411_10116857 | 3300032005 | Bacteria | 1921 |
| 455 | Ga0307411_10169732 | 3300032005 | Bacteria | 1644 |
| 456 | Ga0307415_100002151 | 3300032126 | Bacteria | 9764 |
| 457 | Ga0307415_100019164 | 3300032126 | Bacteria | 4148 |
| 458 | Ga0307415_100077917 | 3300032126 | Unclassified | 2355 |
| 459 | Ga0307415_100213268 | 3300032126 | Bacteria | 1542 |
| 460 | Ga0373934_0000730 | 3300035086 | Bacteria | 11748 |
| 461 | Ga0373953_0000876 | 3300035117 | Bacteria | 8440 |
| 462 | Ga0373957_0031223 | 3300035120 | Unclassified | 1956 |
| 463 | Ga0373955_0001343 | 3300035172 | Bacteria | 10443 |
| 464 | Ga0373955_0040724 | 3300035172 | Bacteria | 2486 |
| 465 | Ga0373924_0064900 | 3300035410 | Unclassified | 1533 |
| 466 | Ga0373931_0003938 | 3300035691 | Bacteria | 6719 |
| 467 | Ga0373935_0022863 | 3300035692 | Bacteria | 3838 |
| 468 | Ga0373927_0046018 | 3300035695 | Unclassified | 2824 |
| 469 | Ga0373927_0102956 | 3300035695 | Bacteria | 1857 |
| 470 | Ga0373927_0120722 | 3300035695 | Unclassified | 1710 |
| 471 | Ga0373933_0000183 | 3300035724 | Bacteria | 41364 |
| 472 | Ga0373933_0028129 | 3300035724 | Unclassified | 3241 |
| 473 | Ga0373937_0000101 | 3300036401 | Bacteria | 81054 |
| 474 | Ga0373937_0000533 | 3300036401 | Bacteria | 34025 |
| 475 | Ga0373925_0097537 | 3300037068 | Bacteria | 2254 |
| 476 | Ga0436364_0274025 | 3300037853 | Bacteria | 1474 |
| 477 | Ga0439446_0052595 | 3300042156 | Bacteria | 1219 |
| 478 | Ga0451577_0025189 | 3300042876 | Bacteria | 5399 |
| 479 | Ga0451577_0131919 | 3300042876 | Unclassified | 2242 |
| 480 | Ga0453684_0039668 | 3300044712 | Bacteria | 6410 |
| 481 | Ga0466967_0036446 | 3300045976 | Bacteria | 4199 |
| 482 | Ga0495592_0128939 | 3300046454 | Unclassified | 1771 |
| 483 | Ga0495629_0015420 | 3300046459 | Bacteria | 5488 |
| 484 | Ga0495629_0085993 | 3300046459 | Bacteria | 2194 |
| 485 | Ga0495651_0000911 | 3300046462 | Bacteria | 22936 |
| 486 | Ga0495651_0078262 | 3300046462 | Bacteria | 2501 |
| 487 | Ga0495653_0000271 | 3300046463 | Bacteria | 41959 |
| 488 | Ga0495580_0011023 | 3300046472 | Bacteria | 7006 |
| 489 | Ga0495580_0109690 | 3300046472 | Unclassified | 1916 |
| 490 | Ga0495662_0002568 | 3300046476 | Bacteria | 9168 |
| 491 | Ga0495664_0118044 | 3300046477 | Bacteria | 1604 |
| 492 | Ga0495594_0003439 | 3300046499 | Bacteria | 8173 |
| 493 | Ga0495596_0039657 | 3300046500 | Unclassified | 1860 |
| 494 | Ga0495608_0000232 | 3300046511 | Bacteria | 40250 |
| 495 | Ga0495628_0000358 | 3300046516 | Bacteria | 41642 |
| 496 | Ga0495628_0011653 | 3300046516 | Bacteria | 7427 |
| 497 | Ga0495628_0032366 | 3300046516 | Bacteria | 4221 |
| 498 | Ga0495628_0116706 | 3300046516 | Bacteria | 2050 |
| 499 | Ga0495630_0036356 | 3300046517 | Bacteria | 3681 |
| 500 | Ga0495630_0056829 | 3300046517 | Bacteria | 2932 |
| 501 | Ga0495652_0004164 | 3300046529 | Bacteria | 13942 |
| 502 | Ga0495665_0022579 | 3300046531 | Bacteria | 3382 |
| 503 | Ga0495640_0044853 | 3300046533 | Bacteria | 3071 |
| 504 | Ga0495640_0100104 | 3300046533 | Bacteria | 1904 |
| 505 | Ga0495586_0014366 | 3300046535 | Bacteria | 4207 |
| 506 | Ga0495586_0191776 | 3300046535 | Bacteria | 1157 |
| 507 | Ga0495587_0000229 | 3300046536 | Bacteria | 41448 |
| 508 | Ga0495587_0003098 | 3300046536 | Bacteria | 11113 |
| 509 | Ga0495587_0094779 | 3300046536 | Unclassified | 1723 |
| 510 | Ga0495645_0000066 | 3300046543 | Bacteria | 73132 |
| 511 | Ga0495645_0057181 | 3300046543 | Unclassified | 2832 |
| 512 | Ga0495645_0158314 | 3300046543 | Bacteria | 1567 |
| 513 | Ga0495667_0024824 | 3300046559 | Bacteria | 4038 |
| 514 | Ga0495667_0055974 | 3300046559 | Bacteria | 2594 |
| 515 | Ga0495634_0027875 | 3300046642 | Bacteria | 3926 |
| 516 | Ga0495635_0000260 | 3300046663 | Bacteria | 33902 |
| 517 | Ga0495635_0021470 | 3300046663 | Bacteria | 4501 |
| 518 | Ga0495588_0003711 | 3300046674 | Bacteria | 6686 |
| 519 | Ga0495657_0000794 | 3300046675 | Bacteria | 28070 |
| 520 | Ga0495657_0112076 | 3300046675 | Bacteria | 1727 |
| 521 | Ga0495599_0000280 | 3300046678 | Bacteria | 31273 |
| 522 | Ga0495599_0037141 | 3300046678 | Unclassified | 3060 |
| 523 | Ga0495599_0149234 | 3300046678 | Unclassified | 1448 |
| 524 | Ga0495623_0000151 | 3300046679 | Bacteria | 42876 |
| 525 | Ga0495623_0007045 | 3300046679 | Bacteria | 7306 |
| 526 | Ga0495623_0083187 | 3300046679 | Bacteria | 1977 |
| 527 | Ga0495646_0000547 | 3300046680 | Bacteria | 20285 |
| 528 | Ga0495646_0065257 | 3300046680 | Bacteria | 2156 |
| 529 | Ga0495613_0107300 | 3300046689 | Bacteria | 2014 |
| 530 | Ga0495613_0120525 | 3300046689 | Bacteria | 1884 |
| 531 | Ga0495600_0000207 | 3300046809 | Bacteria | 33867 |
| 532 | Ga0495581_0038045 | 3300047315 | Unclassified | 2784 |
| 533 | Ga0495604_0000633 | 3300047317 | Bacteria | 30242 |
| 534 | Ga0495674_0042232 | 3300047319 | Bacteria | 4068 |
| 535 | Ga0495674_0062955 | 3300047319 | Bacteria | 3228 |
| 536 | Ga0495680_0041861 | 3300047322 | Bacteria | 3638 |
| 537 | Ga0495680_0047098 | 3300047322 | Bacteria | 3394 |
| 538 | Ga0495680_0152975 | 3300047322 | Bacteria | 1680 |
| 539 | Ga0495675_0001467 | 3300047444 | Bacteria | 14265 |
| 540 | Ga0495675_0007513 | 3300047444 | Bacteria | 6718 |
| 541 | Ga0495675_0014533 | 3300047444 | Bacteria | 4977 |
| 542 | Ga0495675_0131376 | 3300047444 | Unclassified | 1556 |
| 543 | Ga0495685_049190 | 3300047447 | Unclassified | 1432 |
| 544 | Ga0495684_0000428 | 3300047471 | Bacteria | 34287 |
| 545 | Ga0495684_0023109 | 3300047471 | Bacteria | 4782 |
| 546 | Ga0495602_0000545 | 3300048088 | Bacteria | 35134 |
| 547 | Ga0496104_0220651 | 3300048907 | Unclassified | 1808 |
| 548 | Ga0496105_0152252 | 3300048908 | Unclassified | 1901 |
| 549 | Ga0496108_0103884 | 3300048911 | Bacteria | 2425 |
| 550 | Ga0496112_0000846 | 3300048915 | Bacteria | 21835 |
| 551 | Ga0496112_0117561 | 3300048915 | Bacteria | 2629 |
| 552 | Ga0496113_0014546 | 3300048916 | Bacteria | 5372 |
| 553 | Ga0496115_0017289 | 3300048918 | Bacteria | 5509 |
| 554 | Ga0501038_0021601 | 3300049574 | Bacteria | 5776 |
| 555 | Ga0501038_0051923 | 3300049574 | Bacteria | 3536 |
| 556 | Ga0501038_0101527 | 3300049574 | Bacteria | 2394 |
| 557 | Ga0501047_0028778 | 3300049581 | Bacteria | 5359 |
| 558 | Ga0501067_0079575 | 3300049583 | Unclassified | 1816 |
| 559 | Ga0501075_0069668 | 3300049591 | Bacteria | 2658 |
| 560 | Ga0501076_0121273 | 3300049592 | Unclassified | 2117 |
| 561 | Ga0501202_001891 | 3300049652 | Bacteria | 3437 |
| 562 | Ga0501207_002545 | 3300049654 | Unclassified | 2368 |
| 563 | Ga0501209_005853 | 3300049656 | Bacteria | 2251 |
| 564 | Ga0501216_011208 | 3300049660 | Bacteria | 1453 |
| 565 | Ga0501227_007308 | 3300049665 | Unclassified | 2366 |
| 566 | Ga0501233_017174 | 3300049668 | Bacteria | 1508 |
| 567 | Ga0501235_000394 | 3300049669 | Bacteria | 8378 |
| 568 | Ga0501247_003929 | 3300049677 | Bacteria | 1611 |
| 569 | Ga0501249_004913 | 3300049679 | Bacteria | 2727 |
| 570 | Ga0501257_006527 | 3300049686 | Unclassified | 2590 |
| 571 | Ga0501259_003834 | 3300049688 | Bacteria | 2391 |
| 572 | Ga0501221_002958 | 3300049704 | Unclassified | 2799 |
| 573 | Ga0501080_0251639 | 3300049742 | Unclassified | 1611 |
| 574 | Ga0501081_0041404 | 3300049743 | Bacteria | 3155 |
| 575 | Ga0501262_006853 | 3300049759 | Bacteria | 1369 |
| 576 | Ga0501266_005487 | 3300049763 | Bacteria | 1576 |
| 577 | Ga0501268_000450 | 3300049765 | Bacteria | 4448 |
| 578 | Ga0501272_001806 | 3300049769 | Unclassified | 2080 |
| 579 | Ga0501274_001599 | 3300049771 | Bacteria | 1737 |
| 580 | Ga0501035_0156388 | 3300049822 | Bacteria | 1976 |
| 581 | Ga0501212_000692 | 3300049851 | Bacteria | 3426 |
| 582 | nmdc:mga05p37_24424_c1 | 3300050507 | Bacteria | 7345 |
| 583 | nmdc:mga09592_72317_c1 | 3300050508 | Bacteria | 2928 |
| 584 | nmdc:mga0qj67_112725_c1 | 3300050509 | Bacteria | 2196 |
| 585 | nmdc:mga0qj67_1382_c1 | 3300050509 | Bacteria | 17005 |
| 586 | nmdc:mga0qj67_84077_c1 | 3300050509 | Unclassified | 2552 |
| 587 | nmdc:mga06r32_49191_c1 | 3300050510 | Bacteria | 4031 |
| 588 | nmdc:mga08y16_70444_c1 | 3300050511 | Bacteria | 3645 |
| 589 | nmdc:mga0n895_6143_c1 | 3300050512 | Bacteria | 10147 |
| 590 | nmdc:mga0rr50_172416_c1 | 3300050513 | Bacteria | 1764 |
| 591 | nmdc:mga0rr50_45706_c1 | 3300050513 | Unclassified | 3220 |
| 592 | nmdc:mga08x19_26228_c1 | 3300050514 | Bacteria | 3635 |
| 593 | nmdc:mga0a205_1390_c1 | 3300050515 | Bacteria | 20471 |
| 594 | Ga0495601_0056482 | 3300053077 | Unclassified | 2486 |
| 595 | Ga0495612_0000937 | 3300053078 | Bacteria | 11962 |
| 596 | Ga0495619_0010425 | 3300053085 | Bacteria | 5848 |
| 597 | Ga0501084_0026360 | 3300054114 | Bacteria | 4850 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100002688 | Ga0070680_10000268814 | 295 |
| 2 | 3300005458 | Ga0070681_10002407 | Ga0070681_100024079 | 295 |
| 3 | 3300005530 | Ga0070679_100000085 | Ga0070679_1000000857 | 295 |
| 4 | 3300005327 | Ga0070658_10047772 | Ga0070658_100477724 | 304 |
| 5 | 3300005329 | Ga0070683_100091202 | Ga0070683_1000912023 | 304 |
| 6 | 3300005344 | Ga0070661_100140097 | Ga0070661_1001400971 | 304 |
| 7 | 3300005345 | Ga0070692_10020119 | Ga0070692_100201192 | 304 |
| 8 | 3300005366 | Ga0070659_100022685 | Ga0070659_1000226853 | 304 |
| 9 | 3300005535 | Ga0070684_100002564 | Ga0070684_1000025643 | 304 |
| 10 | 3300005564 | Ga0070664_100005882 | Ga0070664_1000058824 | 304 |
| 11 | 3300005577 | Ga0068857_100039204 | Ga0068857_1000392042 | 304 |
| 12 | 3300005618 | Ga0068864_100014535 | Ga0068864_1000145352 | 304 |
| 13 | 3300005841 | Ga0068863_100128028 | Ga0068863_1001280282 | 304 |
| 14 | 3300013100 | Ga0157373_10117608 | Ga0157373_101176081 | 304 |
| 15 | 3300013307 | Ga0157372_10047871 | Ga0157372_100478713 | 304 |
| 16 | 3300025920 | Ga0207649_10071532 | Ga0207649_100715322 | 304 |
| 17 | 3300025932 | Ga0207690_10024198 | Ga0207690_100241981 | 304 |
| 18 | 3300025944 | Ga0207661_10034692 | Ga0207661_100346921 | 304 |
| 19 | 3300025945 | Ga0207679_10008327 | Ga0207679_100083272 | 304 |
| 20 | 3300026088 | Ga0207641_10161084 | Ga0207641_101610841 | 304 |
| 21 | 3300026095 | Ga0207676_10020265 | Ga0207676_100202654 | 304 |
| 22 | 3300026116 | Ga0207674_10019410 | Ga0207674_100194104 | 304 |
| 23 | 3300037853 | Ga0436364_0274025 | Ga0436364_0274025_40_975 | 310 |
| 24 | 3300047444 | Ga0495675_0131376 | Ga0495675_0131376_182_1246 | 315 |
| 25 | 3300013102 | Ga0157371_10133390 | Ga0157371_101333901 | 317 |
| 26 | 3300048915 | Ga0496112_0117561 | Ga0496112_0117561_783_1835 | 317 |
| 27 | 3300048916 | Ga0496113_0014546 | Ga0496113_0014546_2295_3347 | 317 |
| 28 | 3300005336 | Ga0070680_100036579 | Ga0070680_1000365793 | 322 |
| 29 | 3300005336 | Ga0070680_100168995 | Ga0070680_1001689952 | 322 |
| 30 | 3300005530 | Ga0070679_100032603 | Ga0070679_1000326035 | 322 |
| 31 | 3300006914 | Ga0075436_100021637 | Ga0075436_1000216374 | 322 |
| 32 | 3300009174 | Ga0105241_10071396 | Ga0105241_100713963 | 322 |
| 33 | 3300009551 | Ga0105238_10149251 | Ga0105238_101492512 | 322 |
| 34 | 3300013100 | Ga0157373_10037965 | Ga0157373_100379652 | 322 |
| 35 | 3300013104 | Ga0157370_10131534 | Ga0157370_101315342 | 322 |
| 36 | 3300013105 | Ga0157369_10238699 | Ga0157369_102386992 | 322 |
| 37 | 3300013105 | Ga0157369_10314072 | Ga0157369_103140721 | 322 |
| 38 | 3300013307 | Ga0157372_10168563 | Ga0157372_101685633 | 322 |
| 39 | 3300025912 | Ga0207707_10041828 | Ga0207707_100418282 | 322 |
| 40 | 3300025913 | Ga0207695_10067295 | Ga0207695_100672953 | 322 |
| 41 | 3300050514 | nmdc:mga08x19_26228_c1 | nmdc:mga08x19_26228_c1_1340_2314 | 322 |
| 42 | 3300005563 | Ga0068855_100048604 | Ga0068855_1000486043 | 324 |
| 43 | 3300009545 | Ga0105237_10046545 | Ga0105237_100465452 | 324 |
| 44 | 3300005458 | Ga0070681_10005269 | Ga0070681_100052695 | 326 |
| 45 | 3300009093 | Ga0105240_10275034 | Ga0105240_102750342 | 326 |
| 46 | 3300013105 | Ga0157369_10109205 | Ga0157369_101092052 | 326 |
| 47 | 3300049574 | Ga0501038_0101527 | Ga0501038_0101527_565_1740 | 326 |
| 48 | 3300049591 | Ga0501075_0069668 | Ga0501075_0069668_96_1271 | 326 |
| 49 | 3300049743 | Ga0501081_0041404 | Ga0501081_0041404_362_1537 | 326 |
| 50 | 3300049822 | Ga0501035_0156388 | Ga0501035_0156388_780_1955 | 326 |
| 51 | 3300054114 | Ga0501084_0026360 | Ga0501084_0026360_2025_3200 | 326 |
| 52 | 3300005331 | Ga0070670_100057976 | Ga0070670_1000579765 | 327 |
| 53 | 3300005344 | Ga0070661_100000965 | Ga0070661_1000009656 | 327 |
| 54 | 3300005366 | Ga0070659_100013565 | Ga0070659_1000135652 | 327 |
| 55 | 3300005530 | Ga0070679_100035763 | Ga0070679_1000357632 | 327 |
| 56 | 3300005535 | Ga0070684_100007288 | Ga0070684_1000072885 | 327 |
| 57 | 3300005564 | Ga0070664_100002171 | Ga0070664_1000021717 | 327 |
| 58 | 3300005577 | Ga0068857_100000179 | Ga0068857_10000017927 | 327 |
| 59 | 3300013105 | Ga0157369_10021605 | Ga0157369_100216053 | 327 |
| 60 | 3300025912 | Ga0207707_10000872 | Ga0207707_1000087210 | 327 |
| 61 | 3300025922 | Ga0207646_10123672 | Ga0207646_101236722 | 327 |
| 62 | 3300025945 | Ga0207679_10001124 | Ga0207679_100011246 | 327 |
| 63 | 3300025960 | Ga0207651_10255500 | Ga0207651_102555001 | 327 |
| 64 | 3300026116 | Ga0207674_10000842 | Ga0207674_1000084226 | 327 |
| 65 | 3300009093 | Ga0105240_10152084 | Ga0105240_101520842 | 329 |
| 66 | 3300009551 | Ga0105238_10068486 | Ga0105238_100684861 | 329 |
| 67 | 3300013307 | Ga0157372_10269240 | Ga0157372_102692402 | 329 |
| 68 | 3300042156 | Ga0439446_0052595 | Ga0439446_0052595_11_1021 | 329 |
| 69 | 3300046543 | Ga0495645_0057181 | Ga0495645_0057181_1411_2460 | 329 |
| 70 | 3300014325 | Ga0163163_10150316 | Ga0163163_101503161 | 330 |
| 71 | 3300032005 | Ga0307411_10116857 | Ga0307411_101168572 | 330 |
| 72 | 3300049652 | Ga0501202_001891 | Ga0501202_001891_335_1348 | 331 |
| 73 | 3300049654 | Ga0501207_002545 | Ga0501207_002545_1235_2248 | 331 |
| 74 | 3300049656 | Ga0501209_005853 | Ga0501209_005853_756_1769 | 331 |
| 75 | 3300049660 | Ga0501216_011208 | Ga0501216_011208_95_1108 | 331 |
| 76 | 3300049665 | Ga0501227_007308 | Ga0501227_007308_685_1698 | 331 |
| 77 | 3300049668 | Ga0501233_017174 | Ga0501233_017174_50_1063 | 331 |
| 78 | 3300049669 | Ga0501235_000394 | Ga0501235_000394_2703_3716 | 331 |
| 79 | 3300049677 | Ga0501247_003929 | Ga0501247_003929_494_1507 | 331 |
| 80 | 3300049679 | Ga0501249_004913 | Ga0501249_004913_667_1680 | 331 |
| 81 | 3300049686 | Ga0501257_006527 | Ga0501257_006527_451_1464 | 331 |
| 82 | 3300049688 | Ga0501259_003834 | Ga0501259_003834_670_1683 | 331 |
| 83 | 3300049704 | Ga0501221_002958 | Ga0501221_002958_1610_2623 | 331 |
| 84 | 3300049759 | Ga0501262_006853 | Ga0501262_006853_344_1357 | 331 |
| 85 | 3300049765 | Ga0501268_000450 | Ga0501268_000450_2419_3432 | 331 |
| 86 | 3300049769 | Ga0501272_001806 | Ga0501272_001806_364_1377 | 331 |
| 87 | 3300049771 | Ga0501274_001599 | Ga0501274_001599_656_1669 | 331 |
| 88 | 3300049851 | Ga0501212_000692 | Ga0501212_000692_900_1913 | 331 |
| 89 | 3300005535 | Ga0070684_100025041 | Ga0070684_1000250411 | 332 |
| 90 | 3300025914 | Ga0207671_10162167 | Ga0207671_101621671 | 332 |
| 91 | 3300026142 | Ga0207698_10184811 | Ga0207698_101848112 | 332 |
| 92 | 3300031731 | Ga0307405_10010806 | Ga0307405_100108062 | 333 |
| 93 | 3300031901 | Ga0307406_10061290 | Ga0307406_100612902 | 333 |
| 94 | 3300031903 | Ga0307407_10030242 | Ga0307407_100302422 | 333 |
| 95 | 3300031911 | Ga0307412_10004846 | Ga0307412_100048466 | 333 |
| 96 | 3300031995 | Ga0307409_100001171 | Ga0307409_1000011719 | 333 |
| 97 | 3300031995 | Ga0307409_100128865 | Ga0307409_1001288652 | 333 |
| 98 | 3300032002 | Ga0307416_100008551 | Ga0307416_1000085514 | 333 |
| 99 | 3300032002 | Ga0307416_100069096 | Ga0307416_1000690962 | 333 |
| 100 | 3300032005 | Ga0307411_10000924 | Ga0307411_100009249 | 333 |
| 101 | 3300032126 | Ga0307415_100019164 | Ga0307415_1000191645 | 333 |
| 102 | 3300046454 | Ga0495592_0128939 | Ga0495592_0128939_74_1078 | 333 |
| 103 | 3300046533 | Ga0495640_0100104 | Ga0495640_0100104_733_1737 | 333 |
| 104 | 3300046535 | Ga0495586_0191776 | Ga0495586_0191776_139_1143 | 333 |
| 105 | 3300046559 | Ga0495667_0024824 | Ga0495667_0024824_2738_3742 | 333 |
| 106 | 3300047444 | Ga0495675_0014533 | Ga0495675_0014533_2746_3750 | 333 |
| 107 | 3300005336 | Ga0070680_100002464 | Ga0070680_10000246413 | 334 |
| 108 | 3300005530 | Ga0070679_100002972 | Ga0070679_10000297214 | 334 |
| 109 | 3300009098 | Ga0105245_10042292 | Ga0105245_100422923 | 334 |
| 110 | 3300025907 | Ga0207645_10063986 | Ga0207645_100639862 | 334 |
| 111 | 3300025921 | Ga0207652_10005853 | Ga0207652_100058539 | 334 |
| 112 | 3300025927 | Ga0207687_10075709 | Ga0207687_100757092 | 334 |
| 113 | 3300026023 | Ga0207677_10100367 | Ga0207677_101003672 | 334 |
| 114 | 3300031852 | Ga0307410_10075375 | Ga0307410_100753752 | 334 |
| 115 | 3300031901 | Ga0307406_10077393 | Ga0307406_100773932 | 334 |
| 116 | 3300031901 | Ga0307406_10084611 | Ga0307406_100846111 | 334 |
| 117 | 3300031903 | Ga0307407_10055561 | Ga0307407_100555611 | 334 |
| 118 | 3300031911 | Ga0307412_10011032 | Ga0307412_100110325 | 334 |
| 119 | 3300031911 | Ga0307412_10099037 | Ga0307412_100990372 | 334 |
| 120 | 3300032002 | Ga0307416_100029322 | Ga0307416_1000293222 | 334 |
| 121 | 3300032002 | Ga0307416_100164578 | Ga0307416_1001645781 | 334 |
| 122 | 3300032005 | Ga0307411_10060132 | Ga0307411_100601322 | 334 |
| 123 | 3300032126 | Ga0307415_100077917 | Ga0307415_1000779172 | 334 |
| 124 | 3300042876 | Ga0451577_0025189 | Ga0451577_0025189_438_1511 | 334 |
| 125 | 3300042876 | Ga0451577_0131919 | Ga0451577_0131919_1050_2123 | 334 |
| 126 | 3300044712 | Ga0453684_0039668 | Ga0453684_0039668_1249_2322 | 334 |
| 127 | 3300047315 | Ga0495581_0038045 | Ga0495581_0038045_147_1154 | 334 |
| 128 | 3300005293 | Ga0065715_10132560 | Ga0065715_101325602 | 335 |
| 129 | 3300005329 | Ga0070683_100137009 | Ga0070683_1001370091 | 335 |
| 130 | 3300005336 | Ga0070680_100000211 | Ga0070680_10000021111 | 335 |
| 131 | 3300005337 | Ga0070682_100001451 | Ga0070682_1000014511 | 335 |
| 132 | 3300005344 | Ga0070661_100141228 | Ga0070661_1001412282 | 335 |
| 133 | 3300005435 | Ga0070714_100077656 | Ga0070714_1000776562 | 335 |
| 134 | 3300005459 | Ga0068867_100014698 | Ga0068867_1000146984 | 335 |
| 135 | 3300005467 | Ga0070706_100092829 | Ga0070706_1000928291 | 335 |
| 136 | 3300005468 | Ga0070707_100109433 | Ga0070707_1001094332 | 335 |
| 137 | 3300005468 | Ga0070707_100203054 | Ga0070707_1002030541 | 335 |
| 138 | 3300005471 | Ga0070698_100023353 | Ga0070698_1000233533 | 335 |
| 139 | 3300005530 | Ga0070679_100000355 | Ga0070679_10000035511 | 335 |
| 140 | 3300005535 | Ga0070684_100098467 | Ga0070684_1000984672 | 335 |
| 141 | 3300005539 | Ga0068853_100051795 | Ga0068853_1000517953 | 335 |
| 142 | 3300005563 | Ga0068855_100216579 | Ga0068855_1002165793 | 335 |
| 143 | 3300005564 | Ga0070664_100210528 | Ga0070664_1002105281 | 335 |
| 144 | 3300005577 | Ga0068857_100249439 | Ga0068857_1002494391 | 335 |
| 145 | 3300005578 | Ga0068854_100056769 | Ga0068854_1000567692 | 335 |
| 146 | 3300005616 | Ga0068852_100167219 | Ga0068852_1001672191 | 335 |
| 147 | 3300006914 | Ga0075436_100009980 | Ga0075436_1000099802 | 335 |
| 148 | 3300009098 | Ga0105245_10024020 | Ga0105245_100240203 | 335 |
| 149 | 3300009545 | Ga0105237_10121199 | Ga0105237_101211992 | 335 |
| 150 | 3300013104 | Ga0157370_10205822 | Ga0157370_102058221 | 335 |
| 151 | 3300013296 | Ga0157374_10075153 | Ga0157374_100751531 | 335 |
| 152 | 3300013297 | Ga0157378_10002336 | Ga0157378_1000233612 | 335 |
| 153 | 3300020082 | Ga0206353_11062776 | Ga0206353_110627762 | 335 |
| 154 | 3300025912 | Ga0207707_10000303 | Ga0207707_1000030320 | 335 |
| 155 | 3300025913 | Ga0207695_10172476 | Ga0207695_101724762 | 335 |
| 156 | 3300025914 | Ga0207671_10063170 | Ga0207671_100631703 | 335 |
| 157 | 3300025917 | Ga0207660_10001634 | Ga0207660_1000163411 | 335 |
| 158 | 3300025917 | Ga0207660_10016634 | Ga0207660_100166344 | 335 |
| 159 | 3300025920 | Ga0207649_10059317 | Ga0207649_100593172 | 335 |
| 160 | 3300025921 | Ga0207652_10000526 | Ga0207652_1000052621 | 335 |
| 161 | 3300025924 | Ga0207694_10215448 | Ga0207694_102154482 | 335 |
| 162 | 3300025927 | Ga0207687_10107386 | Ga0207687_101073863 | 335 |
| 163 | 3300025937 | Ga0207669_10032838 | Ga0207669_100328382 | 335 |
| 164 | 3300025945 | Ga0207679_10147413 | Ga0207679_101474132 | 335 |
| 165 | 3300025949 | Ga0207667_10123187 | Ga0207667_101231872 | 335 |
| 166 | 3300025981 | Ga0207640_10083306 | Ga0207640_100833062 | 335 |
| 167 | 3300026041 | Ga0207639_10086232 | Ga0207639_100862322 | 335 |
| 168 | 3300026089 | Ga0207648_10008328 | Ga0207648_100083282 | 335 |
| 169 | 3300026142 | Ga0207698_10162705 | Ga0207698_101627052 | 335 |
| 170 | 3300027717 | Ga0209998_10001045 | Ga0209998_100010452 | 335 |
| 171 | 3300031548 | Ga0307408_100213587 | Ga0307408_1002135871 | 335 |
| 172 | 3300031731 | Ga0307405_10103641 | Ga0307405_101036412 | 335 |
| 173 | 3300031731 | Ga0307405_10131695 | Ga0307405_101316951 | 335 |
| 174 | 3300031824 | Ga0307413_10082940 | Ga0307413_100829402 | 335 |
| 175 | 3300031852 | Ga0307410_10001914 | Ga0307410_100019141 | 335 |
| 176 | 3300031901 | Ga0307406_10014765 | Ga0307406_100147656 | 335 |
| 177 | 3300031901 | Ga0307406_10062487 | Ga0307406_100624872 | 335 |
| 178 | 3300031903 | Ga0307407_10000304 | Ga0307407_100003045 | 335 |
| 179 | 3300031911 | Ga0307412_10002031 | Ga0307412_100020311 | 335 |
| 180 | 3300031911 | Ga0307412_10046366 | Ga0307412_100463662 | 335 |
| 181 | 3300031911 | Ga0307412_10049666 | Ga0307412_100496662 | 335 |
| 182 | 3300031995 | Ga0307409_100012398 | Ga0307409_1000123985 | 335 |
| 183 | 3300031995 | Ga0307409_100098393 | Ga0307409_1000983931 | 335 |
| 184 | 3300032002 | Ga0307416_100030920 | Ga0307416_1000309203 | 335 |
| 185 | 3300032005 | Ga0307411_10022666 | Ga0307411_100226662 | 335 |
| 186 | 3300032005 | Ga0307411_10037201 | Ga0307411_100372013 | 335 |
| 187 | 3300032126 | Ga0307415_100002151 | Ga0307415_1000021513 | 335 |
| 188 | 3300049574 | Ga0501038_0021601 | Ga0501038_0021601_2312_3322 | 335 |
| 189 | 3300049574 | Ga0501038_0051923 | Ga0501038_0051923_2292_3350 | 335 |
| 190 | 3300049581 | Ga0501047_0028778 | Ga0501047_0028778_232_1242 | 335 |
| 191 | 3300049583 | Ga0501067_0079575 | Ga0501067_0079575_22_1083 | 335 |
| 192 | 3300049763 | Ga0501266_005487 | Ga0501266_005487_172_1320 | 335 |
| 193 | 2162886012 | MBSR1b_contig_10279081 | MBSR1b_0775.00006140 | 336 |
| 194 | 3300005290 | Ga0065712_10107274 | Ga0065712_101072742 | 336 |
| 195 | 3300005293 | Ga0065715_10092603 | Ga0065715_100926032 | 336 |
| 196 | 3300005295 | Ga0065707_10086002 | Ga0065707_100860024 | 336 |
| 197 | 3300005327 | Ga0070658_10004216 | Ga0070658_100042166 | 336 |
| 198 | 3300005327 | Ga0070658_10111999 | Ga0070658_101119992 | 336 |
| 199 | 3300005328 | Ga0070676_10037765 | Ga0070676_100377652 | 336 |
| 200 | 3300005328 | Ga0070676_10067316 | Ga0070676_100673162 | 336 |
| 201 | 3300005329 | Ga0070683_100001402 | Ga0070683_10000140211 | 336 |
| 202 | 3300005329 | Ga0070683_100005334 | Ga0070683_1000053347 | 336 |
| 203 | 3300005329 | Ga0070683_100058907 | Ga0070683_1000589072 | 336 |
| 204 | 3300005329 | Ga0070683_100073623 | Ga0070683_1000736231 | 336 |
| 205 | 3300005330 | Ga0070690_100031738 | Ga0070690_1000317382 | 336 |
| 206 | 3300005331 | Ga0070670_100005229 | Ga0070670_1000052296 | 336 |
| 207 | 3300005331 | Ga0070670_100012450 | Ga0070670_1000124509 | 336 |
| 208 | 3300005331 | Ga0070670_100024335 | Ga0070670_1000243354 | 336 |
| 209 | 3300005331 | Ga0070670_100028999 | Ga0070670_1000289992 | 336 |
| 210 | 3300005334 | Ga0068869_100001049 | Ga0068869_1000010492 | 336 |
| 211 | 3300005334 | Ga0068869_100027103 | Ga0068869_1000271034 | 336 |
| 212 | 3300005335 | Ga0070666_10031908 | Ga0070666_100319083 | 336 |
| 213 | 3300005335 | Ga0070666_10092775 | Ga0070666_100927752 | 336 |
| 214 | 3300005336 | Ga0070680_100002193 | Ga0070680_10000219310 | 336 |
| 215 | 3300005336 | Ga0070680_100011383 | Ga0070680_1000113832 | 336 |
| 216 | 3300005336 | Ga0070680_100095170 | Ga0070680_1000951702 | 336 |
| 217 | 3300005336 | Ga0070680_100188902 | Ga0070680_1001889021 | 336 |
| 218 | 3300005337 | Ga0070682_100000790 | Ga0070682_1000007905 | 336 |
| 219 | 3300005337 | Ga0070682_100010720 | Ga0070682_1000107201 | 336 |
| 220 | 3300005337 | Ga0070682_100016215 | Ga0070682_1000162153 | 336 |
| 221 | 3300005338 | Ga0068868_100265507 | Ga0068868_1002655071 | 336 |
| 222 | 3300005339 | Ga0070660_100006624 | Ga0070660_1000066245 | 336 |
| 223 | 3300005339 | Ga0070660_100077782 | Ga0070660_1000777822 | 336 |
| 224 | 3300005340 | Ga0070689_100022167 | Ga0070689_1000221673 | 336 |
| 225 | 3300005340 | Ga0070689_100184804 | Ga0070689_1001848042 | 336 |
| 226 | 3300005343 | Ga0070687_100001962 | Ga0070687_1000019627 | 336 |
| 227 | 3300005343 | Ga0070687_100013033 | Ga0070687_1000130334 | 336 |
| 228 | 3300005344 | Ga0070661_100004675 | Ga0070661_1000046752 | 336 |
| 229 | 3300005344 | Ga0070661_100004701 | Ga0070661_1000047014 | 336 |
| 230 | 3300005344 | Ga0070661_100033959 | Ga0070661_1000339595 | 336 |
| 231 | 3300005344 | Ga0070661_100049438 | Ga0070661_1000494382 | 336 |
| 232 | 3300005345 | Ga0070692_10003678 | Ga0070692_100036785 | 336 |
| 233 | 3300005347 | Ga0070668_100159543 | Ga0070668_1001595431 | 336 |
| 234 | 3300005353 | Ga0070669_100002801 | Ga0070669_1000028016 | 336 |
| 235 | 3300005353 | Ga0070669_100012282 | Ga0070669_1000122824 | 336 |
| 236 | 3300005353 | Ga0070669_100120633 | Ga0070669_1001206331 | 336 |
| 237 | 3300005354 | Ga0070675_100001287 | Ga0070675_1000012872 | 336 |
| 238 | 3300005354 | Ga0070675_100011812 | Ga0070675_1000118122 | 336 |
| 239 | 3300005354 | Ga0070675_100038842 | Ga0070675_1000388423 | 336 |
| 240 | 3300005354 | Ga0070675_100042358 | Ga0070675_1000423582 | 336 |
| 241 | 3300005354 | Ga0070675_100258840 | Ga0070675_1002588401 | 336 |
| 242 | 3300005355 | Ga0070671_100024347 | Ga0070671_1000243474 | 336 |
| 243 | 3300005355 | Ga0070671_100050572 | Ga0070671_1000505723 | 336 |
| 244 | 3300005356 | Ga0070674_100245600 | Ga0070674_1002456001 | 336 |
| 245 | 3300005364 | Ga0070673_100076469 | Ga0070673_1000764693 | 336 |
| 246 | 3300005364 | Ga0070673_100129174 | Ga0070673_1001291742 | 336 |
| 247 | 3300005364 | Ga0070673_100295373 | Ga0070673_1002953731 | 336 |
| 248 | 3300005365 | Ga0070688_100005871 | Ga0070688_1000058713 | 336 |
| 249 | 3300005366 | Ga0070659_100003646 | Ga0070659_1000036465 | 336 |
| 250 | 3300005366 | Ga0070659_100004835 | Ga0070659_1000048356 | 336 |
| 251 | 3300005366 | Ga0070659_100335729 | Ga0070659_1003357291 | 336 |
| 252 | 3300005367 | Ga0070667_100008417 | Ga0070667_1000084177 | 336 |
| 253 | 3300005367 | Ga0070667_100067093 | Ga0070667_1000670933 | 336 |
| 254 | 3300005406 | Ga0070703_10013658 | Ga0070703_100136582 | 336 |
| 255 | 3300005435 | Ga0070714_100012956 | Ga0070714_1000129565 | 336 |
| 256 | 3300005439 | Ga0070711_100172282 | Ga0070711_1001722822 | 336 |
| 257 | 3300005445 | Ga0070708_100000849 | Ga0070708_1000008495 | 336 |
| 258 | 3300005445 | Ga0070708_100018454 | Ga0070708_1000184544 | 336 |
| 259 | 3300005455 | Ga0070663_100076849 | Ga0070663_1000768492 | 336 |
| 260 | 3300005457 | Ga0070662_100000424 | Ga0070662_1000004249 | 336 |
| 261 | 3300005457 | Ga0070662_100042621 | Ga0070662_1000426212 | 336 |
| 262 | 3300005457 | Ga0070662_100178612 | Ga0070662_1001786122 | 336 |
| 263 | 3300005458 | Ga0070681_10005393 | Ga0070681_100053939 | 336 |
| 264 | 3300005458 | Ga0070681_10008249 | Ga0070681_100082498 | 336 |
| 265 | 3300005458 | Ga0070681_10023997 | Ga0070681_100239972 | 336 |
| 266 | 3300005458 | Ga0070681_10321787 | Ga0070681_103217871 | 336 |
| 267 | 3300005466 | Ga0070685_10022157 | Ga0070685_100221572 | 336 |
| 268 | 3300005466 | Ga0070685_10040313 | Ga0070685_100403132 | 336 |
| 269 | 3300005466 | Ga0070685_10135584 | Ga0070685_101355842 | 336 |
| 270 | 3300005467 | Ga0070706_100035147 | Ga0070706_1000351473 | 336 |
| 271 | 3300005468 | Ga0070707_100002115 | Ga0070707_1000021154 | 336 |
| 272 | 3300005468 | Ga0070707_100095400 | Ga0070707_1000954001 | 336 |
| 273 | 3300005468 | Ga0070707_100122482 | Ga0070707_1001224822 | 336 |
| 274 | 3300005471 | Ga0070698_100015754 | Ga0070698_1000157545 | 336 |
| 275 | 3300005518 | Ga0070699_100016562 | Ga0070699_1000165627 | 336 |
| 276 | 3300005518 | Ga0070699_100020754 | Ga0070699_1000207541 | 336 |
| 277 | 3300005530 | Ga0070679_100002038 | Ga0070679_10000203813 | 336 |
| 278 | 3300005530 | Ga0070679_100003613 | Ga0070679_1000036134 | 336 |
| 279 | 3300005530 | Ga0070679_100004960 | Ga0070679_1000049609 | 336 |
| 280 | 3300005530 | Ga0070679_100155728 | Ga0070679_1001557282 | 336 |
| 281 | 3300005535 | Ga0070684_100001085 | Ga0070684_10000108515 | 336 |
| 282 | 3300005535 | Ga0070684_100010548 | Ga0070684_1000105482 | 336 |
| 283 | 3300005535 | Ga0070684_100142985 | Ga0070684_1001429852 | 336 |
| 284 | 3300005535 | Ga0070684_100162472 | Ga0070684_1001624722 | 336 |
| 285 | 3300005536 | Ga0070697_100097679 | Ga0070697_1000976791 | 336 |
| 286 | 3300005539 | Ga0068853_100038666 | Ga0068853_1000386662 | 336 |
| 287 | 3300005539 | Ga0068853_100130969 | Ga0068853_1001309693 | 336 |
| 288 | 3300005543 | Ga0070672_100014501 | Ga0070672_1000145011 | 336 |
| 289 | 3300005543 | Ga0070672_100185686 | Ga0070672_1001856862 | 336 |
| 290 | 3300005545 | Ga0070695_100008476 | Ga0070695_1000084765 | 336 |
| 291 | 3300005545 | Ga0070695_100090258 | Ga0070695_1000902582 | 336 |
| 292 | 3300005546 | Ga0070696_100004808 | Ga0070696_1000048083 | 336 |
| 293 | 3300005563 | Ga0068855_100001420 | Ga0068855_10000142023 | 336 |
| 294 | 3300005563 | Ga0068855_100007089 | Ga0068855_1000070892 | 336 |
| 295 | 3300005563 | Ga0068855_100026460 | Ga0068855_1000264607 | 336 |
| 296 | 3300005563 | Ga0068855_100034889 | Ga0068855_1000348894 | 336 |
| 297 | 3300005564 | Ga0070664_100000313 | Ga0070664_10000031313 | 336 |
| 298 | 3300005564 | Ga0070664_100028013 | Ga0070664_1000280134 | 336 |
| 299 | 3300005564 | Ga0070664_100040470 | Ga0070664_1000404705 | 336 |
| 300 | 3300005564 | Ga0070664_100058501 | Ga0070664_1000585012 | 336 |
| 301 | 3300005564 | Ga0070664_100073209 | Ga0070664_1000732093 | 336 |
| 302 | 3300005577 | Ga0068857_100000495 | Ga0068857_10000049524 | 336 |
| 303 | 3300005577 | Ga0068857_100008030 | Ga0068857_1000080308 | 336 |
| 304 | 3300005577 | Ga0068857_100011370 | Ga0068857_1000113706 | 336 |
| 305 | 3300005577 | Ga0068857_100064552 | Ga0068857_1000645522 | 336 |
| 306 | 3300005578 | Ga0068854_100009904 | Ga0068854_1000099043 | 336 |
| 307 | 3300005578 | Ga0068854_100120090 | Ga0068854_1001200902 | 336 |
| 308 | 3300005614 | Ga0068856_100003777 | Ga0068856_1000037774 | 336 |
| 309 | 3300005615 | Ga0070702_100018912 | Ga0070702_1000189122 | 336 |
| 310 | 3300005616 | Ga0068852_100020098 | Ga0068852_1000200983 | 336 |
| 311 | 3300005616 | Ga0068852_100022032 | Ga0068852_1000220323 | 336 |
| 312 | 3300005616 | Ga0068852_100025845 | Ga0068852_1000258453 | 336 |
| 313 | 3300005617 | Ga0068859_100021114 | Ga0068859_1000211142 | 336 |
| 314 | 3300005617 | Ga0068859_100069586 | Ga0068859_1000695863 | 336 |
| 315 | 3300005618 | Ga0068864_100008261 | Ga0068864_1000082613 | 336 |
| 316 | 3300005718 | Ga0068866_10004619 | Ga0068866_100046193 | 336 |
| 317 | 3300005719 | Ga0068861_100007253 | Ga0068861_1000072536 | 336 |
| 318 | 3300005834 | Ga0068851_10029991 | Ga0068851_100299912 | 336 |
| 319 | 3300005840 | Ga0068870_10031641 | Ga0068870_100316412 | 336 |
| 320 | 3300005841 | Ga0068863_100079094 | Ga0068863_1000790943 | 336 |
| 321 | 3300005842 | Ga0068858_100027021 | Ga0068858_1000270215 | 336 |
| 322 | 3300005842 | Ga0068858_100050059 | Ga0068858_1000500595 | 336 |
| 323 | 3300005843 | Ga0068860_100012629 | Ga0068860_1000126294 | 336 |
| 324 | 3300005843 | Ga0068860_100037303 | Ga0068860_1000373033 | 336 |
| 325 | 3300005844 | Ga0068862_100037198 | Ga0068862_1000371985 | 336 |
| 326 | 3300006028 | Ga0070717_10132952 | Ga0070717_101329522 | 336 |
| 327 | 3300006173 | Ga0070716_100093868 | Ga0070716_1000938681 | 336 |
| 328 | 3300006175 | Ga0070712_100218371 | Ga0070712_1002183711 | 336 |
| 329 | 3300006358 | Ga0068871_100034443 | Ga0068871_1000344432 | 336 |
| 330 | 3300006358 | Ga0068871_100193081 | Ga0068871_1001930811 | 336 |
| 331 | 3300006844 | Ga0075428_100393821 | Ga0075428_1003938211 | 336 |
| 332 | 3300006846 | Ga0075430_100002736 | Ga0075430_10000273612 | 336 |
| 333 | 3300006846 | Ga0075430_100009941 | Ga0075430_1000099416 | 336 |
| 334 | 3300006846 | Ga0075430_100056995 | Ga0075430_1000569953 | 336 |
| 335 | 3300006846 | Ga0075430_100193614 | Ga0075430_1001936142 | 336 |
| 336 | 3300006847 | Ga0075431_100055741 | Ga0075431_1000557415 | 336 |
| 337 | 3300006847 | Ga0075431_100330921 | Ga0075431_1003309211 | 336 |
| 338 | 3300006852 | Ga0075433_10021167 | Ga0075433_100211677 | 336 |
| 339 | 3300006871 | Ga0075434_100017657 | Ga0075434_1000176574 | 336 |
| 340 | 3300006881 | Ga0068865_100019525 | Ga0068865_1000195255 | 336 |
| 341 | 3300006881 | Ga0068865_100213199 | Ga0068865_1002131991 | 336 |
| 342 | 3300006914 | Ga0075436_100016778 | Ga0075436_1000167785 | 336 |
| 343 | 3300006931 | Ga0097620_100021115 | Ga0097620_1000211155 | 336 |
| 344 | 3300006931 | Ga0097620_100069590 | Ga0097620_1000695903 | 336 |
| 345 | 3300007076 | Ga0075435_100008656 | Ga0075435_1000086562 | 336 |
| 346 | 3300007788 | Ga0099795_10003411 | Ga0099795_100034113 | 336 |
| 347 | 3300009093 | Ga0105240_10124670 | Ga0105240_101246701 | 336 |
| 348 | 3300009094 | Ga0111539_10036945 | Ga0111539_100369452 | 336 |
| 349 | 3300009098 | Ga0105245_10048195 | Ga0105245_100481953 | 336 |
| 350 | 3300009098 | Ga0105245_10062529 | Ga0105245_100625292 | 336 |
| 351 | 3300009147 | Ga0114129_10012586 | Ga0114129_1001258610 | 336 |
| 352 | 3300009174 | Ga0105241_10057235 | Ga0105241_100572351 | 336 |
| 353 | 3300009174 | Ga0105241_10183727 | Ga0105241_101837271 | 336 |
| 354 | 3300009176 | Ga0105242_10040329 | Ga0105242_100403293 | 336 |
| 355 | 3300009177 | Ga0105248_10011861 | Ga0105248_100118617 | 336 |
| 356 | 3300009177 | Ga0105248_10019314 | Ga0105248_100193143 | 336 |
| 357 | 3300009177 | Ga0105248_10026436 | Ga0105248_100264362 | 336 |
| 358 | 3300009177 | Ga0105248_10153149 | Ga0105248_101531492 | 336 |
| 359 | 3300009177 | Ga0105248_10261374 | Ga0105248_102613741 | 336 |
| 360 | 3300009551 | Ga0105238_10061051 | Ga0105238_100610513 | 336 |
| 361 | 3300009551 | Ga0105238_10278908 | Ga0105238_102789082 | 336 |
| 362 | 3300009553 | Ga0105249_10006039 | Ga0105249_100060396 | 336 |
| 363 | 3300009553 | Ga0105249_10060953 | Ga0105249_100609532 | 336 |
| 364 | 3300009553 | Ga0105249_10133713 | Ga0105249_101337132 | 336 |
| 365 | 3300010159 | Ga0099796_10001176 | Ga0099796_100011763 | 336 |
| 366 | 3300010375 | Ga0105239_10053701 | Ga0105239_100537014 | 336 |
| 367 | 3300011119 | Ga0105246_10001757 | Ga0105246_1000175710 | 336 |
| 368 | 3300013102 | Ga0157371_10011933 | Ga0157371_100119332 | 336 |
| 369 | 3300013105 | Ga0157369_10154431 | Ga0157369_101544312 | 336 |
| 370 | 3300013105 | Ga0157369_10302341 | Ga0157369_103023411 | 336 |
| 371 | 3300013296 | Ga0157374_10024538 | Ga0157374_100245383 | 336 |
| 372 | 3300013296 | Ga0157374_10032088 | Ga0157374_100320883 | 336 |
| 373 | 3300013296 | Ga0157374_10216611 | Ga0157374_102166112 | 336 |
| 374 | 3300013297 | Ga0157378_10023731 | Ga0157378_100237316 | 336 |
| 375 | 3300013297 | Ga0157378_10099905 | Ga0157378_100999052 | 336 |
| 376 | 3300013297 | Ga0157378_10139188 | Ga0157378_101391882 | 336 |
| 377 | 3300013297 | Ga0157378_10163930 | Ga0157378_101639302 | 336 |
| 378 | 3300013306 | Ga0163162_10002048 | Ga0163162_1000204811 | 336 |
| 379 | 3300013307 | Ga0157372_10003799 | Ga0157372_100037997 | 336 |
| 380 | 3300013307 | Ga0157372_10021660 | Ga0157372_100216604 | 336 |
| 381 | 3300013307 | Ga0157372_10025111 | Ga0157372_100251115 | 336 |
| 382 | 3300013307 | Ga0157372_10036633 | Ga0157372_100366333 | 336 |
| 383 | 3300013307 | Ga0157372_10038903 | Ga0157372_100389031 | 336 |
| 384 | 3300013307 | Ga0157372_10134245 | Ga0157372_101342452 | 336 |
| 385 | 3300013307 | Ga0157372_10203259 | Ga0157372_102032593 | 336 |
| 386 | 3300013308 | Ga0157375_10005804 | Ga0157375_1000580414 | 336 |
| 387 | 3300013308 | Ga0157375_10008124 | Ga0157375_100081244 | 336 |
| 388 | 3300013308 | Ga0157375_10162236 | Ga0157375_101622361 | 336 |
| 389 | 3300014325 | Ga0163163_10002127 | Ga0163163_100021278 | 336 |
| 390 | 3300014325 | Ga0163163_10073490 | Ga0163163_100734902 | 336 |
| 391 | 3300014325 | Ga0163163_10385663 | Ga0163163_103856632 | 336 |
| 392 | 3300014745 | Ga0157377_10011964 | Ga0157377_100119644 | 336 |
| 393 | 3300014745 | Ga0157377_10193262 | Ga0157377_101932621 | 336 |
| 394 | 3300014968 | Ga0157379_10007606 | Ga0157379_100076065 | 336 |
| 395 | 3300015262 | Ga0182007_10015980 | Ga0182007_100159801 | 336 |
| 396 | 3300017792 | Ga0163161_10012618 | Ga0163161_100126183 | 336 |
| 397 | 3300025315 | Ga0207697_10005401 | Ga0207697_100054017 | 336 |
| 398 | 3300025899 | Ga0207642_10043498 | Ga0207642_100434982 | 336 |
| 399 | 3300025907 | Ga0207645_10001996 | Ga0207645_1000199610 | 336 |
| 400 | 3300025907 | Ga0207645_10076616 | Ga0207645_100766162 | 336 |
| 401 | 3300025908 | Ga0207643_10020267 | Ga0207643_100202674 | 336 |
| 402 | 3300025909 | Ga0207705_10002919 | Ga0207705_100029195 | 336 |
| 403 | 3300025909 | Ga0207705_10013095 | Ga0207705_100130953 | 336 |
| 404 | 3300025911 | Ga0207654_10021822 | Ga0207654_100218225 | 336 |
| 405 | 3300025912 | Ga0207707_10002037 | Ga0207707_100020376 | 336 |
| 406 | 3300025912 | Ga0207707_10019607 | Ga0207707_100196074 | 336 |
| 407 | 3300025912 | Ga0207707_10039036 | Ga0207707_100390362 | 336 |
| 408 | 3300025912 | Ga0207707_10069981 | Ga0207707_100699811 | 336 |
| 409 | 3300025913 | Ga0207695_10022331 | Ga0207695_100223317 | 336 |
| 410 | 3300025915 | Ga0207693_10088255 | Ga0207693_100882553 | 336 |
| 411 | 3300025917 | Ga0207660_10011842 | Ga0207660_100118422 | 336 |
| 412 | 3300025917 | Ga0207660_10022288 | Ga0207660_100222882 | 336 |
| 413 | 3300025918 | Ga0207662_10001793 | Ga0207662_1000179310 | 336 |
| 414 | 3300025918 | Ga0207662_10003880 | Ga0207662_100038807 | 336 |
| 415 | 3300025919 | Ga0207657_10013223 | Ga0207657_100132235 | 336 |
| 416 | 3300025919 | Ga0207657_10043399 | Ga0207657_100433994 | 336 |
| 417 | 3300025919 | Ga0207657_10046442 | Ga0207657_100464424 | 336 |
| 418 | 3300025919 | Ga0207657_10062627 | Ga0207657_100626272 | 336 |
| 419 | 3300025920 | Ga0207649_10002406 | Ga0207649_100024068 | 336 |
| 420 | 3300025920 | Ga0207649_10011144 | Ga0207649_100111442 | 336 |
| 421 | 3300025920 | Ga0207649_10036228 | Ga0207649_100362283 | 336 |
| 422 | 3300025920 | Ga0207649_10042157 | Ga0207649_100421572 | 336 |
| 423 | 3300025921 | Ga0207652_10002073 | Ga0207652_100020738 | 336 |
| 424 | 3300025921 | Ga0207652_10002917 | Ga0207652_1000291713 | 336 |
| 425 | 3300025921 | Ga0207652_10034175 | Ga0207652_100341754 | 336 |
| 426 | 3300025922 | Ga0207646_10048666 | Ga0207646_100486663 | 336 |
| 427 | 3300025923 | Ga0207681_10012803 | Ga0207681_100128035 | 336 |
| 428 | 3300025923 | Ga0207681_10013491 | Ga0207681_100134916 | 336 |
| 429 | 3300025923 | Ga0207681_10033533 | Ga0207681_100335331 | 336 |
| 430 | 3300025924 | Ga0207694_10062333 | Ga0207694_100623331 | 336 |
| 431 | 3300025924 | Ga0207694_10087633 | Ga0207694_100876332 | 336 |
| 432 | 3300025925 | Ga0207650_10004261 | Ga0207650_100042617 | 336 |
| 433 | 3300025925 | Ga0207650_10012067 | Ga0207650_100120672 | 336 |
| 434 | 3300025925 | Ga0207650_10057237 | Ga0207650_100572373 | 336 |
| 435 | 3300025925 | Ga0207650_10058215 | Ga0207650_100582154 | 336 |
| 436 | 3300025926 | Ga0207659_10022835 | Ga0207659_100228353 | 336 |
| 437 | 3300025926 | Ga0207659_10039822 | Ga0207659_100398223 | 336 |
| 438 | 3300025926 | Ga0207659_10060602 | Ga0207659_100606022 | 336 |
| 439 | 3300025929 | Ga0207664_10001170 | Ga0207664_100011706 | 336 |
| 440 | 3300025929 | Ga0207664_10026494 | Ga0207664_100264943 | 336 |
| 441 | 3300025929 | Ga0207664_10156640 | Ga0207664_101566402 | 336 |
| 442 | 3300025931 | Ga0207644_10136962 | Ga0207644_101369622 | 336 |
| 443 | 3300025932 | Ga0207690_10024833 | Ga0207690_100248334 | 336 |
| 444 | 3300025932 | Ga0207690_10025295 | Ga0207690_100252954 | 336 |
| 445 | 3300025932 | Ga0207690_10130931 | Ga0207690_101309311 | 336 |
| 446 | 3300025933 | Ga0207706_10000323 | Ga0207706_1000032326 | 336 |
| 447 | 3300025933 | Ga0207706_10016185 | Ga0207706_100161854 | 336 |
| 448 | 3300025933 | Ga0207706_10021738 | Ga0207706_100217385 | 336 |
| 449 | 3300025934 | Ga0207686_10081311 | Ga0207686_100813111 | 336 |
| 450 | 3300025936 | Ga0207670_10079842 | Ga0207670_100798422 | 336 |
| 451 | 3300025937 | Ga0207669_10215795 | Ga0207669_102157951 | 336 |
| 452 | 3300025940 | Ga0207691_10003612 | Ga0207691_100036125 | 336 |
| 453 | 3300025940 | Ga0207691_10004648 | Ga0207691_1000464810 | 336 |
| 454 | 3300025940 | Ga0207691_10057706 | Ga0207691_100577062 | 336 |
| 455 | 3300025941 | Ga0207711_10015445 | Ga0207711_100154456 | 336 |
| 456 | 3300025941 | Ga0207711_10258708 | Ga0207711_102587081 | 336 |
| 457 | 3300025942 | Ga0207689_10001442 | Ga0207689_1000144213 | 336 |
| 458 | 3300025942 | Ga0207689_10019703 | Ga0207689_100197033 | 336 |
| 459 | 3300025942 | Ga0207689_10051357 | Ga0207689_100513574 | 336 |
| 460 | 3300025944 | Ga0207661_10000242 | Ga0207661_100002428 | 336 |
| 461 | 3300025944 | Ga0207661_10000342 | Ga0207661_100003425 | 336 |
| 462 | 3300025944 | Ga0207661_10004112 | Ga0207661_100041123 | 336 |
| 463 | 3300025944 | Ga0207661_10065353 | Ga0207661_100653531 | 336 |
| 464 | 3300025944 | Ga0207661_10148792 | Ga0207661_101487922 | 336 |
| 465 | 3300025945 | Ga0207679_10000498 | Ga0207679_1000049812 | 336 |
| 466 | 3300025945 | Ga0207679_10009176 | Ga0207679_100091767 | 336 |
| 467 | 3300025945 | Ga0207679_10018472 | Ga0207679_100184722 | 336 |
| 468 | 3300025945 | Ga0207679_10067805 | Ga0207679_100678052 | 336 |
| 469 | 3300025949 | Ga0207667_10103863 | Ga0207667_101038632 | 336 |
| 470 | 3300025949 | Ga0207667_10122882 | Ga0207667_101228821 | 336 |
| 471 | 3300025960 | Ga0207651_10049697 | Ga0207651_100496972 | 336 |
| 472 | 3300025960 | Ga0207651_10093774 | Ga0207651_100937743 | 336 |
| 473 | 3300025961 | Ga0207712_10002381 | Ga0207712_100023816 | 336 |
| 474 | 3300025972 | Ga0207668_10012005 | Ga0207668_100120053 | 336 |
| 475 | 3300025981 | Ga0207640_10017119 | Ga0207640_100171193 | 336 |
| 476 | 3300025981 | Ga0207640_10104183 | Ga0207640_101041832 | 336 |
| 477 | 3300025981 | Ga0207640_10169213 | Ga0207640_101692131 | 336 |
| 478 | 3300025986 | Ga0207658_10055909 | Ga0207658_100559091 | 336 |
| 479 | 3300025986 | Ga0207658_10183875 | Ga0207658_101838752 | 336 |
| 480 | 3300026023 | Ga0207677_10037705 | Ga0207677_100377054 | 336 |
| 481 | 3300026023 | Ga0207677_10086793 | Ga0207677_100867932 | 336 |
| 482 | 3300026035 | Ga0207703_10070038 | Ga0207703_100700382 | 336 |
| 483 | 3300026041 | Ga0207639_10241135 | Ga0207639_102411351 | 336 |
| 484 | 3300026088 | Ga0207641_10054611 | Ga0207641_100546111 | 336 |
| 485 | 3300026088 | Ga0207641_10089255 | Ga0207641_100892551 | 336 |
| 486 | 3300026089 | Ga0207648_10018714 | Ga0207648_100187142 | 336 |
| 487 | 3300026095 | Ga0207676_10029857 | Ga0207676_100298572 | 336 |
| 488 | 3300026095 | Ga0207676_10037558 | Ga0207676_100375583 | 336 |
| 489 | 3300026095 | Ga0207676_10175835 | Ga0207676_101758352 | 336 |
| 490 | 3300026116 | Ga0207674_10000387 | Ga0207674_1000038712 | 336 |
| 491 | 3300026116 | Ga0207674_10001900 | Ga0207674_100019009 | 336 |
| 492 | 3300026116 | Ga0207674_10003885 | Ga0207674_100038856 | 336 |
| 493 | 3300026116 | Ga0207674_10090003 | Ga0207674_100900031 | 336 |
| 494 | 3300026118 | Ga0207675_100000372 | Ga0207675_10000037218 | 336 |
| 495 | 3300026142 | Ga0207698_10088078 | Ga0207698_100880782 | 336 |
| 496 | 3300027512 | Ga0209179_1003005 | Ga0209179_10030053 | 336 |
| 497 | 3300028380 | Ga0268265_10021415 | Ga0268265_100214153 | 336 |
| 498 | 3300028380 | Ga0268265_10065843 | Ga0268265_100658432 | 336 |
| 499 | 3300028381 | Ga0268264_10017322 | Ga0268264_100173224 | 336 |
| 500 | 3300028381 | Ga0268264_10095140 | Ga0268264_100951402 | 336 |
| 501 | 3300032005 | Ga0307411_10169732 | Ga0307411_101697321 | 336 |
| 502 | 3300032126 | Ga0307415_100213268 | Ga0307415_1002132682 | 336 |
| 503 | 3300035086 | Ga0373934_0000730 | Ga0373934_0000730_1320_2369 | 336 |
| 504 | 3300035117 | Ga0373953_0000876 | Ga0373953_0000876_4613_5626 | 336 |
| 505 | 3300035120 | Ga0373957_0031223 | Ga0373957_0031223_160_1209 | 336 |
| 506 | 3300035172 | Ga0373955_0001343 | Ga0373955_0001343_764_1777 | 336 |
| 507 | 3300035172 | Ga0373955_0040724 | Ga0373955_0040724_64_1113 | 336 |
| 508 | 3300035410 | Ga0373924_0064900 | Ga0373924_0064900_286_1335 | 336 |
| 509 | 3300035691 | Ga0373931_0003938 | Ga0373931_0003938_5576_6664 | 336 |
| 510 | 3300035692 | Ga0373935_0022863 | Ga0373935_0022863_2693_3787 | 336 |
| 511 | 3300035695 | Ga0373927_0046018 | Ga0373927_0046018_1788_2801 | 336 |
| 512 | 3300035695 | Ga0373927_0102956 | Ga0373927_0102956_367_1440 | 336 |
| 513 | 3300035695 | Ga0373927_0120722 | Ga0373927_0120722_395_1468 | 336 |
| 514 | 3300035724 | Ga0373933_0000183 | Ga0373933_0000183_8591_9604 | 336 |
| 515 | 3300035724 | Ga0373933_0028129 | Ga0373933_0028129_908_1957 | 336 |
| 516 | 3300036401 | Ga0373937_0000101 | Ga0373937_0000101_72081_73130 | 336 |
| 517 | 3300036401 | Ga0373937_0000533 | Ga0373937_0000533_31751_32764 | 336 |
| 518 | 3300037068 | Ga0373925_0097537 | Ga0373925_0097537_610_1683 | 336 |
| 519 | 3300045976 | Ga0466967_0036446 | Ga0466967_0036446_950_2011 | 336 |
| 520 | 3300046459 | Ga0495629_0015420 | Ga0495629_0015420_751_1764 | 336 |
| 521 | 3300046459 | Ga0495629_0085993 | Ga0495629_0085993_688_1809 | 336 |
| 522 | 3300046462 | Ga0495651_0000911 | Ga0495651_0000911_12523_13536 | 336 |
| 523 | 3300046462 | Ga0495651_0078262 | Ga0495651_0078262_955_2076 | 336 |
| 524 | 3300046463 | Ga0495653_0000271 | Ga0495653_0000271_9207_10220 | 336 |
| 525 | 3300046472 | Ga0495580_0011023 | Ga0495580_0011023_2821_3834 | 336 |
| 526 | 3300046472 | Ga0495580_0109690 | Ga0495580_0109690_614_1687 | 336 |
| 527 | 3300046476 | Ga0495662_0002568 | Ga0495662_0002568_2361_3482 | 336 |
| 528 | 3300046477 | Ga0495664_0118044 | Ga0495664_0118044_112_1245 | 336 |
| 529 | 3300046499 | Ga0495594_0003439 | Ga0495594_0003439_402_1454 | 336 |
| 530 | 3300046500 | Ga0495596_0039657 | Ga0495596_0039657_737_1813 | 336 |
| 531 | 3300046511 | Ga0495608_0000232 | Ga0495608_0000232_24887_25900 | 336 |
| 532 | 3300046516 | Ga0495628_0000358 | Ga0495628_0000358_31765_32778 | 336 |
| 533 | 3300046516 | Ga0495628_0011653 | Ga0495628_0011653_3130_4179 | 336 |
| 534 | 3300046516 | Ga0495628_0032366 | Ga0495628_0032366_741_1862 | 336 |
| 535 | 3300046516 | Ga0495628_0116706 | Ga0495628_0116706_574_1707 | 336 |
| 536 | 3300046517 | Ga0495630_0036356 | Ga0495630_0036356_2318_3439 | 336 |
| 537 | 3300046517 | Ga0495630_0056829 | Ga0495630_0056829_1333_2346 | 336 |
| 538 | 3300046529 | Ga0495652_0004164 | Ga0495652_0004164_6470_7483 | 336 |
| 539 | 3300046531 | Ga0495665_0022579 | Ga0495665_0022579_1206_2279 | 336 |
| 540 | 3300046533 | Ga0495640_0044853 | Ga0495640_0044853_1030_2151 | 336 |
| 541 | 3300046535 | Ga0495586_0014366 | Ga0495586_0014366_2376_3497 | 336 |
| 542 | 3300046536 | Ga0495587_0000229 | Ga0495587_0000229_31702_32715 | 336 |
| 543 | 3300046536 | Ga0495587_0003098 | Ga0495587_0003098_480_1529 | 336 |
| 544 | 3300046536 | Ga0495587_0094779 | Ga0495587_0094779_468_1589 | 336 |
| 545 | 3300046543 | Ga0495645_0000066 | Ga0495645_0000066_11746_12795 | 336 |
| 546 | 3300046543 | Ga0495645_0158314 | Ga0495645_0158314_423_1556 | 336 |
| 547 | 3300046559 | Ga0495667_0055974 | Ga0495667_0055974_852_1865 | 336 |
| 548 | 3300046642 | Ga0495634_0027875 | Ga0495634_0027875_757_1878 | 336 |
| 549 | 3300046663 | Ga0495635_0000260 | Ga0495635_0000260_31762_32775 | 336 |
| 550 | 3300046663 | Ga0495635_0021470 | Ga0495635_0021470_1666_2799 | 336 |
| 551 | 3300046674 | Ga0495588_0003711 | Ga0495588_0003711_3072_4130 | 336 |
| 552 | 3300046675 | Ga0495657_0000794 | Ga0495657_0000794_8795_9808 | 336 |
| 553 | 3300046675 | Ga0495657_0112076 | Ga0495657_0112076_35_1156 | 336 |
| 554 | 3300046678 | Ga0495599_0000280 | Ga0495599_0000280_28999_30012 | 336 |
| 555 | 3300046678 | Ga0495599_0037141 | Ga0495599_0037141_781_1830 | 336 |
| 556 | 3300046678 | Ga0495599_0149234 | Ga0495599_0149234_304_1377 | 336 |
| 557 | 3300046679 | Ga0495623_0000151 | Ga0495623_0000151_10096_11109 | 336 |
| 558 | 3300046679 | Ga0495623_0007045 | Ga0495623_0007045_3851_4900 | 336 |
| 559 | 3300046679 | Ga0495623_0083187 | Ga0495623_0083187_570_1691 | 336 |
| 560 | 3300046680 | Ga0495646_0000547 | Ga0495646_0000547_4144_5157 | 336 |
| 561 | 3300046680 | Ga0495646_0065257 | Ga0495646_0065257_379_1500 | 336 |
| 562 | 3300046689 | Ga0495613_0107300 | Ga0495613_0107300_393_1514 | 336 |
| 563 | 3300046689 | Ga0495613_0120525 | Ga0495613_0120525_134_1267 | 336 |
| 564 | 3300046809 | Ga0495600_0000207 | Ga0495600_0000207_24927_25940 | 336 |
| 565 | 3300047317 | Ga0495604_0000633 | Ga0495604_0000633_10755_11768 | 336 |
| 566 | 3300047319 | Ga0495674_0042232 | Ga0495674_0042232_2632_3753 | 336 |
| 567 | 3300047319 | Ga0495674_0062955 | Ga0495674_0062955_657_1790 | 336 |
| 568 | 3300047322 | Ga0495680_0041861 | Ga0495680_0041861_669_1802 | 336 |
| 569 | 3300047322 | Ga0495680_0047098 | Ga0495680_0047098_1095_2108 | 336 |
| 570 | 3300047322 | Ga0495680_0152975 | Ga0495680_0152975_320_1441 | 336 |
| 571 | 3300047444 | Ga0495675_0001467 | Ga0495675_0001467_8545_9558 | 336 |
| 572 | 3300047444 | Ga0495675_0007513 | Ga0495675_0007513_4115_5164 | 336 |
| 573 | 3300047447 | Ga0495685_049190 | Ga0495685_049190_54_1130 | 336 |
| 574 | 3300047471 | Ga0495684_0000428 | Ga0495684_0000428_1486_2499 | 336 |
| 575 | 3300047471 | Ga0495684_0023109 | Ga0495684_0023109_2314_3327 | 336 |
| 576 | 3300048088 | Ga0495602_0000545 | Ga0495602_0000545_31825_32838 | 336 |
| 577 | 3300048907 | Ga0496104_0220651 | Ga0496104_0220651_297_1310 | 336 |
| 578 | 3300048908 | Ga0496105_0152252 | Ga0496105_0152252_303_1355 | 336 |
| 579 | 3300048911 | Ga0496108_0103884 | Ga0496108_0103884_597_1658 | 336 |
| 580 | 3300048915 | Ga0496112_0000846 | Ga0496112_0000846_228_1316 | 336 |
| 581 | 3300048918 | Ga0496115_0017289 | Ga0496115_0017289_2137_3165 | 336 |
| 582 | 3300049592 | Ga0501076_0121273 | Ga0501076_0121273_627_1802 | 336 |
| 583 | 3300049742 | Ga0501080_0251639 | Ga0501080_0251639_335_1510 | 336 |
| 584 | 3300050507 | nmdc:mga05p37_24424_c1 | nmdc:mga05p37_24424_c1_1526_2587 | 336 |
| 585 | 3300050508 | nmdc:mga09592_72317_c1 | nmdc:mga09592_72317_c1_348_1409 | 336 |
| 586 | 3300050509 | nmdc:mga0qj67_112725_c1 | nmdc:mga0qj67_112725_c1_199_1332 | 336 |
| 587 | 3300050509 | nmdc:mga0qj67_1382_c1 | nmdc:mga0qj67_1382_c1_2081_3211 | 336 |
| 588 | 3300050509 | nmdc:mga0qj67_84077_c1 | nmdc:mga0qj67_84077_c1_696_1904 | 336 |
| 589 | 3300050510 | nmdc:mga06r32_49191_c1 | nmdc:mga06r32_49191_c1_455_1663 | 336 |
| 590 | 3300050511 | nmdc:mga08y16_70444_c1 | nmdc:mga08y16_70444_c1_1266_2327 | 336 |
| 591 | 3300050512 | nmdc:mga0n895_6143_c1 | nmdc:mga0n895_6143_c1_69_1130 | 336 |
| 592 | 3300050513 | nmdc:mga0rr50_172416_c1 | nmdc:mga0rr50_172416_c1_625_1638 | 336 |
| 593 | 3300050513 | nmdc:mga0rr50_45706_c1 | nmdc:mga0rr50_45706_c1_206_1264 | 336 |
| 594 | 3300050515 | nmdc:mga0a205_1390_c1 | nmdc:mga0a205_1390_c1_6305_7366 | 336 |
| 595 | 3300053077 | Ga0495601_0056482 | Ga0495601_0056482_250_1263 | 336 |
| 596 | 3300053078 | Ga0495612_0000937 | Ga0495612_0000937_1756_2769 | 336 |
| 597 | 3300053085 | Ga0495619_0010425 | Ga0495619_0010425_716_1729 | 336 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sqc-assembly3.cif.gz_C | squalene-hopene cyclase | 0.5029 | 23 | 222 |
| 6o60-assembly1.cif.gz_B | crystal structure of ggtase3-fbxl2-skp1 complex | 0.4927 | 23 | 224 |
| 3c72-assembly1.cif.gz_B | engineered rabggtase in complex with a peptidomimetic inhibitor | 0.4844 | 23 | 257 |
| 1gxo-assembly1.cif.gz_A | mutant d189a of family 10 polysaccharide lyase from cellvibrio cellulosa in complex with trigalaturonic acid | 0.4457 | 20 | 204 |
| 8enu-assembly1.cif.gz_H | structure of the c3bb proconvertase in complex with lufaxin | 0.4422 | 58 | 321 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6LG90_353_536_1.50.10.20 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.5608 | 25 | 196 | 1.50.10.20 |
| af_Q4DDP3_167_393_2.60.40.1230 | Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain | 0.5156 | 58 | 209 | 2.60.40.1230 |
| af_Q9URV2_1077_1221_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5074 | 59 | 191 | 1.25.10.10 |
| 1h35A01 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.4749 | 24 | 332 | 1.50.10.20 |
| af_A0A1D6LG90_353_536_1.50.10.20 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.4595 | 25 | 196 | 1.50.10.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7RYQ0-F1-model_v4 | Uncharacterized protein | 0.9785 | 153 | 336 |
|
| AF-A0A2V7RYQ0-F1-model_v4 | Uncharacterized protein | 0.9733 | 153 | 336 |
|
| AF-A0A2V7SZ84-F1-model_v4 | Uncharacterized protein | 0.973 | 42 | 336 |
|
| AF-A0A7Y5QND2-F1-model_v4 | Uncharacterized protein | 0.9695 | 21 | 336 |
|
| AF-A0A2V7EFG4-F1-model_v4 | Uncharacterized protein | 0.9692 | 100 | 336 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar