F467657

General Info

Members Datasets Scaffolds Average Seq Length
597 191 597 205

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10493795|Ga0114129_104937952
Length 216
Sequence VRNTVGEEDRMATTQWQISGQYFEACSCDSVCPCPTSGLTARPTKGSCDVGLVFQVDRGQHGATRLDGLSFAVLAHTPGPMIQGNWTVGLILDERATAPQREALTAIASGQGGGPMAALAPLIGRFAGVEAKPITITQDGMRRSVSIPGALDLAIEGIPGAKSTEPIWFDNVGHPAASRLALAKASRSHLHAFGIDWDDTTGRNNGHFAPFAWSSS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.5
Rhizosphere 99.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10077564 3300003203 Unclassified 1026
2 Ga0068869_100015087 3300005334 Bacteria 5173
3 Ga0068869_100104773 3300005334 Bacteria 2144
4 Ga0068869_100266829 3300005334 Unclassified 1372
5 Ga0070680_100050763 3300005336 Bacteria 3384
6 Ga0070680_100146861 3300005336 Bacteria 1979
7 Ga0070680_100372909 3300005336 Archaea 1214
8 Ga0070689_100397687 3300005340 Unclassified 1164
9 Ga0070689_100594580 3300005340 Bacteria 958
10 Ga0070692_10316521 3300005345 Bacteria 958
11 Ga0070692_10528465 3300005345 Unclassified 769
12 Ga0070668_100640236 3300005347 Unclassified 933
13 Ga0070669_100115364 3300005353 Bacteria 2043
14 Ga0070669_100312200 3300005353 Bacteria 1268
15 Ga0070669_100672769 3300005353 Bacteria 872
16 Ga0070675_100207723 3300005354 Bacteria 1701
17 Ga0070671_100906112 3300005355 Unclassified 770
18 Ga0070674_101046100 3300005356 Bacteria 718
19 Ga0070667_100088682 3300005367 Bacteria 2656
20 Ga0070703_10015824 3300005406 Bacteria 2161
21 Ga0070701_10021450 3300005438 Bacteria 3083
22 Ga0070711_100023739 3300005439 Bacteria 3993
23 Ga0070705_100009045 3300005440 Bacteria 4944
24 Ga0070705_100039317 3300005440 Bacteria 2683
25 Ga0070705_100126914 3300005440 Unclassified 1658
26 Ga0070700_100060078 3300005441 Bacteria 2395
27 Ga0070700_100677292 3300005441 Bacteria 817
28 Ga0070694_100021129 3300005444 Bacteria 4156
29 Ga0070694_100033319 3300005444 Bacteria 3389
30 Ga0070694_100094443 3300005444 Bacteria 2104
31 Ga0070694_100101247 3300005444 Bacteria 2038
32 Ga0070694_100108826 3300005444 Bacteria 1972
33 Ga0070708_100036527 3300005445 Bacteria 4285
34 Ga0070708_100086820 3300005445 Unclassified 2842
35 Ga0070708_100115938 3300005445 Unclassified 2466
36 Ga0070708_100137581 3300005445 Unclassified 2264
37 Ga0070708_100137587 3300005445 Bacteria 2263
38 Ga0070708_100190560 3300005445 Unclassified 1918
39 Ga0070708_100574990 3300005445 Unclassified 1062
40 Ga0070662_100015202 3300005457 Bacteria 5152
41 Ga0070662_100266694 3300005457 Bacteria 1381
42 Ga0070681_10261757 3300005458 Bacteria 1642
43 Ga0068867_100071295 3300005459 Bacteria 2599
44 Ga0068867_100202353 3300005459 Bacteria 1590
45 Ga0070706_100020500 3300005467 Bacteria 6092
46 Ga0070706_100026957 3300005467 Bacteria 5288
47 Ga0070706_100050460 3300005467 Bacteria 3840
48 Ga0070706_100142860 3300005467 Unclassified 2234
49 Ga0070706_100482166 3300005467 Bacteria 1154
50 Ga0070706_100503517 3300005467 Bacteria 1127
51 Ga0070706_100640324 3300005467 Bacteria 987
52 Ga0070707_100016010 3300005468 Bacteria 7036
53 Ga0070707_100162460 3300005468 Unclassified 2176
54 Ga0070707_100336629 3300005468 Bacteria 1466
55 Ga0070707_100616473 3300005468 Unclassified 1048
56 Ga0070698_100011370 3300005471 Bacteria 9447
57 Ga0070698_100026074 3300005471 Bacteria 6087
58 Ga0070698_100642937 3300005471 Bacteria 1002
59 Ga0070699_100003484 3300005518 Bacteria 13912
60 Ga0070699_100005636 3300005518 Bacteria 10976
61 Ga0070699_100030643 3300005518 Bacteria 4644
62 Ga0070699_100033332 3300005518 Bacteria 4449
63 Ga0070699_100043924 3300005518 Bacteria 3868
64 Ga0070699_100187087 3300005518 Bacteria 1839
65 Ga0070699_100784463 3300005518 Unclassified 872
66 Ga0070679_100597845 3300005530 Bacteria 1046
67 Ga0070697_100005465 3300005536 Bacteria 9793
68 Ga0070697_100007192 3300005536 Bacteria 8656
69 Ga0070697_100078344 3300005536 Bacteria 2719
70 Ga0070697_100155476 3300005536 Bacteria 1930
71 Ga0070697_100269042 3300005536 Unclassified 1460
72 Ga0070697_100382704 3300005536 Bacteria 1219
73 Ga0070697_100708180 3300005536 Unclassified 888
74 Ga0070686_100099270 3300005544 Unclassified 1964
75 Ga0070695_100000221 3300005545 Bacteria 27872
76 Ga0070695_100005442 3300005545 Bacteria 7491
77 Ga0070695_100025890 3300005545 Bacteria 3626
78 Ga0070695_100044206 3300005545 Bacteria 2834
79 Ga0070695_100561683 3300005545 Unclassified 891
80 Ga0070696_100030363 3300005546 Unclassified 3700
81 Ga0070696_100066053 3300005546 Bacteria 2536
82 Ga0070696_100279112 3300005546 Bacteria 1273
83 Ga0070696_100406978 3300005546 Unclassified 1066
84 Ga0070693_100205017 3300005547 Bacteria 1283
85 Ga0070704_100053834 3300005549 Bacteria 2845
86 Ga0070704_100077256 3300005549 Bacteria 2438
87 Ga0070704_100140824 3300005549 Unclassified 1883
88 Ga0070704_100319314 3300005549 Archaea 1301
89 Ga0068857_100062377 3300005577 Bacteria 3313
90 Ga0068857_100346557 3300005577 Unclassified 1375
91 Ga0070702_100081000 3300005615 Bacteria 1944
92 Ga0068859_100043483 3300005617 Bacteria 4514
93 Ga0068859_100241172 3300005617 Bacteria 1897
94 Ga0068859_100601695 3300005617 Bacteria 1192
95 Ga0068859_100977229 3300005617 Unclassified 929
96 Ga0068864_100116617 3300005618 Bacteria 2383
97 Ga0068861_100064989 3300005719 Bacteria 2809
98 Ga0068861_101188663 3300005719 Unclassified 737
99 Ga0068870_10352883 3300005840 Unclassified 944
100 Ga0068863_100100242 3300005841 Unclassified 2753
101 Ga0068858_100191690 3300005842 Unclassified 1931
102 Ga0068858_100456779 3300005842 Unclassified 1231
103 Ga0068858_100503684 3300005842 Bacteria 1170
104 Ga0068858_100866548 3300005842 Bacteria 882
105 Ga0068860_100052240 3300005843 Bacteria 3888
106 Ga0068860_100132460 3300005843 Unclassified 2393
107 Ga0068860_100176340 3300005843 Bacteria 2066
108 Ga0068860_100690510 3300005843 Unclassified 1030
109 Ga0068862_100057797 3300005844 Bacteria 3327
110 Ga0068862_100083486 3300005844 Bacteria 2774
111 Ga0068862_100227702 3300005844 Unclassified 1690
112 Ga0068862_100586671 3300005844 Bacteria 1068
113 Ga0081455_10003397 3300005937 Bacteria 18331
114 Ga0081539_10000259 3300005985 Bacteria 121997
115 Ga0070717_11005790 3300006028 Archaea 759
116 Ga0070716_100002408 3300006173 Bacteria 8607
117 Ga0070712_100008419 3300006175 Bacteria 6489
118 Ga0075428_100000409 3300006844 Bacteria 42695
119 Ga0075428_100002009 3300006844 Bacteria 21936
120 Ga0075428_100016544 3300006844 Bacteria 8143
121 Ga0075428_100032654 3300006844 Bacteria 5748
122 Ga0075428_100033386 3300006844 Bacteria 5683
123 Ga0075428_100059085 3300006844 Bacteria 4199
124 Ga0075428_100261016 3300006844 Unclassified 1865
125 Ga0075428_100341359 3300006844 Bacteria 1608
126 Ga0075430_100000648 3300006846 Bacteria 26549
127 Ga0075430_100010911 3300006846 Bacteria 7696
128 Ga0075430_100016650 3300006846 Bacteria 6260
129 Ga0075430_100036386 3300006846 Bacteria 4175
130 Ga0075430_100037863 3300006846 Bacteria 4089
131 Ga0075430_100088073 3300006846 Bacteria 2598
132 Ga0075430_100189799 3300006846 Bacteria 1708
133 Ga0075430_100541744 3300006846 Unclassified 960
134 Ga0075431_100000309 3300006847 Bacteria 38472
135 Ga0075431_100000454 3300006847 Bacteria 33687
136 Ga0075431_100000773 3300006847 Bacteria 27751
137 Ga0075431_100009238 3300006847 Bacteria 9895
138 Ga0075431_100054542 3300006847 Bacteria 4122
139 Ga0075431_100138829 3300006847 Unclassified 2506
140 Ga0075431_100143496 3300006847 Bacteria 2461
141 Ga0075431_100150289 3300006847 Bacteria 2399
142 Ga0075431_100175481 3300006847 Bacteria 2201
143 Ga0075431_100259179 3300006847 Unclassified 1765
144 Ga0075431_100676654 3300006847 Bacteria 1011
145 Ga0075433_10001946 3300006852 Bacteria 15529
146 Ga0075433_10021968 3300006852 Bacteria 5354
147 Ga0075433_10029060 3300006852 Bacteria 4707
148 Ga0075433_10049025 3300006852 Bacteria 3674
149 Ga0075433_10068391 3300006852 Bacteria 3118
150 Ga0075433_10100066 3300006852 Bacteria 2566
151 Ga0075433_10114019 3300006852 Bacteria 2398
152 Ga0075433_10210242 3300006852 Bacteria 1729
153 Ga0075433_10241388 3300006852 Bacteria 1604
154 Ga0075433_10490994 3300006852 Unclassified 1081
155 Ga0075434_100002428 3300006871 Bacteria 16376
156 Ga0075434_100008835 3300006871 Bacteria 9377
157 Ga0075434_100013842 3300006871 Bacteria 7693
158 Ga0075434_100014502 3300006871 Bacteria 7534
159 Ga0075434_100021309 3300006871 Bacteria 6300
160 Ga0075434_100025057 3300006871 Bacteria 5835
161 Ga0075434_100036075 3300006871 Bacteria 4889
162 Ga0075434_100094429 3300006871 Bacteria 2996
163 Ga0075434_100185406 3300006871 Bacteria 2101
164 Ga0075434_100402868 3300006871 Unclassified 1389
165 Ga0075434_100500800 3300006871 Bacteria 1235
166 Ga0075429_100000116 3300006880 Bacteria 45959
167 Ga0075429_100002908 3300006880 Bacteria 14516
168 Ga0075429_100004527 3300006880 Bacteria 11955
169 Ga0075429_100005985 3300006880 Bacteria 10512
170 Ga0075429_100018102 3300006880 Bacteria 6095
171 Ga0075429_100044968 3300006880 Bacteria 3841
172 Ga0075429_100064013 3300006880 Bacteria 3203
173 Ga0075429_100251350 3300006880 Bacteria 1548
174 Ga0075436_100001411 3300006914 Bacteria 16336
175 Ga0075436_100017120 3300006914 Bacteria 4960
176 Ga0075436_100189287 3300006914 Bacteria 1456
177 Ga0075436_100678434 3300006914 Unclassified 762
178 Ga0097620_100043484 3300006931 Bacteria 4514
179 Ga0097620_100241150 3300006931 Bacteria 1897
180 Ga0097620_100601775 3300006931 Bacteria 1192
181 Ga0097620_100977217 3300006931 Unclassified 929
182 Ga0075435_100003300 3300007076 Bacteria 10941
183 Ga0075435_100009489 3300007076 Bacteria 7050
184 Ga0075435_100022072 3300007076 Bacteria 4908
185 Ga0075435_100029119 3300007076 Bacteria 4333
186 Ga0075435_100337021 3300007076 Unclassified 1292
187 Ga0099794_10032889 3300007265 Bacteria 2436
188 Ga0099794_10145062 3300007265 Unclassified 1203
189 Ga0111539_10012414 3300009094 Bacteria 10683
190 Ga0111539_10021696 3300009094 Bacteria 7899
191 Ga0111539_10026196 3300009094 Bacteria 7135
192 Ga0111539_10029369 3300009094 Bacteria 6698
193 Ga0111539_10251040 3300009094 Bacteria 2060
194 Ga0111539_10824636 3300009094 Unclassified 1079
195 Ga0114129_10000065 3300009147 Bacteria 94355
196 Ga0114129_10008581 3300009147 Bacteria 14569
197 Ga0114129_10018194 3300009147 Bacteria 10004
198 Ga0114129_10023686 3300009147 Bacteria 8703
199 Ga0114129_10024663 3300009147 Bacteria 8524
200 Ga0114129_10026469 3300009147 Bacteria 8212
201 Ga0114129_10037511 3300009147 Bacteria 6842
202 Ga0114129_10042025 3300009147 Bacteria 6437
203 Ga0114129_10060953 3300009147 Bacteria 5274
204 Ga0114129_10066869 3300009147 Bacteria 5012
205 Ga0114129_10154075 3300009147 Bacteria 3144
206 Ga0114129_10195581 3300009147 Bacteria 2743
207 Ga0114129_10297347 3300009147 Bacteria 2153
208 Ga0114129_10400145 3300009147 Bacteria 1810
209 Ga0114129_10405858 3300009147 Unclassified 1795
210 Ga0114129_10493795 3300009147 Bacteria 1600
211 Ga0114129_11027814 3300009147 Unclassified 1036
212 Ga0105243_10086615 3300009148 Bacteria 2570
213 Ga0105243_10103986 3300009148 Bacteria 2363
214 Ga0105241_11166504 3300009174 Bacteria 728
215 Ga0105242_10018117 3300009176 Bacteria 5500
216 Ga0105242_11297505 3300009176 Unclassified 751
217 Ga0105248_11095887 3300009177 Unclassified 900
218 Ga0105248_11648156 3300009177 Unclassified 727
219 Ga0105249_10016993 3300009553 Bacteria 6455
220 Ga0105249_11571910 3300009553 Unclassified 730
221 Ga0105249_12238589 3300009553 Unclassified 619
222 Ga0157373_10753727 3300013100 Bacteria 716
223 Ga0157371_10146446 3300013102 Bacteria 1683
224 Ga0157378_10656041 3300013297 Unclassified 1065
225 Ga0163162_10376579 3300013306 Unclassified 1553
226 Ga0157380_10500244 3300014326 Bacteria 1180
227 Ga0157379_10182502 3300014968 Bacteria 1896
228 Ga0157376_10323242 3300014969 Bacteria 1467
229 Ga0207653_10054929 3300025885 Unclassified 1333
230 Ga0207653_10068658 3300025885 Unclassified 1208
231 Ga0207680_10461126 3300025903 Bacteria 903
232 Ga0207684_10001638 3300025910 Bacteria 23790
233 Ga0207684_10005022 3300025910 Bacteria 12335
234 Ga0207684_10018648 3300025910 Bacteria 5941
235 Ga0207684_10020078 3300025910 Bacteria 5708
236 Ga0207684_10030586 3300025910 Bacteria 4582
237 Ga0207684_10100073 3300025910 Bacteria 2477
238 Ga0207684_10927075 3300025910 Bacteria 731
239 Ga0207654_10267256 3300025911 Unclassified 1152
240 Ga0207707_10234985 3300025912 Bacteria 1595
241 Ga0207693_10035500 3300025915 Bacteria 3930
242 Ga0207663_10345127 3300025916 Unclassified 1125
243 Ga0207660_10031415 3300025917 Bacteria 3657
244 Ga0207660_10050261 3300025917 Bacteria 2960
245 Ga0207662_10245602 3300025918 Bacteria 1173
246 Ga0207662_10439766 3300025918 Unclassified 890
247 Ga0207646_10001729 3300025922 Bacteria 26558
248 Ga0207646_10004209 3300025922 Bacteria 15753
249 Ga0207646_10084546 3300025922 Bacteria 2839
250 Ga0207646_10121025 3300025922 Bacteria 2351
251 Ga0207646_10179967 3300025922 Bacteria 1909
252 Ga0207681_10668327 3300025923 Bacteria 862
253 Ga0207659_10400010 3300025926 Bacteria 1149
254 Ga0207706_10024045 3300025933 Bacteria 5466
255 Ga0207686_10055130 3300025934 Bacteria 2492
256 Ga0207709_10006527 3300025935 Bacteria 6552
257 Ga0207670_10101655 3300025936 Bacteria 2054
258 Ga0207669_10842315 3300025937 Bacteria 763
259 Ga0207665_10005009 3300025939 Bacteria 8841
260 Ga0207711_10533045 3300025941 Bacteria 1095
261 Ga0207689_10027878 3300025942 Bacteria 4726
262 Ga0207689_10050666 3300025942 Bacteria 3423
263 Ga0207712_10144996 3300025961 Unclassified 1827
264 Ga0207712_10180333 3300025961 Bacteria 1658
265 Ga0207668_10537247 3300025972 Bacteria 1011
266 Ga0207658_10126286 3300025986 Unclassified 2048
267 Ga0207708_10144990 3300026075 Bacteria 1865
268 Ga0207708_10315359 3300026075 Unclassified 1275
269 Ga0207641_10854647 3300026088 Unclassified 902
270 Ga0207648_10081569 3300026089 Bacteria 2821
271 Ga0207674_10017749 3300026116 Bacteria 7756
272 Ga0207674_10667664 3300026116 Unclassified 1004
273 Ga0207675_100499474 3300026118 Unclassified 1211
274 Ga0209968_1000254 3300027526 Bacteria 9110
275 Ga0209982_1006982 3300027552 Bacteria 1649
276 Ga0209970_1000766 3300027614 Bacteria 5611
277 Ga0209983_1004889 3300027665 Bacteria 2799
278 Ga0209588_1090143 3300027671 Bacteria 988
279 Ga0209588_1128271 3300027671 Bacteria 810
280 Ga0209971_1000008 3300027682 Bacteria 102612
281 Ga0209966_1001622 3300027695 Bacteria 3843
282 Ga0209998_10000016 3300027717 Bacteria 85166
283 Ga0209998_10009816 3300027717 Unclassified 1985
284 Ga0209974_10000710 3300027876 Bacteria 11372
285 Ga0207428_10000018 3300027907 Bacteria 293117
286 Ga0207428_10000063 3300027907 Bacteria 151868
287 Ga0207428_10000091 3300027907 Bacteria 125388
288 Ga0207428_10071657 3300027907 Bacteria 2721
289 Ga0207428_10326128 3300027907 Bacteria 1133
290 Ga0268265_10050677 3300028380 Bacteria 3129
291 Ga0268265_10066067 3300028380 Unclassified 2794
292 Ga0268265_10165708 3300028380 Bacteria 1883
293 Ga0268265_10289467 3300028380 Unclassified 1470
294 Ga0268264_10199438 3300028381 Unclassified 1830
295 Ga0268264_10210727 3300028381 Bacteria 1784
296 Ga0268264_10256977 3300028381 Unclassified 1625
297 Ga0268264_10334816 3300028381 Unclassified 1436
298 Ga0268264_10722167 3300028381 Bacteria 991
299 Ga0307408_100013646 3300031548 Bacteria 5395
300 Ga0307408_100018402 3300031548 Bacteria 4690
301 Ga0307408_100041162 3300031548 Bacteria 3275
302 Ga0316576_10095984 3300031727 Bacteria 2212
303 Ga0316576_10302819 3300031727 Unclassified 1194
304 Ga0316578_10217556 3300031728 Bacteria 1149
305 Ga0307405_10123714 3300031731 Bacteria 1775
306 Ga0316577_10560312 3300031733 Unclassified 650
307 Ga0307410_10071726 3300031852 Bacteria 2403
308 Ga0307410_10239539 3300031852 Bacteria 1405
309 Ga0307406_10062802 3300031901 Bacteria 2404
310 Ga0307406_10398424 3300031901 Bacteria 1090
311 Ga0307409_100028240 3300031995 Bacteria 3993
312 Ga0307416_100452439 3300032002 Unclassified 1337
313 Ga0307416_100593181 3300032002 Bacteria 1187
314 Ga0307416_100821347 3300032002 Unclassified 1026
315 Ga0307411_10257832 3300032005 Bacteria 1375
316 Ga0316593_10023280 3300032168 Bacteria 1953
317 Ga0373948_0017021 3300034817 Bacteria 1351
318 Ga0373948_0077913 3300034817 Unclassified 752
319 Ga0373928_0109455 3300035084 Unclassified 729
320 Ga0373940_0003774 3300035088 Bacteria 3132
321 Ga0373940_0006061 3300035088 Unclassified 2658
322 Ga0373940_0017310 3300035088 Unclassified 1796
323 Ga0373951_0053824 3300035091 Bacteria 995
324 Ga0373932_0043183 3300035112 Bacteria 1310
325 Ga0373939_0004128 3300035114 Bacteria 3422
326 Ga0316574_0133950 3300035398 Bacteria 1595
327 Ga0373931_0014239 3300035691 Bacteria 3884
328 Ga0373931_0025013 3300035691 Bacteria 3031
329 Ga0373931_0046835 3300035691 Bacteria 2287
330 Ga0316582_0116794 3300036647 Bacteria 1782
331 Ga0395899_0170432 3300037312 Bacteria 1533
332 Ga0395899_0338067 3300037312 Unclassified 1010
333 Ga0395900_0422969 3300037418 Bacteria 1293
334 Ga0395905_0056466 3300037471 Bacteria 3673
335 Ga0395901_0113025 3300038443 Bacteria 2852
336 Ga0395901_0179834 3300038443 Bacteria 2218
337 Ga0242420_015063 3300038996 Bacteria 1334
338 Ga0439441_032199 3300042001 Bacteria 1021
339 Ga0439450_094923 3300042008 Bacteria 752
340 Ga0439460_0018747 3300042461 Bacteria 1866
341 Ga0451577_0071658 3300042876 Bacteria 3090
342 Ga0451577_0136739 3300042876 Unclassified 2200
343 Ga0451577_0177190 3300042876 Unclassified 1922
344 Ga0451577_0461241 3300042876 Bacteria 1154
345 Ga0451577_0517912 3300042876 Bacteria 1083
346 Ga0453683_0018206 3300044673 Bacteria 4511
347 Ga0453683_0019096 3300044673 Bacteria 4393
348 Ga0453683_0073768 3300044673 Bacteria 2136
349 Ga0453683_0430250 3300044673 Unclassified 852
350 Ga0453684_0037837 3300044712 Bacteria 6615
351 Ga0451576_0069513 3300045051 Bacteria 3664
352 Ga0451576_0114489 3300045051 Bacteria 2808
353 Ga0451576_0153871 3300045051 Unclassified 2398
354 Ga0451576_0391003 3300045051 Unclassified 1458
355 Ga0451576_0676873 3300045051 Unclassified 1084
356 Ga0495580_0003884 3300046472 Bacteria 12636
357 Ga0495584_0290495 3300046491 Bacteria 831
358 Ga0495636_0114153 3300047318 Bacteria 1190
359 Ga0496102_0070213 3300048905 Bacteria 3216
360 Ga0496106_0259375 3300048909 Bacteria 1391
361 Ga0496106_0820734 3300048909 Unclassified 737
362 Ga0501031_0020822 3300049568 Bacteria 4276
363 Ga0501031_0086020 3300049568 Bacteria 2050
364 Ga0501031_0135303 3300049568 Unclassified 1610
365 Ga0501031_0486863 3300049568 Unclassified 796
366 Ga0501032_0215895 3300049569 Bacteria 1249
367 Ga0501032_0316393 3300049569 Unclassified 1008
368 Ga0501033_0112536 3300049570 Bacteria 1980
369 Ga0501033_0323327 3300049570 Unclassified 1083
370 Ga0501036_0011987 3300049572 Bacteria 7186
371 Ga0501036_0028906 3300049572 Bacteria 4685
372 Ga0501036_0047305 3300049572 Unclassified 3644
373 Ga0501036_0071026 3300049572 Bacteria 2944
374 Ga0501036_0186021 3300049572 Bacteria 1748
375 Ga0501038_0000637 3300049574 Bacteria 31123
376 Ga0501038_0073062 3300049574 Bacteria 2905
377 Ga0501038_0080988 3300049574 Bacteria 2736
378 Ga0501038_0093581 3300049574 Unclassified 2514
379 Ga0501038_0581148 3300049574 Unclassified 849
380 Ga0501039_0019329 3300049575 Bacteria 5223
381 Ga0501039_0021708 3300049575 Bacteria 4926
382 Ga0501039_0025460 3300049575 Bacteria 4546
383 Ga0501039_0040862 3300049575 Bacteria 3580
384 Ga0501039_0208659 3300049575 Bacteria 1536
385 Ga0501039_0544103 3300049575 Bacteria 911
386 Ga0501039_0733144 3300049575 Unclassified 772
387 Ga0501040_0000166 3300049576 Bacteria 37216
388 Ga0501040_0044569 3300049576 Bacteria 3024
389 Ga0501040_0044747 3300049576 Bacteria 3018
390 Ga0501040_0059352 3300049576 Bacteria 2628
391 Ga0501040_0076651 3300049576 Bacteria 2312
392 Ga0501040_0111411 3300049576 Bacteria 1914
393 Ga0501040_0119238 3300049576 Bacteria 1850
394 Ga0501040_0151719 3300049576 Bacteria 1635
395 Ga0501040_0201960 3300049576 Unclassified 1411
396 Ga0501040_0576188 3300049576 Bacteria 813
397 Ga0501041_0000298 3300049577 Bacteria 23977
398 Ga0501041_0023484 3300049577 Bacteria 3698
399 Ga0501041_0050010 3300049577 Bacteria 2547
400 Ga0501041_0054025 3300049577 Bacteria 2450
401 Ga0501041_0099419 3300049577 Bacteria 1800
402 Ga0501041_0211871 3300049577 Unclassified 1215
403 Ga0501042_0000055 3300049578 Bacteria 39662
404 Ga0501042_0009072 3300049578 Bacteria 6613
405 Ga0501042_0069915 3300049578 Unclassified 2511
406 Ga0501042_0082944 3300049578 Bacteria 2298
407 Ga0501042_0420519 3300049578 Bacteria 968
408 Ga0501043_0068996 3300049579 Bacteria 2777
409 Ga0501043_0172394 3300049579 Bacteria 1688
410 Ga0501046_0000295 3300049580 Bacteria 50418
411 Ga0501046_0000697 3300049580 Bacteria 32498
412 Ga0501046_0049294 3300049580 Unclassified 3331
413 Ga0501046_0052944 3300049580 Bacteria 3198
414 Ga0501046_0129710 3300049580 Bacteria 1913
415 Ga0501047_0013094 3300049581 Bacteria 7856
416 Ga0501048_0000123 3300049582 Bacteria 44886
417 Ga0501048_0002070 3300049582 Bacteria 15266
418 Ga0501048_0045191 3300049582 Bacteria 3147
419 Ga0501048_0103396 3300049582 Bacteria 2010
420 Ga0501048_0482519 3300049582 Unclassified 889
421 Ga0501067_0093920 3300049583 Bacteria 1665
422 Ga0501067_0115691 3300049583 Archaea 1492
423 Ga0501068_0011235 3300049584 Bacteria 5050
424 Ga0501068_0341724 3300049584 Unclassified 961
425 Ga0501068_0426053 3300049584 Bacteria 857
426 Ga0501068_0575883 3300049584 Bacteria 733
427 Ga0501069_0041989 3300049585 Bacteria 2529
428 Ga0501069_0356606 3300049585 Bacteria 862
429 Ga0501070_0014353 3300049586 Bacteria 6667
430 Ga0501071_0000151 3300049587 Bacteria 29305
431 Ga0501071_0054673 3300049587 Bacteria 2880
432 Ga0501071_0107365 3300049587 Bacteria 2061
433 Ga0501071_0636397 3300049587 Unclassified 820
434 Ga0501072_0000139 3300049588 Bacteria 54279
435 Ga0501072_0015970 3300049588 Bacteria 5756
436 Ga0501072_0022312 3300049588 Unclassified 4911
437 Ga0501072_0137263 3300049588 Bacteria 1950
438 Ga0501072_0174746 3300049588 Bacteria 1713
439 Ga0501072_0185572 3300049588 Bacteria 1659
440 Ga0501072_0285960 3300049588 Bacteria 1311
441 Ga0501074_0003511 3300049590 Bacteria 11128
442 Ga0501074_0105158 3300049590 Bacteria 2021
443 Ga0501074_0677477 3300049590 Bacteria 728
444 Ga0501075_0000051 3300049591 Bacteria 49296
445 Ga0501075_0012681 3300049591 Bacteria 5995
446 Ga0501075_0016833 3300049591 Bacteria 5272
447 Ga0501075_0023296 3300049591 Bacteria 4532
448 Ga0501075_0049369 3300049591 Bacteria 3163
449 Ga0501075_0053170 3300049591 Bacteria 3046
450 Ga0501075_0065926 3300049591 Bacteria 2732
451 Ga0501075_0140120 3300049591 Bacteria 1843
452 Ga0501076_0000008 3300049592 Bacteria 121885
453 Ga0501076_0009355 3300049592 Bacteria 7233
454 Ga0501076_0009862 3300049592 Bacteria 7061
455 Ga0501076_0036165 3300049592 Bacteria 3868
456 Ga0501076_0052678 3300049592 Bacteria 3224
457 Ga0501076_0173751 3300049592 Unclassified 1756
458 Ga0501076_0289380 3300049592 Unclassified 1342
459 Ga0501076_0358834 3300049592 Bacteria 1197
460 Ga0501077_0000800 3300049593 Bacteria 19032
461 Ga0501077_0017732 3300049593 Bacteria 4497
462 Ga0501077_0022071 3300049593 Bacteria 4032
463 Ga0501077_0024172 3300049593 Bacteria 3857
464 Ga0501077_0038106 3300049593 Bacteria 3060
465 Ga0501077_0038910 3300049593 Unclassified 3029
466 Ga0501077_0177399 3300049593 Bacteria 1354
467 Ga0501077_0179323 3300049593 Bacteria 1346
468 Ga0501077_0577979 3300049593 Bacteria 721
469 Ga0501079_0000131 3300049741 Bacteria 40400
470 Ga0501079_0007276 3300049741 Bacteria 8357
471 Ga0501079_0011928 3300049741 Bacteria 6632
472 Ga0501079_0013897 3300049741 Bacteria 6142
473 Ga0501079_0061689 3300049741 Bacteria 2892
474 Ga0501079_0067526 3300049741 Unclassified 2760
475 Ga0501079_0095164 3300049741 Bacteria 2308
476 Ga0501079_0448254 3300049741 Unclassified 1013
477 Ga0501079_0853216 3300049741 Bacteria 717
478 Ga0501080_0035323 3300049742 Bacteria 4665
479 Ga0501080_0043180 3300049742 Bacteria 4197
480 Ga0501080_0049661 3300049742 Bacteria 3905
481 Ga0501080_0167643 3300049742 Bacteria 2026
482 Ga0501080_0277882 3300049742 Bacteria 1523
483 Ga0501081_0003066 3300049743 Bacteria 10605
484 Ga0501081_0004495 3300049743 Bacteria 8954
485 Ga0501081_0008226 3300049743 Bacteria 6773
486 Ga0501081_0019250 3300049743 Bacteria 4543
487 Ga0501081_0030055 3300049743 Unclassified 3675
488 Ga0501081_0077876 3300049743 Bacteria 2317
489 Ga0501081_0085909 3300049743 Bacteria 2209
490 Ga0501081_0432137 3300049743 Bacteria 977
491 Ga0501083_0011523 3300049744 Bacteria 6203
492 Ga0501083_0043357 3300049744 Bacteria 3048
493 Ga0501083_0084739 3300049744 Bacteria 2098
494 Ga0501035_0121611 3300049822 Bacteria 2282
495 Ga0501035_0250762 3300049822 Bacteria 1503
496 Ga0501044_0686712 3300049823 Bacteria 910
497 Ga0501045_0000061 3300049824 Bacteria 50353
498 Ga0501045_0031981 3300049824 Bacteria 3811
499 Ga0501045_0107549 3300049824 Bacteria 2067
500 Ga0501045_0129053 3300049824 Unclassified 1879
501 Ga0501045_0508783 3300049824 Unclassified 894
502 Ga0501045_0681850 3300049824 Bacteria 759
503 nmdc:mga05p37_10296_c1 3300050507 Bacteria 11105
504 nmdc:mga05p37_10664_c1 3300050507 Bacteria 10904
505 nmdc:mga05p37_142322_c1 3300050507 Bacteria 2938
506 nmdc:mga05p37_19852_c1 3300050507 Bacteria 8131
507 nmdc:mga05p37_25174_c1 3300050507 Bacteria 7237
508 nmdc:mga05p37_28896_c2 3300050507 Bacteria 4762
509 nmdc:mga05p37_296196_c1 3300050507 Bacteria 1924
510 nmdc:mga05p37_298843_c1 3300050507 Bacteria 1914
511 nmdc:mga05p37_29990_c1 3300050507 Bacteria 6637
512 nmdc:mga05p37_311357_c1 3300050507 Bacteria 1866
513 nmdc:mga05p37_32003_c1 3300050507 Bacteria 6431
514 nmdc:mga05p37_3522_c1 3300050507 Bacteria 18284
515 nmdc:mga05p37_356586_c1 3300050507 Bacteria 1721
516 nmdc:mga09592_265_c1 3300050508 Bacteria 38165
517 nmdc:mga09592_353894_c1 3300050508 Bacteria 1271
518 nmdc:mga09592_3977_c1 3300050508 Bacteria 11907
519 nmdc:mga09592_523283_c1 3300050508 Bacteria 1020
520 nmdc:mga09592_858_c1 3300050508 Bacteria 23710
521 nmdc:mga09592_8878_c1 3300050508 Bacteria 8175
522 nmdc:mga0qj67_13093_c1 3300050509 Bacteria 6264
523 nmdc:mga0qj67_180789_c1 3300050509 Bacteria 1713
524 nmdc:mga0qj67_23622_c1 3300050509 Bacteria 4731
525 nmdc:mga0qj67_26897_c1 3300050509 Bacteria 4455
526 nmdc:mga0qj67_321931_c1 3300050509 Unclassified 1252
527 nmdc:mga0qj67_35131_c1 3300050509 Bacteria 3917
528 nmdc:mga0qj67_799005_c1 3300050509 Unclassified 747
529 nmdc:mga0qj67_8453_c1 3300050509 Bacteria 7638
530 nmdc:mga06r32_1559_c1 3300050510 Bacteria 20685
531 nmdc:mga06r32_15689_c1 3300050510 Bacteria 6883
532 nmdc:mga06r32_18333_c1 3300050510 Bacteria 6408
533 nmdc:mga06r32_213499_c1 3300050510 Bacteria 1918
534 nmdc:mga06r32_290318_c1 3300050510 Unclassified 1622
535 nmdc:mga06r32_388398_c1 3300050510 Bacteria 1378
536 nmdc:mga06r32_5125_c1 3300050510 Bacteria 11785
537 nmdc:mga06r32_594309_c1 3300050510 Bacteria 1078
538 nmdc:mga06r32_622153_c1 3300050510 Unclassified 1049
539 nmdc:mga06r32_784_c1 3300050510 Bacteria 28098
540 nmdc:mga08y16_138_c1 3300050511 Bacteria 63184
541 nmdc:mga08y16_202132_c1 3300050511 Bacteria 2059
542 nmdc:mga08y16_2413_c1 3300050511 Bacteria 19203
543 nmdc:mga08y16_538120_c1 3300050511 Bacteria 1183
544 nmdc:mga08y16_54806_c1 3300050511 Bacteria 4167
545 nmdc:mga08y16_61503_c1 3300050511 Bacteria 3921
546 nmdc:mga08y16_800870_c1 3300050511 Unclassified 935
547 nmdc:mga0n895_10685_c1 3300050512 Bacteria 8133
548 nmdc:mga0n895_10836_c1 3300050512 Bacteria 8090
549 nmdc:mga0n895_118359_c1 3300050512 Bacteria 2669
550 nmdc:mga0n895_1251388_c1 3300050512 Bacteria 714
551 nmdc:mga0n895_126751_c1 3300050512 Bacteria 2577
552 nmdc:mga0n895_17031_c1 3300050512 Bacteria 6688
553 nmdc:mga0n895_287887_c1 3300050512 Bacteria 1666
554 nmdc:mga0n895_29523_c1 3300050512 Bacteria 5232
555 nmdc:mga0n895_378785_c1 3300050512 Bacteria 1432
556 nmdc:mga0n895_39369_c1 3300050512 Bacteria 4587
557 nmdc:mga0n895_486102_c1 3300050512 Bacteria 1245
558 nmdc:mga0rr50_14392_c1 3300050513 Bacteria 5187
559 nmdc:mga0rr50_4035_c1 3300050513 Bacteria 8565
560 nmdc:mga0rr50_45919_c1 3300050513 Bacteria 3214
561 nmdc:mga0rr50_579963_c1 3300050513 Unclassified 955
562 nmdc:mga0rr50_77925_c1 3300050513 Bacteria 2549
563 nmdc:mga08x19_10981_c1 3300050514 Bacteria 5448
564 nmdc:mga08x19_205769_c1 3300050514 Bacteria 1350
565 nmdc:mga08x19_265505_c1 3300050514 Unclassified 1187
566 nmdc:mga08x19_268518_c1 3300050514 Bacteria 1180
567 nmdc:mga08x19_6121_c1 3300050514 Bacteria 7114
568 nmdc:mga0a205_112397_c1 3300050515 Unclassified 2623
569 nmdc:mga0a205_120966_c1 3300050515 Bacteria 2517
570 nmdc:mga0a205_12102_c1 3300050515 Bacteria 7974
571 nmdc:mga0a205_21087_c1 3300050515 Bacteria 6162
572 nmdc:mga0a205_21191_c2 3300050515 Bacteria 4956
573 nmdc:mga0a205_52423_c1 3300050515 Bacteria 3937
574 nmdc:mga0a205_7228_c1 3300050515 Bacteria 10038
575 Ga0501084_0000174 3300054114 Bacteria 50134
576 Ga0501084_0004586 3300054114 Bacteria 11299
577 Ga0501084_0004793 3300054114 Bacteria 11059
578 Ga0501084_0004982 3300054114 Bacteria 10865
579 Ga0501084_0043807 3300054114 Unclassified 3744
580 Ga0501084_0081395 3300054114 Bacteria 2716
581 Ga0501084_0097432 3300054114 Bacteria 2469
582 Ga0590075_045893 3300059424 Unclassified 1119
583 Ga0501082_0001603 3300060353 Bacteria 19926
584 Ga0501082_0003815 3300060353 Bacteria 13177
585 Ga0501082_0005513 3300060353 Bacteria 10983
586 Ga0501082_0018214 3300060353 Bacteria 6047
587 Ga0501082_0029010 3300060353 Unclassified 4767
588 Ga0501082_0149432 3300060353 Bacteria 2029
589 Ga0501082_0308417 3300060353 Bacteria 1378
590 Ga0501082_0393537 3300060353 Bacteria 1209
591 Ga0501082_0400049 3300060353 Archaea 1199
592 Ga0530510_0000120 3300061734 Bacteria 44746
593 Ga0530510_0035270 3300061734 Bacteria 3605
594 Ga0530510_0091747 3300061734 Bacteria 2216
595 Ga0530510_0142629 3300061734 Bacteria 1766
596 Ga0530510_0551574 3300061734 Bacteria 875
597 Ga0530510_0582843 3300061734 Bacteria 850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_486102_c1 nmdc:mga0n895_486102_c1_71_580 165
2 3300025915 Ga0207693_10035500 Ga0207693_100355006 176
3 3300009147 Ga0114129_10037511 Ga0114129_100375114 177
4 3300038996 Ga0242420_015063 Ga0242420_015063_38_571 177
5 3300049583 Ga0501067_0093920 Ga0501067_0093920_349_882 177
6 3300050507 nmdc:mga05p37_28896_c2 nmdc:mga05p37_28896_c2_1778_2311 177
7 3300050512 nmdc:mga0n895_378785_c1 nmdc:mga0n895_378785_c1_590_1123 177
8 3300009176 Ga0105242_11297505 Ga0105242_112975051 178
9 3300050512 nmdc:mga0n895_10685_c1 nmdc:mga0n895_10685_c1_125_661 178
10 3300050513 nmdc:mga0rr50_77925_c1 nmdc:mga0rr50_77925_c1_402_938 178
11 3300050514 nmdc:mga08x19_10981_c1 nmdc:mga08x19_10981_c1_1618_2154 178
12 3300050515 nmdc:mga0a205_21087_c1 nmdc:mga0a205_21087_c1_4610_5146 178
13 3300005356 Ga0070674_101046100 Ga0070674_1010461001 182
14 3300025937 Ga0207669_10842315 Ga0207669_108423151 182
15 3300031727 Ga0316576_10302819 Ga0316576_103028192 185
16 3300049593 Ga0501077_0577979 Ga0501077_0577979_124_681 185
17 3300009553 Ga0105249_12238589 Ga0105249_122385891 186
18 3300050514 nmdc:mga08x19_268518_c1 nmdc:mga08x19_268518_c1_11_571 186
19 3300031727 Ga0316576_10095984 Ga0316576_100959843 192
20 3300031728 Ga0316578_10217556 Ga0316578_102175561 192
21 3300031733 Ga0316577_10560312 Ga0316577_105603121 192
22 3300032168 Ga0316593_10023280 Ga0316593_100232801 192
23 3300035398 Ga0316574_0133950 Ga0316574_0133950_89_685 192
24 3300036647 Ga0316582_0116794 Ga0316582_0116794_963_1559 192
25 3300049579 Ga0501043_0172394 Ga0501043_0172394_11_592 193
26 3300061734 Ga0530510_0091747 Ga0530510_0091747_1607_2188 193
27 3300049575 Ga0501039_0544103 Ga0501039_0544103_309_893 194
28 3300006844 Ga0075428_100000409 Ga0075428_10000040924 199
29 3300006846 Ga0075430_100000648 Ga0075430_1000006489 199
30 3300006847 Ga0075431_100175481 Ga0075431_1001754813 199
31 3300006880 Ga0075429_100000116 Ga0075429_10000011623 199
32 3300009147 Ga0114129_10042025 Ga0114129_100420254 199
33 3300050507 nmdc:mga05p37_10296_c1 nmdc:mga05p37_10296_c1_7861_8481 199
34 3300050508 nmdc:mga09592_265_c1 nmdc:mga09592_265_c1_22023_22643 199
35 3300050509 nmdc:mga0qj67_23622_c1 nmdc:mga0qj67_23622_c1_895_1515 199
36 3300050510 nmdc:mga06r32_213499_c1 nmdc:mga06r32_213499_c1_874_1494 199
37 3300005617 Ga0068859_100601695 Ga0068859_1006016952 200
38 3300006931 Ga0097620_100601775 Ga0097620_1006017752 200
39 3300050511 nmdc:mga08y16_800870_c1 nmdc:mga08y16_800870_c1_150_767 204
40 3300005440 Ga0070705_100039317 Ga0070705_1000393173 205
41 3300005444 Ga0070694_100094443 Ga0070694_1000944433 205
42 3300005445 Ga0070708_100190560 Ga0070708_1001905602 205
43 3300005457 Ga0070662_100266694 Ga0070662_1002666942 205
44 3300005459 Ga0068867_100071295 Ga0068867_1000712953 205
45 3300005545 Ga0070695_100025890 Ga0070695_1000258903 205
46 3300005545 Ga0070695_100561683 Ga0070695_1005616831 205
47 3300005546 Ga0070696_100279112 Ga0070696_1002791122 205
48 3300005615 Ga0070702_100081000 Ga0070702_1000810002 205
49 3300005842 Ga0068858_100503684 Ga0068858_1005036842 205
50 3300006844 Ga0075428_100016544 Ga0075428_1000165445 205
51 3300006844 Ga0075428_100261016 Ga0075428_1002610162 205
52 3300006846 Ga0075430_100010911 Ga0075430_1000109112 205
53 3300006846 Ga0075430_100036386 Ga0075430_1000363863 205
54 3300006846 Ga0075430_100037863 Ga0075430_1000378632 205
55 3300006846 Ga0075430_100088073 Ga0075430_1000880732 205
56 3300006846 Ga0075430_100541744 Ga0075430_1005417442 205
57 3300006847 Ga0075431_100000309 Ga0075431_10000030921 205
58 3300006847 Ga0075431_100054542 Ga0075431_1000545423 205
59 3300006847 Ga0075431_100143496 Ga0075431_1001434963 205
60 3300006852 Ga0075433_10114019 Ga0075433_101140192 205
61 3300006871 Ga0075434_100013842 Ga0075434_1000138424 205
62 3300006871 Ga0075434_100402868 Ga0075434_1004028682 205
63 3300006880 Ga0075429_100002908 Ga0075429_1000029089 205
64 3300006880 Ga0075429_100044968 Ga0075429_1000449685 205
65 3300006880 Ga0075429_100251350 Ga0075429_1002513502 205
66 3300009094 Ga0111539_10029369 Ga0111539_100293693 205
67 3300009094 Ga0111539_10251040 Ga0111539_102510402 205
68 3300009147 Ga0114129_10060953 Ga0114129_100609536 205
69 3300009147 Ga0114129_10154075 Ga0114129_101540752 205
70 3300009147 Ga0114129_10400145 Ga0114129_104001452 205
71 3300013100 Ga0157373_10753727 Ga0157373_107537271 205
72 3300026089 Ga0207648_10081569 Ga0207648_100815692 205
73 3300027717 Ga0209998_10009816 Ga0209998_100098162 205
74 3300027907 Ga0207428_10071657 Ga0207428_100716572 205
75 3300027907 Ga0207428_10326128 Ga0207428_103261281 205
76 3300031548 Ga0307408_100013646 Ga0307408_1000136464 205
77 3300031548 Ga0307408_100018402 Ga0307408_1000184024 205
78 3300031731 Ga0307405_10123714 Ga0307405_101237142 205
79 3300031852 Ga0307410_10071726 Ga0307410_100717262 205
80 3300031852 Ga0307410_10239539 Ga0307410_102395392 205
81 3300031901 Ga0307406_10062802 Ga0307406_100628023 205
82 3300031901 Ga0307406_10398424 Ga0307406_103984242 205
83 3300031995 Ga0307409_100028240 Ga0307409_1000282403 205
84 3300032002 Ga0307416_100452439 Ga0307416_1004524393 205
85 3300032002 Ga0307416_100821347 Ga0307416_1008213472 205
86 3300032005 Ga0307411_10257832 Ga0307411_102578323 205
87 3300045051 Ga0451576_0114489 Ga0451576_0114489_684_1301 205
88 3300048909 Ga0496106_0259375 Ga0496106_0259375_386_1006 205
89 3300049568 Ga0501031_0086020 Ga0501031_0086020_1395_2012 205
90 3300049572 Ga0501036_0071026 Ga0501036_0071026_1020_1637 205
91 3300049574 Ga0501038_0080988 Ga0501038_0080988_407_1024 205
92 3300049575 Ga0501039_0019329 Ga0501039_0019329_3241_3858 205
93 3300049576 Ga0501040_0044747 Ga0501040_0044747_1328_1945 205
94 3300049576 Ga0501040_0076651 Ga0501040_0076651_1269_1886 205
95 3300049576 Ga0501040_0151719 Ga0501040_0151719_130_747 205
96 3300049577 Ga0501041_0054025 Ga0501041_0054025_1427_2044 205
97 3300049578 Ga0501042_0009072 Ga0501042_0009072_4495_5112 205
98 3300049580 Ga0501046_0052944 Ga0501046_0052944_1983_2600 205
99 3300049582 Ga0501048_0045191 Ga0501048_0045191_1803_2420 205
100 3300049584 Ga0501068_0341724 Ga0501068_0341724_221_838 205
101 3300049584 Ga0501068_0426053 Ga0501068_0426053_133_750 205
102 3300049584 Ga0501068_0575883 Ga0501068_0575883_20_637 205
103 3300049585 Ga0501069_0356606 Ga0501069_0356606_43_660 205
104 3300049587 Ga0501071_0054673 Ga0501071_0054673_2105_2722 205
105 3300049588 Ga0501072_0137263 Ga0501072_0137263_1318_1935 205
106 3300049588 Ga0501072_0285960 Ga0501072_0285960_29_664 205
107 3300049591 Ga0501075_0140120 Ga0501075_0140120_1081_1698 205
108 3300049592 Ga0501076_0009355 Ga0501076_0009355_3934_4551 205
109 3300049592 Ga0501076_0358834 Ga0501076_0358834_550_1185 205
110 3300049593 Ga0501077_0038106 Ga0501077_0038106_1966_2583 205
111 3300049593 Ga0501077_0177399 Ga0501077_0177399_501_1136 205
112 3300049741 Ga0501079_0011928 Ga0501079_0011928_4351_4968 205
113 3300049741 Ga0501079_0095164 Ga0501079_0095164_1538_2173 205
114 3300049741 Ga0501079_0448254 Ga0501079_0448254_31_648 205
115 3300049741 Ga0501079_0853216 Ga0501079_0853216_67_684 205
116 3300049742 Ga0501080_0035323 Ga0501080_0035323_179_796 205
117 3300049742 Ga0501080_0277882 Ga0501080_0277882_230_847 205
118 3300049743 Ga0501081_0077876 Ga0501081_0077876_250_885 205
119 3300049824 Ga0501045_0681850 Ga0501045_0681850_79_696 205
120 3300050507 nmdc:mga05p37_298843_c1 nmdc:mga05p37_298843_c1_866_1486 205
121 3300050507 nmdc:mga05p37_311357_c1 nmdc:mga05p37_311357_c1_694_1311 205
122 3300050508 nmdc:mga09592_353894_c1 nmdc:mga09592_353894_c1_415_1032 205
123 3300050508 nmdc:mga09592_858_c1 nmdc:mga09592_858_c1_17532_18152 205
124 3300050509 nmdc:mga0qj67_13093_c1 nmdc:mga0qj67_13093_c1_388_1005 205
125 3300050509 nmdc:mga0qj67_26897_c1 nmdc:mga0qj67_26897_c1_845_1465 205
126 3300050509 nmdc:mga0qj67_35131_c1 nmdc:mga0qj67_35131_c1_2660_3280 205
127 3300050509 nmdc:mga0qj67_799005_c1 nmdc:mga0qj67_799005_c1_20_637 205
128 3300050509 nmdc:mga0qj67_8453_c1 nmdc:mga0qj67_8453_c1_5814_6431 205
129 3300050510 nmdc:mga06r32_15689_c1 nmdc:mga06r32_15689_c1_5334_5951 205
130 3300050510 nmdc:mga06r32_5125_c1 nmdc:mga06r32_5125_c1_9357_9977 205
131 3300050511 nmdc:mga08y16_202132_c1 nmdc:mga08y16_202132_c1_454_1071 205
132 3300050511 nmdc:mga08y16_538120_c1 nmdc:mga08y16_538120_c1_489_1109 205
133 3300050511 nmdc:mga08y16_54806_c1 nmdc:mga08y16_54806_c1_819_1436 205
134 3300050512 nmdc:mga0n895_118359_c1 nmdc:mga0n895_118359_c1_1735_2352 205
135 3300050515 nmdc:mga0a205_120966_c1 nmdc:mga0a205_120966_c1_1402_2019 205
136 3300054114 Ga0501084_0004793 Ga0501084_0004793_9723_10340 205
137 3300054114 Ga0501084_0097432 Ga0501084_0097432_173_808 205
138 3300059424 Ga0590075_045893 Ga0590075_045893_97_714 205
139 3300060353 Ga0501082_0005513 Ga0501082_0005513_10226_10843 205
140 3300060353 Ga0501082_0308417 Ga0501082_0308417_129_746 205
141 3300060353 Ga0501082_0393537 Ga0501082_0393537_66_701 205
142 3300060353 Ga0501082_0400049 Ga0501082_0400049_203_820 205
143 3300061734 Ga0530510_0142629 Ga0530510_0142629_162_779 205
144 3300061734 Ga0530510_0551574 Ga0530510_0551574_21_656 205
145 3300003203 JGI25406J46586_10077564 JGI25406J46586_100775642 206
146 3300005334 Ga0068869_100015087 Ga0068869_1000150873 206
147 3300005334 Ga0068869_100104773 Ga0068869_1001047734 206
148 3300005334 Ga0068869_100266829 Ga0068869_1002668292 206
149 3300005336 Ga0070680_100050763 Ga0070680_1000507634 206
150 3300005336 Ga0070680_100146861 Ga0070680_1001468612 206
151 3300005336 Ga0070680_100372909 Ga0070680_1003729091 206
152 3300005340 Ga0070689_100397687 Ga0070689_1003976872 206
153 3300005340 Ga0070689_100594580 Ga0070689_1005945802 206
154 3300005345 Ga0070692_10316521 Ga0070692_103165211 206
155 3300005345 Ga0070692_10528465 Ga0070692_105284651 206
156 3300005347 Ga0070668_100640236 Ga0070668_1006402361 206
157 3300005353 Ga0070669_100115364 Ga0070669_1001153642 206
158 3300005353 Ga0070669_100312200 Ga0070669_1003122001 206
159 3300005353 Ga0070669_100672769 Ga0070669_1006727691 206
160 3300005354 Ga0070675_100207723 Ga0070675_1002077232 206
161 3300005355 Ga0070671_100906112 Ga0070671_1009061121 206
162 3300005367 Ga0070667_100088682 Ga0070667_1000886822 206
163 3300005406 Ga0070703_10015824 Ga0070703_100158243 206
164 3300005438 Ga0070701_10021450 Ga0070701_100214504 206
165 3300005439 Ga0070711_100023739 Ga0070711_1000237394 206
166 3300005440 Ga0070705_100009045 Ga0070705_1000090454 206
167 3300005440 Ga0070705_100126914 Ga0070705_1001269142 206
168 3300005441 Ga0070700_100060078 Ga0070700_1000600784 206
169 3300005441 Ga0070700_100677292 Ga0070700_1006772921 206
170 3300005444 Ga0070694_100021129 Ga0070694_1000211292 206
171 3300005444 Ga0070694_100033319 Ga0070694_1000333193 206
172 3300005444 Ga0070694_100101247 Ga0070694_1001012472 206
173 3300005444 Ga0070694_100108826 Ga0070694_1001088261 206
174 3300005445 Ga0070708_100036527 Ga0070708_1000365271 206
175 3300005445 Ga0070708_100086820 Ga0070708_1000868203 206
176 3300005445 Ga0070708_100115938 Ga0070708_1001159382 206
177 3300005445 Ga0070708_100137581 Ga0070708_1001375813 206
178 3300005445 Ga0070708_100137587 Ga0070708_1001375873 206
179 3300005445 Ga0070708_100574990 Ga0070708_1005749901 206
180 3300005457 Ga0070662_100015202 Ga0070662_1000152022 206
181 3300005458 Ga0070681_10261757 Ga0070681_102617572 206
182 3300005459 Ga0068867_100202353 Ga0068867_1002023532 206
183 3300005467 Ga0070706_100020500 Ga0070706_1000205002 206
184 3300005467 Ga0070706_100026957 Ga0070706_1000269575 206
185 3300005467 Ga0070706_100050460 Ga0070706_1000504601 206
186 3300005467 Ga0070706_100142860 Ga0070706_1001428602 206
187 3300005467 Ga0070706_100482166 Ga0070706_1004821662 206
188 3300005467 Ga0070706_100503517 Ga0070706_1005035172 206
189 3300005467 Ga0070706_100640324 Ga0070706_1006403241 206
190 3300005468 Ga0070707_100016010 Ga0070707_1000160106 206
191 3300005468 Ga0070707_100162460 Ga0070707_1001624601 206
192 3300005468 Ga0070707_100336629 Ga0070707_1003366292 206
193 3300005468 Ga0070707_100616473 Ga0070707_1006164731 206
194 3300005471 Ga0070698_100011370 Ga0070698_1000113704 206
195 3300005471 Ga0070698_100026074 Ga0070698_1000260745 206
196 3300005471 Ga0070698_100642937 Ga0070698_1006429372 206
197 3300005518 Ga0070699_100003484 Ga0070699_1000034848 206
198 3300005518 Ga0070699_100005636 Ga0070699_1000056363 206
199 3300005518 Ga0070699_100030643 Ga0070699_1000306437 206
200 3300005518 Ga0070699_100033332 Ga0070699_1000333324 206
201 3300005518 Ga0070699_100043924 Ga0070699_1000439242 206
202 3300005518 Ga0070699_100187087 Ga0070699_1001870872 206
203 3300005518 Ga0070699_100784463 Ga0070699_1007844631 206
204 3300005530 Ga0070679_100597845 Ga0070679_1005978451 206
205 3300005536 Ga0070697_100005465 Ga0070697_1000054653 206
206 3300005536 Ga0070697_100007192 Ga0070697_1000071926 206
207 3300005536 Ga0070697_100078344 Ga0070697_1000783443 206
208 3300005536 Ga0070697_100155476 Ga0070697_1001554762 206
209 3300005536 Ga0070697_100269042 Ga0070697_1002690421 206
210 3300005536 Ga0070697_100382704 Ga0070697_1003827042 206
211 3300005536 Ga0070697_100708180 Ga0070697_1007081801 206
212 3300005544 Ga0070686_100099270 Ga0070686_1000992702 206
213 3300005545 Ga0070695_100000221 Ga0070695_10000022118 206
214 3300005545 Ga0070695_100005442 Ga0070695_1000054425 206
215 3300005545 Ga0070695_100044206 Ga0070695_1000442062 206
216 3300005546 Ga0070696_100030363 Ga0070696_1000303634 206
217 3300005546 Ga0070696_100066053 Ga0070696_1000660532 206
218 3300005546 Ga0070696_100406978 Ga0070696_1004069781 206
219 3300005547 Ga0070693_100205017 Ga0070693_1002050172 206
220 3300005549 Ga0070704_100053834 Ga0070704_1000538342 206
221 3300005549 Ga0070704_100077256 Ga0070704_1000772563 206
222 3300005549 Ga0070704_100140824 Ga0070704_1001408242 206
223 3300005549 Ga0070704_100319314 Ga0070704_1003193142 206
224 3300005577 Ga0068857_100062377 Ga0068857_1000623772 206
225 3300005577 Ga0068857_100346557 Ga0068857_1003465572 206
226 3300005617 Ga0068859_100043483 Ga0068859_1000434833 206
227 3300005617 Ga0068859_100241172 Ga0068859_1002411723 206
228 3300005617 Ga0068859_100977229 Ga0068859_1009772292 206
229 3300005618 Ga0068864_100116617 Ga0068864_1001166173 206
230 3300005719 Ga0068861_100064989 Ga0068861_1000649894 206
231 3300005719 Ga0068861_101188663 Ga0068861_1011886631 206
232 3300005840 Ga0068870_10352883 Ga0068870_103528832 206
233 3300005841 Ga0068863_100100242 Ga0068863_1001002422 206
234 3300005842 Ga0068858_100191690 Ga0068858_1001916902 206
235 3300005842 Ga0068858_100456779 Ga0068858_1004567792 206
236 3300005842 Ga0068858_100866548 Ga0068858_1008665481 206
237 3300005843 Ga0068860_100052240 Ga0068860_1000522402 206
238 3300005843 Ga0068860_100132460 Ga0068860_1001324604 206
239 3300005843 Ga0068860_100176340 Ga0068860_1001763401 206
240 3300005843 Ga0068860_100690510 Ga0068860_1006905102 206
241 3300005844 Ga0068862_100057797 Ga0068862_1000577972 206
242 3300005844 Ga0068862_100083486 Ga0068862_1000834862 206
243 3300005844 Ga0068862_100227702 Ga0068862_1002277022 206
244 3300005844 Ga0068862_100586671 Ga0068862_1005866712 206
245 3300005937 Ga0081455_10003397 Ga0081455_100033977 206
246 3300005985 Ga0081539_10000259 Ga0081539_1000025950 206
247 3300006028 Ga0070717_11005790 Ga0070717_110057901 206
248 3300006173 Ga0070716_100002408 Ga0070716_10000240811 206
249 3300006175 Ga0070712_100008419 Ga0070712_1000084192 206
250 3300006844 Ga0075428_100002009 Ga0075428_10000200911 206
251 3300006844 Ga0075428_100032654 Ga0075428_1000326546 206
252 3300006844 Ga0075428_100033386 Ga0075428_1000333865 206
253 3300006844 Ga0075428_100059085 Ga0075428_1000590852 206
254 3300006844 Ga0075428_100341359 Ga0075428_1003413592 206
255 3300006846 Ga0075430_100016650 Ga0075430_1000166504 206
256 3300006846 Ga0075430_100189799 Ga0075430_1001897992 206
257 3300006847 Ga0075431_100000454 Ga0075431_10000045425 206
258 3300006847 Ga0075431_100000773 Ga0075431_1000007737 206
259 3300006847 Ga0075431_100009238 Ga0075431_10000923810 206
260 3300006847 Ga0075431_100138829 Ga0075431_1001388293 206
261 3300006847 Ga0075431_100150289 Ga0075431_1001502892 206
262 3300006847 Ga0075431_100259179 Ga0075431_1002591791 206
263 3300006847 Ga0075431_100676654 Ga0075431_1006766542 206
264 3300006852 Ga0075433_10001946 Ga0075433_1000194618 206
265 3300006852 Ga0075433_10021968 Ga0075433_100219684 206
266 3300006852 Ga0075433_10029060 Ga0075433_100290604 206
267 3300006852 Ga0075433_10049025 Ga0075433_100490255 206
268 3300006852 Ga0075433_10068391 Ga0075433_100683913 206
269 3300006852 Ga0075433_10100066 Ga0075433_101000662 206
270 3300006852 Ga0075433_10210242 Ga0075433_102102422 206
271 3300006852 Ga0075433_10241388 Ga0075433_102413882 206
272 3300006852 Ga0075433_10490994 Ga0075433_104909942 206
273 3300006871 Ga0075434_100002428 Ga0075434_1000024282 206
274 3300006871 Ga0075434_100008835 Ga0075434_1000088354 206
275 3300006871 Ga0075434_100014502 Ga0075434_1000145026 206
276 3300006871 Ga0075434_100021309 Ga0075434_1000213096 206
277 3300006871 Ga0075434_100025057 Ga0075434_1000250579 206
278 3300006871 Ga0075434_100036075 Ga0075434_1000360753 206
279 3300006871 Ga0075434_100094429 Ga0075434_1000944292 206
280 3300006871 Ga0075434_100185406 Ga0075434_1001854062 206
281 3300006871 Ga0075434_100500800 Ga0075434_1005008002 206
282 3300006880 Ga0075429_100004527 Ga0075429_1000045275 206
283 3300006880 Ga0075429_100005985 Ga0075429_1000059855 206
284 3300006880 Ga0075429_100018102 Ga0075429_1000181023 206
285 3300006880 Ga0075429_100064013 Ga0075429_1000640133 206
286 3300006914 Ga0075436_100001411 Ga0075436_10000141119 206
287 3300006914 Ga0075436_100017120 Ga0075436_1000171205 206
288 3300006914 Ga0075436_100189287 Ga0075436_1001892872 206
289 3300006914 Ga0075436_100678434 Ga0075436_1006784341 206
290 3300006931 Ga0097620_100043484 Ga0097620_1000434843 206
291 3300006931 Ga0097620_100241150 Ga0097620_1002411502 206
292 3300006931 Ga0097620_100977217 Ga0097620_1009772172 206
293 3300007076 Ga0075435_100003300 Ga0075435_1000033005 206
294 3300007076 Ga0075435_100009489 Ga0075435_1000094894 206
295 3300007076 Ga0075435_100022072 Ga0075435_1000220721 206
296 3300007076 Ga0075435_100029119 Ga0075435_1000291194 206
297 3300007076 Ga0075435_100337021 Ga0075435_1003370212 206
298 3300007265 Ga0099794_10032889 Ga0099794_100328893 206
299 3300007265 Ga0099794_10145062 Ga0099794_101450622 206
300 3300009094 Ga0111539_10012414 Ga0111539_100124147 206
301 3300009094 Ga0111539_10021696 Ga0111539_100216966 206
302 3300009094 Ga0111539_10026196 Ga0111539_100261965 206
303 3300009094 Ga0111539_10824636 Ga0111539_108246363 206
304 3300009147 Ga0114129_10000065 Ga0114129_1000006571 206
305 3300009147 Ga0114129_10008581 Ga0114129_100085812 206
306 3300009147 Ga0114129_10018194 Ga0114129_1001819411 206
307 3300009147 Ga0114129_10023686 Ga0114129_100236867 206
308 3300009147 Ga0114129_10024663 Ga0114129_100246635 206
309 3300009147 Ga0114129_10026469 Ga0114129_100264697 206
310 3300009147 Ga0114129_10066869 Ga0114129_100668692 206
311 3300009147 Ga0114129_10195581 Ga0114129_101955811 206
312 3300009147 Ga0114129_10297347 Ga0114129_102973471 206
313 3300009147 Ga0114129_10405858 Ga0114129_104058582 206
314 3300009147 Ga0114129_10493795 Ga0114129_104937952 206
315 3300009147 Ga0114129_11027814 Ga0114129_110278142 206
316 3300009148 Ga0105243_10086615 Ga0105243_100866154 206
317 3300009148 Ga0105243_10103986 Ga0105243_101039863 206
318 3300009174 Ga0105241_11166504 Ga0105241_111665042 206
319 3300009176 Ga0105242_10018117 Ga0105242_100181176 206
320 3300009177 Ga0105248_11095887 Ga0105248_110958871 206
321 3300009177 Ga0105248_11648156 Ga0105248_116481561 206
322 3300009553 Ga0105249_10016993 Ga0105249_100169938 206
323 3300009553 Ga0105249_11571910 Ga0105249_115719101 206
324 3300013102 Ga0157371_10146446 Ga0157371_101464462 206
325 3300013297 Ga0157378_10656041 Ga0157378_106560412 206
326 3300013306 Ga0163162_10376579 Ga0163162_103765792 206
327 3300014326 Ga0157380_10500244 Ga0157380_105002442 206
328 3300014968 Ga0157379_10182502 Ga0157379_101825023 206
329 3300014969 Ga0157376_10323242 Ga0157376_103232422 206
330 3300025885 Ga0207653_10054929 Ga0207653_100549292 206
331 3300025885 Ga0207653_10068658 Ga0207653_100686582 206
332 3300025903 Ga0207680_10461126 Ga0207680_104611262 206
333 3300025910 Ga0207684_10001638 Ga0207684_100016385 206
334 3300025910 Ga0207684_10005022 Ga0207684_100050228 206
335 3300025910 Ga0207684_10018648 Ga0207684_100186484 206
336 3300025910 Ga0207684_10020078 Ga0207684_100200784 206
337 3300025910 Ga0207684_10030586 Ga0207684_100305862 206
338 3300025910 Ga0207684_10100073 Ga0207684_101000733 206
339 3300025910 Ga0207684_10927075 Ga0207684_109270751 206
340 3300025911 Ga0207654_10267256 Ga0207654_102672561 206
341 3300025912 Ga0207707_10234985 Ga0207707_102349851 206
342 3300025916 Ga0207663_10345127 Ga0207663_103451272 206
343 3300025917 Ga0207660_10031415 Ga0207660_100314155 206
344 3300025917 Ga0207660_10050261 Ga0207660_100502612 206
345 3300025918 Ga0207662_10245602 Ga0207662_102456022 206
346 3300025918 Ga0207662_10439766 Ga0207662_104397661 206
347 3300025922 Ga0207646_10001729 Ga0207646_1000172913 206
348 3300025922 Ga0207646_10004209 Ga0207646_1000420912 206
349 3300025922 Ga0207646_10084546 Ga0207646_100845464 206
350 3300025922 Ga0207646_10121025 Ga0207646_101210252 206
351 3300025922 Ga0207646_10179967 Ga0207646_101799673 206
352 3300025923 Ga0207681_10668327 Ga0207681_106683272 206
353 3300025926 Ga0207659_10400010 Ga0207659_104000102 206
354 3300025933 Ga0207706_10024045 Ga0207706_100240453 206
355 3300025934 Ga0207686_10055130 Ga0207686_100551304 206
356 3300025935 Ga0207709_10006527 Ga0207709_100065277 206
357 3300025936 Ga0207670_10101655 Ga0207670_101016552 206
358 3300025939 Ga0207665_10005009 Ga0207665_100050099 206
359 3300025941 Ga0207711_10533045 Ga0207711_105330452 206
360 3300025942 Ga0207689_10027878 Ga0207689_100278786 206
361 3300025942 Ga0207689_10050666 Ga0207689_100506663 206
362 3300025961 Ga0207712_10144996 Ga0207712_101449964 206
363 3300025961 Ga0207712_10180333 Ga0207712_101803332 206
364 3300025972 Ga0207668_10537247 Ga0207668_105372471 206
365 3300025986 Ga0207658_10126286 Ga0207658_101262863 206
366 3300026075 Ga0207708_10144990 Ga0207708_101449903 206
367 3300026075 Ga0207708_10315359 Ga0207708_103153592 206
368 3300026088 Ga0207641_10854647 Ga0207641_108546472 206
369 3300026116 Ga0207674_10017749 Ga0207674_100177494 206
370 3300026116 Ga0207674_10667664 Ga0207674_106676642 206
371 3300026118 Ga0207675_100499474 Ga0207675_1004994742 206
372 3300027526 Ga0209968_1000254 Ga0209968_10002548 206
373 3300027552 Ga0209982_1006982 Ga0209982_10069823 206
374 3300027614 Ga0209970_1000766 Ga0209970_10007664 206
375 3300027665 Ga0209983_1004889 Ga0209983_10048892 206
376 3300027671 Ga0209588_1090143 Ga0209588_10901431 206
377 3300027671 Ga0209588_1128271 Ga0209588_11282712 206
378 3300027682 Ga0209971_1000008 Ga0209971_100000875 206
379 3300027695 Ga0209966_1001622 Ga0209966_10016221 206
380 3300027717 Ga0209998_10000016 Ga0209998_1000001627 206
381 3300027876 Ga0209974_10000710 Ga0209974_100007109 206
382 3300027907 Ga0207428_10000018 Ga0207428_1000001851 206
383 3300027907 Ga0207428_10000063 Ga0207428_1000006355 206
384 3300027907 Ga0207428_10000091 Ga0207428_1000009133 206
385 3300028380 Ga0268265_10050677 Ga0268265_100506772 206
386 3300028380 Ga0268265_10066067 Ga0268265_100660674 206
387 3300028380 Ga0268265_10165708 Ga0268265_101657082 206
388 3300028380 Ga0268265_10289467 Ga0268265_102894672 206
389 3300028381 Ga0268264_10199438 Ga0268264_101994382 206
390 3300028381 Ga0268264_10210727 Ga0268264_102107272 206
391 3300028381 Ga0268264_10256977 Ga0268264_102569772 206
392 3300028381 Ga0268264_10334816 Ga0268264_103348161 206
393 3300028381 Ga0268264_10722167 Ga0268264_107221672 206
394 3300031548 Ga0307408_100041162 Ga0307408_1000411622 206
395 3300032002 Ga0307416_100593181 Ga0307416_1005931812 206
396 3300034817 Ga0373948_0017021 Ga0373948_0017021_348_968 206
397 3300034817 Ga0373948_0077913 Ga0373948_0077913_89_709 206
398 3300035084 Ga0373928_0109455 Ga0373928_0109455_35_667 206
399 3300035088 Ga0373940_0003774 Ga0373940_0003774_1167_1793 206
400 3300035088 Ga0373940_0006061 Ga0373940_0006061_620_1240 206
401 3300035088 Ga0373940_0017310 Ga0373940_0017310_496_1116 206
402 3300035091 Ga0373951_0053824 Ga0373951_0053824_112_732 206
403 3300035112 Ga0373932_0043183 Ga0373932_0043183_559_1179 206
404 3300035114 Ga0373939_0004128 Ga0373939_0004128_344_970 206
405 3300035691 Ga0373931_0014239 Ga0373931_0014239_2807_3433 206
406 3300035691 Ga0373931_0025013 Ga0373931_0025013_2142_2762 206
407 3300035691 Ga0373931_0046835 Ga0373931_0046835_887_1507 206
408 3300037312 Ga0395899_0170432 Ga0395899_0170432_761_1381 206
409 3300037312 Ga0395899_0338067 Ga0395899_0338067_325_945 206
410 3300037418 Ga0395900_0422969 Ga0395900_0422969_333_965 206
411 3300037471 Ga0395905_0056466 Ga0395905_0056466_1100_1720 206
412 3300038443 Ga0395901_0113025 Ga0395901_0113025_1439_2059 206
413 3300038443 Ga0395901_0179834 Ga0395901_0179834_174_794 206
414 3300042001 Ga0439441_032199 Ga0439441_032199_24_650 206
415 3300042008 Ga0439450_094923 Ga0439450_094923_104_724 206
416 3300042461 Ga0439460_0018747 Ga0439460_0018747_99_719 206
417 3300042876 Ga0451577_0071658 Ga0451577_0071658_158_778 206
418 3300042876 Ga0451577_0136739 Ga0451577_0136739_1255_1881 206
419 3300042876 Ga0451577_0177190 Ga0451577_0177190_593_1213 206
420 3300042876 Ga0451577_0461241 Ga0451577_0461241_112_732 206
421 3300042876 Ga0451577_0517912 Ga0451577_0517912_72_692 206
422 3300044673 Ga0453683_0018206 Ga0453683_0018206_1763_2389 206
423 3300044673 Ga0453683_0019096 Ga0453683_0019096_776_1402 206
424 3300044673 Ga0453683_0073768 Ga0453683_0073768_1065_1685 206
425 3300044673 Ga0453683_0430250 Ga0453683_0430250_25_645 206
426 3300044712 Ga0453684_0037837 Ga0453684_0037837_2440_3066 206
427 3300045051 Ga0451576_0069513 Ga0451576_0069513_1982_2602 206
428 3300045051 Ga0451576_0153871 Ga0451576_0153871_1661_2281 206
429 3300045051 Ga0451576_0391003 Ga0451576_0391003_57_680 206
430 3300045051 Ga0451576_0676873 Ga0451576_0676873_434_1054 206
431 3300046472 Ga0495580_0003884 Ga0495580_0003884_5356_5976 206
432 3300046491 Ga0495584_0290495 Ga0495584_0290495_34_660 206
433 3300047318 Ga0495636_0114153 Ga0495636_0114153_422_1042 206
434 3300048905 Ga0496102_0070213 Ga0496102_0070213_787_1407 206
435 3300048909 Ga0496106_0820734 Ga0496106_0820734_58_678 206
436 3300049568 Ga0501031_0020822 Ga0501031_0020822_2112_2732 206
437 3300049568 Ga0501031_0135303 Ga0501031_0135303_826_1446 206
438 3300049568 Ga0501031_0486863 Ga0501031_0486863_64_684 206
439 3300049569 Ga0501032_0215895 Ga0501032_0215895_171_791 206
440 3300049569 Ga0501032_0316393 Ga0501032_0316393_99_719 206
441 3300049570 Ga0501033_0112536 Ga0501033_0112536_979_1605 206
442 3300049570 Ga0501033_0323327 Ga0501033_0323327_252_872 206
443 3300049572 Ga0501036_0011987 Ga0501036_0011987_404_1024 206
444 3300049572 Ga0501036_0028906 Ga0501036_0028906_2664_3284 206
445 3300049572 Ga0501036_0047305 Ga0501036_0047305_23_643 206
446 3300049572 Ga0501036_0186021 Ga0501036_0186021_659_1285 206
447 3300049574 Ga0501038_0000637 Ga0501038_0000637_14606_15226 206
448 3300049574 Ga0501038_0073062 Ga0501038_0073062_1412_2032 206
449 3300049574 Ga0501038_0093581 Ga0501038_0093581_663_1283 206
450 3300049574 Ga0501038_0581148 Ga0501038_0581148_12_635 206
451 3300049575 Ga0501039_0021708 Ga0501039_0021708_123_743 206
452 3300049575 Ga0501039_0025460 Ga0501039_0025460_2455_3075 206
453 3300049575 Ga0501039_0040862 Ga0501039_0040862_1759_2379 206
454 3300049575 Ga0501039_0208659 Ga0501039_0208659_759_1379 206
455 3300049575 Ga0501039_0733144 Ga0501039_0733144_137_757 206
456 3300049576 Ga0501040_0000166 Ga0501040_0000166_13985_14605 206
457 3300049576 Ga0501040_0044569 Ga0501040_0044569_1182_1808 206
458 3300049576 Ga0501040_0059352 Ga0501040_0059352_1968_2591 206
459 3300049576 Ga0501040_0111411 Ga0501040_0111411_909_1529 206
460 3300049576 Ga0501040_0119238 Ga0501040_0119238_858_1478 206
461 3300049576 Ga0501040_0201960 Ga0501040_0201960_659_1279 206
462 3300049576 Ga0501040_0576188 Ga0501040_0576188_106_726 206
463 3300049577 Ga0501041_0000298 Ga0501041_0000298_21456_22076 206
464 3300049577 Ga0501041_0023484 Ga0501041_0023484_1972_2592 206
465 3300049577 Ga0501041_0050010 Ga0501041_0050010_1155_1781 206
466 3300049577 Ga0501041_0099419 Ga0501041_0099419_304_924 206
467 3300049577 Ga0501041_0211871 Ga0501041_0211871_510_1130 206
468 3300049578 Ga0501042_0000055 Ga0501042_0000055_17866_18486 206
469 3300049578 Ga0501042_0069915 Ga0501042_0069915_1624_2244 206
470 3300049578 Ga0501042_0082944 Ga0501042_0082944_1162_1782 206
471 3300049578 Ga0501042_0420519 Ga0501042_0420519_198_824 206
472 3300049579 Ga0501043_0068996 Ga0501043_0068996_1286_1906 206
473 3300049580 Ga0501046_0000295 Ga0501046_0000295_38860_39480 206
474 3300049580 Ga0501046_0000697 Ga0501046_0000697_19091_19711 206
475 3300049580 Ga0501046_0049294 Ga0501046_0049294_1759_2379 206
476 3300049580 Ga0501046_0129710 Ga0501046_0129710_646_1269 206
477 3300049581 Ga0501047_0013094 Ga0501047_0013094_314_934 206
478 3300049582 Ga0501048_0000123 Ga0501048_0000123_20871_21491 206
479 3300049582 Ga0501048_0002070 Ga0501048_0002070_842_1462 206
480 3300049582 Ga0501048_0103396 Ga0501048_0103396_556_1176 206
481 3300049582 Ga0501048_0482519 Ga0501048_0482519_21_644 206
482 3300049583 Ga0501067_0115691 Ga0501067_0115691_475_1095 206
483 3300049584 Ga0501068_0011235 Ga0501068_0011235_3399_4019 206
484 3300049585 Ga0501069_0041989 Ga0501069_0041989_522_1142 206
485 3300049586 Ga0501070_0014353 Ga0501070_0014353_5590_6210 206
486 3300049587 Ga0501071_0000151 Ga0501071_0000151_24155_24775 206
487 3300049587 Ga0501071_0107365 Ga0501071_0107365_864_1484 206
488 3300049587 Ga0501071_0636397 Ga0501071_0636397_73_693 206
489 3300049588 Ga0501072_0000139 Ga0501072_0000139_32203_32823 206
490 3300049588 Ga0501072_0015970 Ga0501072_0015970_2513_3133 206
491 3300049588 Ga0501072_0022312 Ga0501072_0022312_1619_2239 206
492 3300049588 Ga0501072_0174746 Ga0501072_0174746_171_794 206
493 3300049588 Ga0501072_0185572 Ga0501072_0185572_456_1076 206
494 3300049590 Ga0501074_0003511 Ga0501074_0003511_8686_9306 206
495 3300049590 Ga0501074_0105158 Ga0501074_0105158_1172_1792 206
496 3300049590 Ga0501074_0677477 Ga0501074_0677477_93_716 206
497 3300049591 Ga0501075_0000051 Ga0501075_0000051_32832_33452 206
498 3300049591 Ga0501075_0012681 Ga0501075_0012681_92_712 206
499 3300049591 Ga0501075_0016833 Ga0501075_0016833_2398_3018 206
500 3300049591 Ga0501075_0023296 Ga0501075_0023296_3477_4097 206
501 3300049591 Ga0501075_0049369 Ga0501075_0049369_896_1522 206
502 3300049591 Ga0501075_0053170 Ga0501075_0053170_650_1270 206
503 3300049591 Ga0501075_0065926 Ga0501075_0065926_32_652 206
504 3300049592 Ga0501076_0000008 Ga0501076_0000008_15750_16370 206
505 3300049592 Ga0501076_0009862 Ga0501076_0009862_2033_2653 206
506 3300049592 Ga0501076_0036165 Ga0501076_0036165_1111_1731 206
507 3300049592 Ga0501076_0052678 Ga0501076_0052678_1194_1820 206
508 3300049592 Ga0501076_0173751 Ga0501076_0173751_391_1011 206
509 3300049592 Ga0501076_0289380 Ga0501076_0289380_704_1324 206
510 3300049593 Ga0501077_0000800 Ga0501077_0000800_9303_9923 206
511 3300049593 Ga0501077_0017732 Ga0501077_0017732_1308_1928 206
512 3300049593 Ga0501077_0022071 Ga0501077_0022071_3277_3897 206
513 3300049593 Ga0501077_0024172 Ga0501077_0024172_1337_1963 206
514 3300049593 Ga0501077_0038910 Ga0501077_0038910_345_965 206
515 3300049593 Ga0501077_0179323 Ga0501077_0179323_152_775 206
516 3300049741 Ga0501079_0000131 Ga0501079_0000131_15393_16013 206
517 3300049741 Ga0501079_0007276 Ga0501079_0007276_6610_7230 206
518 3300049741 Ga0501079_0013897 Ga0501079_0013897_1150_1776 206
519 3300049741 Ga0501079_0061689 Ga0501079_0061689_2254_2877 206
520 3300049741 Ga0501079_0067526 Ga0501079_0067526_905_1525 206
521 3300049742 Ga0501080_0043180 Ga0501080_0043180_898_1518 206
522 3300049742 Ga0501080_0049661 Ga0501080_0049661_2292_2912 206
523 3300049742 Ga0501080_0167643 Ga0501080_0167643_312_938 206
524 3300049743 Ga0501081_0003066 Ga0501081_0003066_3173_3793 206
525 3300049743 Ga0501081_0004495 Ga0501081_0004495_7953_8573 206
526 3300049743 Ga0501081_0008226 Ga0501081_0008226_1145_1765 206
527 3300049743 Ga0501081_0019250 Ga0501081_0019250_1440_2066 206
528 3300049743 Ga0501081_0030055 Ga0501081_0030055_1444_2064 206
529 3300049743 Ga0501081_0085909 Ga0501081_0085909_1117_1737 206
530 3300049743 Ga0501081_0432137 Ga0501081_0432137_38_658 206
531 3300049744 Ga0501083_0011523 Ga0501083_0011523_3867_4487 206
532 3300049744 Ga0501083_0043357 Ga0501083_0043357_65_685 206
533 3300049744 Ga0501083_0084739 Ga0501083_0084739_764_1384 206
534 3300049822 Ga0501035_0121611 Ga0501035_0121611_81_707 206
535 3300049822 Ga0501035_0250762 Ga0501035_0250762_759_1379 206
536 3300049823 Ga0501044_0686712 Ga0501044_0686712_245_865 206
537 3300049824 Ga0501045_0000061 Ga0501045_0000061_17141_17761 206
538 3300049824 Ga0501045_0031981 Ga0501045_0031981_433_1053 206
539 3300049824 Ga0501045_0107549 Ga0501045_0107549_1136_1762 206
540 3300049824 Ga0501045_0129053 Ga0501045_0129053_598_1218 206
541 3300049824 Ga0501045_0508783 Ga0501045_0508783_243_866 206
542 3300050507 nmdc:mga05p37_10664_c1 nmdc:mga05p37_10664_c1_7649_8269 206
543 3300050507 nmdc:mga05p37_142322_c1 nmdc:mga05p37_142322_c1_2019_2639 206
544 3300050507 nmdc:mga05p37_19852_c1 nmdc:mga05p37_19852_c1_1983_2603 206
545 3300050507 nmdc:mga05p37_25174_c1 nmdc:mga05p37_25174_c1_1361_1981 206
546 3300050507 nmdc:mga05p37_296196_c1 nmdc:mga05p37_296196_c1_42_662 206
547 3300050507 nmdc:mga05p37_29990_c1 nmdc:mga05p37_29990_c1_1243_1863 206
548 3300050507 nmdc:mga05p37_32003_c1 nmdc:mga05p37_32003_c1_555_1181 206
549 3300050507 nmdc:mga05p37_3522_c1 nmdc:mga05p37_3522_c1_17399_18019 206
550 3300050507 nmdc:mga05p37_356586_c1 nmdc:mga05p37_356586_c1_592_1212 206
551 3300050508 nmdc:mga09592_3977_c1 nmdc:mga09592_3977_c1_895_1515 206
552 3300050508 nmdc:mga09592_523283_c1 nmdc:mga09592_523283_c1_328_948 206
553 3300050508 nmdc:mga09592_8878_c1 nmdc:mga09592_8878_c1_1632_2252 206
554 3300050509 nmdc:mga0qj67_180789_c1 nmdc:mga0qj67_180789_c1_288_908 206
555 3300050509 nmdc:mga0qj67_321931_c1 nmdc:mga0qj67_321931_c1_506_1132 206
556 3300050510 nmdc:mga06r32_1559_c1 nmdc:mga06r32_1559_c1_10587_11207 206
557 3300050510 nmdc:mga06r32_18333_c1 nmdc:mga06r32_18333_c1_4909_5529 206
558 3300050510 nmdc:mga06r32_290318_c1 nmdc:mga06r32_290318_c1_940_1560 206
559 3300050510 nmdc:mga06r32_388398_c1 nmdc:mga06r32_388398_c1_718_1350 206
560 3300050510 nmdc:mga06r32_594309_c1 nmdc:mga06r32_594309_c1_69_689 206
561 3300050510 nmdc:mga06r32_622153_c1 nmdc:mga06r32_622153_c1_266_886 206
562 3300050510 nmdc:mga06r32_784_c1 nmdc:mga06r32_784_c1_6854_7474 206
563 3300050511 nmdc:mga08y16_138_c1 nmdc:mga08y16_138_c1_23331_23957 206
564 3300050511 nmdc:mga08y16_2413_c1 nmdc:mga08y16_2413_c1_4187_4807 206
565 3300050511 nmdc:mga08y16_61503_c1 nmdc:mga08y16_61503_c1_953_1573 206
566 3300050512 nmdc:mga0n895_10836_c1 nmdc:mga0n895_10836_c1_904_1524 206
567 3300050512 nmdc:mga0n895_1251388_c1 nmdc:mga0n895_1251388_c1_61_681 206
568 3300050512 nmdc:mga0n895_126751_c1 nmdc:mga0n895_126751_c1_1528_2148 206
569 3300050512 nmdc:mga0n895_17031_c1 nmdc:mga0n895_17031_c1_980_1600 206
570 3300050512 nmdc:mga0n895_287887_c1 nmdc:mga0n895_287887_c1_890_1510 206
571 3300050512 nmdc:mga0n895_29523_c1 nmdc:mga0n895_29523_c1_4200_4820 206
572 3300050512 nmdc:mga0n895_39369_c1 nmdc:mga0n895_39369_c1_2447_3067 206
573 3300050513 nmdc:mga0rr50_14392_c1 nmdc:mga0rr50_14392_c1_1853_2473 206
574 3300050513 nmdc:mga0rr50_4035_c1 nmdc:mga0rr50_4035_c1_7792_8412 206
575 3300050513 nmdc:mga0rr50_45919_c1 nmdc:mga0rr50_45919_c1_1424_2044 206
576 3300050513 nmdc:mga0rr50_579963_c1 nmdc:mga0rr50_579963_c1_292_912 206
577 3300050514 nmdc:mga08x19_205769_c1 nmdc:mga08x19_205769_c1_516_1136 206
578 3300050514 nmdc:mga08x19_265505_c1 nmdc:mga08x19_265505_c1_221_841 206
579 3300050514 nmdc:mga08x19_6121_c1 nmdc:mga08x19_6121_c1_4048_4668 206
580 3300050515 nmdc:mga0a205_112397_c1 nmdc:mga0a205_112397_c1_616_1236 206
581 3300050515 nmdc:mga0a205_12102_c1 nmdc:mga0a205_12102_c1_154_774 206
582 3300050515 nmdc:mga0a205_21191_c2 nmdc:mga0a205_21191_c2_1355_1975 206
583 3300050515 nmdc:mga0a205_52423_c1 nmdc:mga0a205_52423_c1_151_771 206
584 3300050515 nmdc:mga0a205_7228_c1 nmdc:mga0a205_7228_c1_3908_4528 206
585 3300054114 Ga0501084_0000174 Ga0501084_0000174_30709_31329 206
586 3300054114 Ga0501084_0004586 Ga0501084_0004586_1920_2540 206
587 3300054114 Ga0501084_0004982 Ga0501084_0004982_6678_7304 206
588 3300054114 Ga0501084_0043807 Ga0501084_0043807_486_1106 206
589 3300054114 Ga0501084_0081395 Ga0501084_0081395_1458_2078 206
590 3300060353 Ga0501082_0001603 Ga0501082_0001603_15390_16010 206
591 3300060353 Ga0501082_0003815 Ga0501082_0003815_7137_7757 206
592 3300060353 Ga0501082_0018214 Ga0501082_0018214_1896_2522 206
593 3300060353 Ga0501082_0029010 Ga0501082_0029010_1083_1703 206
594 3300060353 Ga0501082_0149432 Ga0501082_0149432_1022_1642 206
595 3300061734 Ga0530510_0000120 Ga0530510_0000120_30176_30796 206
596 3300061734 Ga0530510_0035270 Ga0530510_0035270_1447_2067 206
597 3300061734 Ga0530510_0582843 Ga0530510_0582843_52_675 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07040

DUF1326

Protein of unknown function (DUF1326)

24

204

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s2f-assembly1.cif.gz_D cryo-em structure of ctf18-1-8 in complex with the catalytic domain of dna polymerase epsilon (class 2) 0.6634 124 146
6vda-assembly1.cif.gz_A-2 metal-bound c-terminal domain of czcd transporter from thermotoga maritima 0.634 75 123
2zzt-assembly1.cif.gz_A-2 crystal structure of the cytosolic domain of the cation diffusion facilitator family protein 0.6172 74 123
6gp6-assembly1.cif.gz_A mamm ctd - copper form 0.5769 73 123
6h5u-assembly2.cif.gz_B mamm ctd h264e - zinc form 2 0.5708 63 123
ID Description Score Start End Superfamily
af_A0A1D6IE07_266_395_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.5806 60 121 3.40.20.10
af_P85515_1_101_2.60.40.1940 Mainly Beta;Sandwich;Immunoglobulin-like; 0.571 122 139 2.60.40.1940
af_O76639_293_347_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5587 124 185 2.30.29.30
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.5556 76 122 3.30.300.20
af_A0A0R0IUI6_98_233_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5402 3 67 2.60.40.1820
ID Description Score Start End GO Terms
AF-A0A2V6TXJ5-F1-model_v4 DUF1326 domain-containing protein 0.9953 1 123
AF-A0A831X6N9-F1-model_v4 DUF1326 domain-containing protein 0.9941 6 103
AF-A0A535HGQ4-F1-model_v4 DUF1326 domain-containing protein 0.9938 5 205
AF-A0A7V3BIH2-F1-model_v4 DUF1326 domain-containing protein 0.9915 1 205
AF-A0A7W1BJ22-F1-model_v4 DUF1326 domain-containing protein 0.9907 1 115

Feature Viewer

pLDDT pTM Quality
94.26 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map