F467669

General Info

Members Datasets Scaffolds Average Seq Length
597 275 1194 127

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_11142638|Ga0157372_111426381
Length 131
Sequence MVDRLTTADLIERAAVQAAHLVTRIVELTGIAIIAFGAXGTLLLFLYRLVRRQDRELAIAAFRSSLGRAILLGLEFLVAADIINTVAVEPSLMSVAVLAGIVVIRTFLSFSLETEIEGRWPWQRGSRQRKI

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 10.05
Rhizosphere 86.77
Stem 0
Stem Tuber 0
Unclassified 21.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_11142638 3300013307 Bacteria 901
2 JGI24748J21848_1025472 3300002074 Unclassified 721
3 Ga0065712_10081284 3300005290 Bacteria 2991
4 Ga0065715_10250984 3300005293 Unclassified 1159
5 Ga0070658_10063386 3300005327 Bacteria 3013
6 Ga0070658_10857225 3300005327 Bacteria 790
7 Ga0070676_10006695 3300005328 Bacteria 6173
8 Ga0070676_10040066 3300005328 Plasmid 2712
9 Ga0070683_100358653 3300005329 Unclassified 1388
10 Ga0070683_101774379 3300005329 Unclassified 593
11 Ga0070683_101780261 3300005329 Unclassified 592
12 Ga0070690_100033621 3300005330 Bacteria 3211
13 Ga0070670_100033835 3300005331 Bacteria 4400
14 Ga0070670_100235277 3300005331 Bacteria 1594
15 Ga0068869_100066496 3300005334 Plasmid 2656
16 Ga0068869_100250332 3300005334 Bacteria 1415
17 Ga0068869_100542408 3300005334 Bacteria 976
18 Ga0068869_100890996 3300005334 Bacteria 769
19 Ga0070666_10017712 3300005335 Plasmid 4571
20 Ga0070680_100014202 3300005336 Bacteria 6221
21 Ga0070680_100980380 3300005336 Bacteria 730
22 Ga0070682_100014897 3300005337 Bacteria 4501
23 Ga0070682_100022660 3300005337 Bacteria 3723
24 Ga0070682_101112353 3300005337 Unclassified 662
25 Ga0068868_100042745 3300005338 Bacteria 3538
26 Ga0068868_100077643 3300005338 Bacteria 2657
27 Ga0068868_100160360 3300005338 Bacteria 1857
28 Ga0070660_100389146 3300005339 Unclassified 1152
29 Ga0070689_100011212 3300005340 Bacteria 6414
30 Ga0070689_100478440 3300005340 Bacteria 1063
31 Ga0070689_100561307 3300005340 Unclassified 985
32 Ga0070689_100799567 3300005340 Unclassified 829
33 Ga0070689_101217845 3300005340 Bacteria 676
34 Ga0070691_10078028 3300005341 Bacteria 1617
35 Ga0070687_100555987 3300005343 Bacteria 781
36 Ga0070661_100145215 3300005344 Bacteria 1790
37 Ga0070661_100151008 3300005344 Bacteria 1756
38 Ga0070661_100492319 3300005344 Bacteria 980
39 Ga0070668_100001379 3300005347 Bacteria 17433
40 Ga0070668_100171912 3300005347 Bacteria 1764
41 Ga0070668_100302359 3300005347 Bacteria 1342
42 Ga0070669_100019385 3300005353 Bacteria 4857
43 Ga0070669_100245584 3300005353 Bacteria 1424
44 Ga0070675_100755029 3300005354 Bacteria 888
45 Ga0070675_100773360 3300005354 Bacteria 877
46 Ga0070675_101010128 3300005354 Unclassified 764
47 Ga0070671_100031813 3300005355 Bacteria 4361
48 Ga0070671_100169126 3300005355 Bacteria 1848
49 Ga0070671_100204126 3300005355 Bacteria 1676
50 Ga0070671_100282889 3300005355 Bacteria 1411
51 Ga0070671_100333268 3300005355 Bacteria 1293
52 Ga0070671_100747156 3300005355 Bacteria 850
53 Ga0070674_100006800 3300005356 Bacteria 6701
54 Ga0070674_100272470 3300005356 Unclassified 1338
55 Ga0070673_100024647 3300005364 Bacteria 4415
56 Ga0070673_100026988 3300005364 Bacteria 4251
57 Ga0070673_100068673 3300005364 Bacteria 2839
58 Ga0070673_100213313 3300005364 Bacteria 1668
59 Ga0070673_100559006 3300005364 Bacteria 1040
60 Ga0070673_101423816 3300005364 Bacteria 653
61 Ga0070688_100084758 3300005365 Bacteria 2059
62 Ga0070688_100188124 3300005365 Unclassified 1437
63 Ga0070688_100494298 3300005365 Unclassified 922
64 Ga0070688_100917870 3300005365 Bacteria 691
65 Ga0070659_100168969 3300005366 Bacteria 1790
66 Ga0070659_100772967 3300005366 Unclassified 834
67 Ga0070667_100043834 3300005367 Bacteria 3755
68 Ga0070667_100110958 3300005367 Bacteria 2378
69 Ga0070667_100245423 3300005367 Bacteria 1600
70 Ga0070667_100280185 3300005367 Bacteria 1497
71 Ga0070667_100333209 3300005367 Bacteria 1371
72 Ga0070667_101159926 3300005367 Bacteria 723
73 Ga0070667_101547714 3300005367 Bacteria 623
74 Ga0070709_10006294 3300005434 Bacteria 6465
75 Ga0070709_11278668 3300005434 Unclassified 591
76 Ga0070714_100088052 3300005435 Bacteria 2716
77 Ga0070714_100689813 3300005435 Unclassified 985
78 Ga0070714_101051951 3300005435 Unclassified 793
79 Ga0070713_100010156 3300005436 Bacteria 6790
80 Ga0070713_100055904 3300005436 Bacteria 3281
81 Ga0070710_10326377 3300005437 Unclassified 1009
82 Ga0070711_100018319 3300005439 Bacteria 4467
83 Ga0070711_100079530 3300005439 Bacteria 2332
84 Ga0070711_100429725 3300005439 Bacteria 1078
85 Ga0070711_100939951 3300005439 Unclassified 739
86 Ga0070705_100033340 3300005440 Bacteria 2870
87 Ga0070700_100417293 3300005441 Unclassified 1013
88 Ga0070694_100601735 3300005444 Unclassified 885
89 Ga0070663_100008316 3300005455 Bacteria 6376
90 Ga0070663_100031636 3300005455 Bacteria 3638
91 Ga0070663_100298568 3300005455 Bacteria 1288
92 Ga0070663_100448830 3300005455 Bacteria 1062
93 Ga0070663_101209760 3300005455 Unclassified 664
94 Ga0070678_100023311 3300005456 Bacteria 4122
95 Ga0070678_100035698 3300005456 Bacteria 3474
96 Ga0070678_100700222 3300005456 Unclassified 913
97 Ga0070678_101704446 3300005456 Bacteria 593
98 Ga0070662_100027211 3300005457 Bacteria 3967
99 Ga0070662_100207629 3300005457 Bacteria 1557
100 Ga0070662_100576506 3300005457 Bacteria 945
101 Ga0070681_10003122 3300005458 Bacteria 15392
102 Ga0070681_10097705 3300005458 Bacteria 2884
103 Ga0068867_100622094 3300005459 Bacteria 944
104 Ga0070685_10008342 3300005466 Bacteria 5317
105 Ga0070679_100218380 3300005530 Bacteria 1868
106 Ga0070679_102051197 3300005530 Unclassified 521
107 Ga0070684_100321419 3300005535 Bacteria 1421
108 Ga0070684_100586463 3300005535 Bacteria 1036
109 Ga0070684_101010012 3300005535 Unclassified 781
110 Ga0068853_101310254 3300005539 Unclassified 700
111 Ga0070672_100054659 3300005543 Bacteria 3127
112 Ga0070672_100146586 3300005543 Bacteria 1951
113 Ga0070672_100366250 3300005543 Bacteria 1231
114 Ga0070672_100388253 3300005543 Bacteria 1195
115 Ga0070686_100010171 3300005544 Bacteria 5295
116 Ga0070686_100044085 3300005544 Bacteria 2801
117 Ga0070695_100978536 3300005545 Bacteria 687
118 Ga0070696_100014177 3300005546 Bacteria 5348
119 Ga0070693_100003704 3300005547 Bacteria 7148
120 Ga0070693_100258557 3300005547 Bacteria 1157
121 Ga0070665_100118517 3300005548 Bacteria 2649
122 Ga0070665_100515395 3300005548 Bacteria 1207
123 Ga0070665_100646867 3300005548 Bacteria 1070
124 Ga0070704_101205336 3300005549 Unclassified 690
125 Ga0068855_100017094 3300005563 Bacteria 8726
126 Ga0070664_100247877 3300005564 Unclassified 1600
127 Ga0070664_100346677 3300005564 Bacteria 1350
128 Ga0070664_100418982 3300005564 Unclassified 1226
129 Ga0070664_100722980 3300005564 Unclassified 928
130 Ga0068854_100689440 3300005578 Bacteria 881
131 Ga0068856_100010418 3300005614 Bacteria 9027
132 Ga0068856_101208572 3300005614 Unclassified 772
133 Ga0070702_100063867 3300005615 Bacteria 2151
134 Ga0070702_100068917 3300005615 Bacteria 2083
135 Ga0070702_100142289 3300005615 Unclassified 1529
136 Ga0070702_101310477 3300005615 Unclassified 588
137 Ga0070702_101811137 3300005615 Unclassified 510
138 Ga0068852_100005404 3300005616 Bacteria 9139
139 Ga0068859_100011876 3300005617 Bacteria 8749
140 Ga0068859_100424131 3300005617 Bacteria 1426
141 Ga0068859_100513461 3300005617 Bacteria 1293
142 Ga0068859_102225317 3300005617 Unclassified 605
143 Ga0068864_100028015 3300005618 Bacteria 4761
144 Ga0068864_100142380 3300005618 Bacteria 2164
145 Ga0068864_100745346 3300005618 Unclassified 959
146 Ga0068866_10120669 3300005718 Unclassified 1477
147 Ga0068866_10490862 3300005718 Unclassified 811
148 Ga0068861_100323368 3300005719 Unclassified 1344
149 Ga0068870_10572679 3300005840 Bacteria 763
150 Ga0068863_100158962 3300005841 Bacteria 2164
151 Ga0068863_100359142 3300005841 Unclassified 1420
152 Ga0068863_100693377 3300005841 Bacteria 1012
153 Ga0068858_100011894 3300005842 Bacteria 8202
154 Ga0068858_100039121 3300005842 Plasmid 4399
155 Ga0068858_100406322 3300005842 Unclassified 1309
156 Ga0068860_100098409 3300005843 Bacteria 2790
157 Ga0068860_100522863 3300005843 Bacteria 1186
158 Ga0068860_101199102 3300005843 Bacteria 779
159 Ga0068860_101300553 3300005843 Bacteria 748
160 Ga0068860_102610898 3300005843 Unclassified 524
161 Ga0068862_100048943 3300005844 Bacteria 3610
162 Ga0068862_100680955 3300005844 Bacteria 994
163 Ga0068862_102144670 3300005844 Bacteria 570
164 Ga0081455_10082967 3300005937 Unclassified 2620
165 Ga0081540_1083921 3300005983 Bacteria 1423
166 Ga0070717_10000933 3300006028 Bacteria 19493
167 Ga0070717_10489500 3300006028 Unclassified 1111
168 Ga0070717_10519238 3300006028 Unclassified 1077
169 Ga0070717_11055452 3300006028 Unclassified 740
170 Ga0075432_10007574 3300006058 Plasmid 3700
171 Ga0070715_10006780 3300006163 Bacteria 3907
172 Ga0070716_100008938 3300006173 Bacteria 4983
173 Ga0070716_100064926 3300006173 Bacteria 2124
174 Ga0070712_100014848 3300006175 Bacteria 5005
175 Ga0070712_100469713 3300006175 Bacteria 1050
176 Ga0075367_10523434 3300006178 Unclassified 753
177 Ga0075427_10000009 3300006194 Bacteria 12449
178 Ga0075366_10076854 3300006195 Bacteria 1993
179 Ga0075366_10129882 3300006195 Unclassified 1520
180 Ga0097621_100000666 3300006237 Bacteria 24162
181 Ga0097621_100040635 3300006237 Bacteria 3740
182 Ga0097621_100898629 3300006237 Bacteria 825
183 Ga0075370_10336811 3300006353 Unclassified 900
184 Ga0068871_100001336 3300006358 Bacteria 16502
185 Ga0068871_100013597 3300006358 Bacteria 6044
186 Ga0068871_100065305 3300006358 Bacteria 2980
187 Ga0068871_101389391 3300006358 Unclassified 662
188 Ga0075430_100003439 3300006846 Bacteria 13241
189 Ga0075434_100128121 3300006871 Bacteria 2555
190 Ga0075429_100667404 3300006880 Bacteria 911
191 Ga0068865_100043504 3300006881 Bacteria 3069
192 Ga0068865_100050517 3300006881 Bacteria 2873
193 Ga0068865_100164329 3300006881 Bacteria 1696
194 Ga0068865_100313978 3300006881 Bacteria 1258
195 Ga0075436_100193717 3300006914 Unclassified 1439
196 Ga0097620_100011876 3300006931 Bacteria 8749
197 Ga0097620_100424146 3300006931 Bacteria 1426
198 Ga0097620_100513449 3300006931 Bacteria 1293
199 Ga0097620_102224660 3300006931 Unclassified 605
200 Ga0075435_100232898 3300007076 Bacteria 1565
201 Ga0105251_10027052 3300009011 Bacteria 2913
202 Ga0105251_10088188 3300009011 Bacteria 1427
203 Ga0105251_10199655 3300009011 Bacteria 901
204 Ga0105250_10037596 3300009092 Bacteria 1942
205 Ga0105250_10073248 3300009092 Bacteria 1385
206 Ga0105240_10001672 3300009093 Bacteria 37648
207 Ga0111539_11414601 3300009094 Bacteria 807
208 Ga0105245_10018207 3300009098 Bacteria 6141
209 Ga0105245_10145289 3300009098 Unclassified 2237
210 Ga0105245_10149545 3300009098 Bacteria 2207
211 Ga0105245_10201770 3300009098 Bacteria 1910
212 Ga0105247_10200223 3300009101 Bacteria 1341
213 Ga0105247_10295375 3300009101 Bacteria 1122
214 Ga0105247_10357734 3300009101 Bacteria 1028
215 Ga0114129_10182637 3300009147 Bacteria 2853
216 Ga0105243_10118755 3300009148 Bacteria 2226
217 Ga0105243_10638357 3300009148 Bacteria 1030
218 Ga0105243_10843821 3300009148 Bacteria 907
219 Ga0105241_10033841 3300009174 Bacteria 3838
220 Ga0105241_10079047 3300009174 Bacteria 2571
221 Ga0105241_11000001 3300009174 Unclassified 782
222 Ga0105241_11052828 3300009174 Bacteria 764
223 Ga0105242_10015199 3300009176 Bacteria 5977
224 Ga0105242_10015761 3300009176 Bacteria 5872
225 Ga0105242_10813815 3300009176 Bacteria 926
226 Ga0105242_11129857 3300009176 Unclassified 799
227 Ga0105248_10019149 3300009177 Bacteria 7572
228 Ga0105248_10019687 3300009177 Bacteria 7470
229 Ga0105248_10043340 3300009177 Bacteria 5045
230 Ga0105248_10073240 3300009177 Bacteria 3850
231 Ga0105248_10077432 3300009177 Bacteria 3739
232 Ga0105248_10115900 3300009177 Bacteria 3022
233 Ga0105237_10000430 3300009545 Bacteria 59639
234 Ga0105237_10090558 3300009545 Bacteria 3048
235 Ga0105238_10031928 3300009551 Bacteria 5358
236 Ga0105249_10053483 3300009553 Bacteria 3691
237 Ga0105249_11872045 3300009553 Bacteria 673
238 Ga0105249_12621044 3300009553 Bacteria 576
239 Ga0105239_10058559 3300010375 Bacteria 4228
240 Ga0105239_10090355 3300010375 Bacteria 3379
241 Ga0105239_10200548 3300010375 Unclassified 2235
242 Ga0105239_10783516 3300010375 Bacteria 1092
243 Ga0105239_11593453 3300010375 Unclassified 755
244 Ga0105246_10116216 3300011119 Bacteria 1974
245 Ga0105246_10346059 3300011119 Bacteria 1216
246 Ga0157338_1026307 3300012515 Unclassified 714
247 Ga0157373_10584251 3300013100 Bacteria 812
248 Ga0157369_10000185 3300013105 Bacteria 86285
249 Ga0157374_10039259 3300013296 Bacteria 4357
250 Ga0157374_10409445 3300013296 Bacteria 1354
251 Ga0157374_12501790 3300013296 Unclassified 544
252 Ga0157374_12638879 3300013296 Unclassified 530
253 Ga0157378_10014693 3300013297 Bacteria 6859
254 Ga0157378_10015420 3300013297 Bacteria 6693
255 Ga0157378_11162186 3300013297 Bacteria 810
256 Ga0157378_11368788 3300013297 Bacteria 750
257 Ga0163162_10076604 3300013306 Bacteria 3407
258 Ga0163162_10087850 3300013306 Bacteria 3188
259 Ga0163162_10615236 3300013306 Bacteria 1212
260 Ga0163162_10818810 3300013306 Unclassified 1048
261 Ga0157372_10299252 3300013307 Bacteria 1871
262 Ga0157372_11734944 3300013307 Bacteria 718
263 Ga0157372_13089311 3300013307 Bacteria 532
264 Ga0157375_10072318 3300013308 Bacteria 3464
265 Ga0157375_10236709 3300013308 Bacteria 1985
266 Ga0157375_10331944 3300013308 Bacteria 1686
267 Ga0157375_10556956 3300013308 Bacteria 1308
268 Ga0157375_10847714 3300013308 Bacteria 1060
269 Ga0157375_10856468 3300013308 Bacteria 1055
270 Ga0157375_11532396 3300013308 Unclassified 787
271 Ga0157375_12204399 3300013308 Bacteria 656
272 Ga0163163_10052405 3300014325 Bacteria 4025
273 Ga0163163_10076257 3300014325 Bacteria 3347
274 Ga0163163_10112147 3300014325 Bacteria 2756
275 Ga0163163_10338545 3300014325 Bacteria 1559
276 Ga0163163_10666861 3300014325 Unclassified 1104
277 Ga0157380_10833921 3300014326 Unclassified 942
278 Ga0182008_10784151 3300014497 Bacteria 552
279 Ga0157379_10027185 3300014968 Bacteria 5094
280 Ga0157379_10047435 3300014968 Bacteria 3833
281 Ga0157379_10090196 3300014968 Bacteria 2750
282 Ga0157376_10024794 3300014969 Bacteria 4716
283 Ga0157376_10113642 3300014969 Bacteria 2388
284 Ga0157376_10315873 3300014969 Bacteria 1484
285 Ga0157376_10410550 3300014969 Unclassified 1311
286 Ga0157376_10840553 3300014969 Bacteria 933
287 Ga0157376_11305384 3300014969 Unclassified 756
288 Ga0163161_10725626 3300017792 Bacteria 829
289 Ga0213876_10204264 3300021384 Bacteria 1050
290 Ga0213876_10694423 3300021384 Bacteria 541
291 Ga0213875_10214221 3300021388 Bacteria 907
292 Ga0207696_1040342 3300025711 Unclassified 1368
293 Ga0207713_1039400 3300025735 Bacteria 1993
294 Ga0207692_10031485 3300025898 Bacteria 2541
295 Ga0207692_10358061 3300025898 Bacteria 901
296 Ga0207642_10083344 3300025899 Unclassified 1559
297 Ga0207642_10296374 3300025899 Unclassified 936
298 Ga0207710_10013177 3300025900 Bacteria 3484
299 Ga0207688_10017748 3300025901 Bacteria 3872
300 Ga0207688_10098650 3300025901 Bacteria 1684
301 Ga0207685_10003301 3300025905 Bacteria 3901
302 Ga0207699_10008335 3300025906 Bacteria 5110
303 Ga0207645_10002717 3300025907 Bacteria 13782
304 Ga0207645_10054866 3300025907 Bacteria 2545
305 Ga0207645_10734815 3300025907 Unclassified 671
306 Ga0207643_10300337 3300025908 Bacteria 999
307 Ga0207705_10628406 3300025909 Unclassified 835
308 Ga0207654_10023420 3300025911 Bacteria 3308
309 Ga0207654_10063873 3300025911 Bacteria 2162
310 Ga0207707_10060909 3300025912 Bacteria 3283
311 Ga0207707_10153767 3300025912 Bacteria 2011
312 Ga0207695_10001549 3300025913 Bacteria 37807
313 Ga0207671_10000523 3300025914 Bacteria 51846
314 Ga0207671_10253039 3300025914 Unclassified 1385
315 Ga0207693_10033808 3300025915 Bacteria 4033
316 Ga0207693_10502976 3300025915 Unclassified 946
317 Ga0207663_10018049 3300025916 Bacteria 3943
318 Ga0207663_10512326 3300025916 Unclassified 933
319 Ga0207660_10011920 3300025917 Bacteria 5673
320 Ga0207657_10228153 3300025919 Unclassified 1490
321 Ga0207649_10100415 3300025920 Bacteria 1914
322 Ga0207649_10170181 3300025920 Bacteria 1517
323 Ga0207649_10186550 3300025920 Bacteria 1455
324 Ga0207652_10002246 3300025921 Bacteria 16436
325 Ga0207652_10163720 3300025921 Bacteria 1994
326 Ga0207681_10512321 3300025923 Bacteria 984
327 Ga0207681_11575072 3300025923 Unclassified 550
328 Ga0207694_10060580 3300025924 Bacteria 2946
329 Ga0207650_10054325 3300025925 Bacteria 2971
330 Ga0207650_10060165 3300025925 Bacteria 2834
331 Ga0207650_10265069 3300025925 Bacteria 1395
332 Ga0207659_10436456 3300025926 Bacteria 1101
333 Ga0207659_10747267 3300025926 Bacteria 839
334 Ga0207659_11171574 3300025926 Unclassified 661
335 Ga0207687_10006688 3300025927 Bacteria 7603
336 Ga0207687_10025586 3300025927 Bacteria 3949
337 Ga0207700_10003532 3300025928 Bacteria 9108
338 Ga0207700_10697450 3300025928 Bacteria 906
339 Ga0207664_10876667 3300025929 Bacteria 806
340 Ga0207644_10010000 3300025931 Bacteria 6246
341 Ga0207644_10114582 3300025931 Bacteria 2043
342 Ga0207644_10212008 3300025931 Bacteria 1532
343 Ga0207644_11501800 3300025931 Unclassified 565
344 Ga0207690_10115075 3300025932 Unclassified 1943
345 Ga0207690_10290142 3300025932 Bacteria 1277
346 Ga0207706_10029303 3300025933 Bacteria 4915
347 Ga0207706_10217901 3300025933 Bacteria 1672
348 Ga0207706_10302400 3300025933 Bacteria 1394
349 Ga0207686_10046331 3300025934 Bacteria 2681
350 Ga0207686_10075854 3300025934 Bacteria 2178
351 Ga0207686_10873631 3300025934 Unclassified 724
352 Ga0207709_10017701 3300025935 Bacteria 3981
353 Ga0207670_10056396 3300025936 Bacteria 2659
354 Ga0207670_10314796 3300025936 Unclassified 1230
355 Ga0207670_10379414 3300025936 Unclassified 1126
356 Ga0207670_11004395 3300025936 Bacteria 702
357 Ga0207669_10039166 3300025937 Bacteria 2736
358 Ga0207669_10195377 3300025937 Bacteria 1463
359 Ga0207704_11272836 3300025938 Unclassified 628
360 Ga0207665_10005155 3300025939 Bacteria 8724
361 Ga0207691_10106444 3300025940 Bacteria 2498
362 Ga0207691_10131737 3300025940 Bacteria 2208
363 Ga0207691_10361495 3300025940 Bacteria 1241
364 Ga0207691_10757317 3300025940 Unclassified 817
365 Ga0207711_10003234 3300025941 Bacteria 14200
366 Ga0207711_10020204 3300025941 Bacteria 5549
367 Ga0207711_10026441 3300025941 Bacteria 4869
368 Ga0207711_10117801 3300025941 Bacteria 2369
369 Ga0207711_10466233 3300025941 Bacteria 1176
370 Ga0207689_10297769 3300025942 Bacteria 1337
371 Ga0207689_10542434 3300025942 Bacteria 976
372 Ga0207661_10120792 3300025944 Bacteria 2230
373 Ga0207661_11203517 3300025944 Unclassified 697
374 Ga0207679_10280788 3300025945 Bacteria 1428
375 Ga0207667_10015424 3300025949 Bacteria 8682
376 Ga0207651_10005748 3300025960 Bacteria 6404
377 Ga0207651_10143991 3300025960 Bacteria 1845
378 Ga0207651_10437507 3300025960 Unclassified 1120
379 Ga0207651_11181883 3300025960 Bacteria 686
380 Ga0207712_10587560 3300025961 Unclassified 962
381 Ga0207712_11115288 3300025961 Bacteria 702
382 Ga0207712_11659022 3300025961 Bacteria 573
383 Ga0207668_10000271 3300025972 Bacteria 34470
384 Ga0207668_10105530 3300025972 Bacteria 2103
385 Ga0207668_10166504 3300025972 Bacteria 1724
386 Ga0207668_10175369 3300025972 Bacteria 1686
387 Ga0207658_10019151 3300025986 Bacteria 4733
388 Ga0207658_10027098 3300025986 Bacteria 4024
389 Ga0207658_10050332 3300025986 Bacteria 3065
390 Ga0207658_10053895 3300025986 Bacteria 2974
391 Ga0207658_10062993 3300025986 Bacteria 2777
392 Ga0207658_10252895 3300025986 Bacteria 1498
393 Ga0207658_10321866 3300025986 Unclassified 1339
394 Ga0207658_10407069 3300025986 Bacteria 1197
395 Ga0207677_10019455 3300026023 Bacteria 4100
396 Ga0207677_10394744 3300026023 Bacteria 1171
397 Ga0207703_10001212 3300026035 Bacteria 24117
398 Ga0207703_10035046 3300026035 Bacteria 3987
399 Ga0207703_10215264 3300026035 Bacteria 1715
400 Ga0207678_10006861 3300026067 Bacteria 10098
401 Ga0207678_10081334 3300026067 Bacteria 2773
402 Ga0207678_10108671 3300026067 Bacteria 2366
403 Ga0207678_10177803 3300026067 Bacteria 1817
404 Ga0207678_10582998 3300026067 Unclassified 980
405 Ga0207678_10646434 3300026067 Bacteria 929
406 Ga0207708_11527723 3300026075 Bacteria 587
407 Ga0207702_10029415 3300026078 Bacteria 4571
408 Ga0207702_12407616 3300026078 Unclassified 514
409 Ga0207641_10002972 3300026088 Bacteria 15339
410 Ga0207648_10004936 3300026089 Bacteria 13571
411 Ga0207648_10169433 3300026089 Bacteria 1930
412 Ga0207648_11109339 3300026089 Unclassified 742
413 Ga0207676_10026046 3300026095 Bacteria 4345
414 Ga0207676_10044015 3300026095 Bacteria 3441
415 Ga0207676_10547391 3300026095 Bacteria 1105
416 Ga0207676_11138449 3300026095 Unclassified 772
417 Ga0207676_11603663 3300026095 Unclassified 648
418 Ga0207675_100151491 3300026118 Bacteria 2207
419 Ga0207675_100765723 3300026118 Bacteria 977
420 Ga0207683_10002999 3300026121 Bacteria 14743
421 Ga0207683_10025150 3300026121 Bacteria 5134
422 Ga0207683_11416526 3300026121 Bacteria 642
423 Ga0207698_10002233 3300026142 Bacteria 11449
424 Ga0268266_10022241 3300028379 Bacteria 5403
425 Ga0268266_10195759 3300028379 Bacteria 1847
426 Ga0268266_11789909 3300028379 Bacteria 589
427 Ga0268265_10024511 3300028380 Bacteria 4270
428 Ga0268265_10178283 3300028380 Bacteria 1823
429 Ga0268264_10272261 3300028381 Bacteria 1582
430 Ga0307410_11314872 3300031852 Bacteria 633
431 Ga0307412_10420908 3300031911 Bacteria 1093
432 Ga0307414_10287197 3300032004 Bacteria 1385
433 Ga0373958_0101406 3300034819 Bacteria 676
434 Ga0373926_0276033 3300035083 Unclassified 654
435 Ga0373928_0028059 3300035084 Bacteria 1229
436 Ga0373949_0007811 3300035090 Unclassified 2343
437 Ga0373932_0042869 3300035112 Bacteria 1314
438 Ga0373932_0051019 3300035112 Bacteria 1228
439 Ga0373932_0065118 3300035112 Bacteria 1117
440 Ga0373941_0309690 3300035115 Unclassified 633
441 Ga0373945_0148524 3300035116 Bacteria 949
442 Ga0373945_0169064 3300035116 Unclassified 895
443 Ga0373960_0149113 3300035121 Bacteria 798
444 Ga0373943_0055242 3300035170 Bacteria 1966
445 Ga0373943_0600778 3300035170 Bacteria 648
446 Ga0373946_0037226 3300035171 Bacteria 1976
447 Ga0373942_0258275 3300035207 Unclassified 594
448 Ga0373961_0186206 3300035241 Unclassified 726
449 Ga0373931_0120080 3300035691 Bacteria 1501
450 Ga0373931_0300706 3300035691 Unclassified 991
451 Ga0373931_0574950 3300035691 Unclassified 734
452 Ga0373935_0044114 3300035692 Bacteria 2809
453 Ga0373927_0029461 3300035695 Bacteria 3578
454 Ga0373927_0050928 3300035695 Plasmid 2678
455 Ga0373947_0009292 3300035725 Bacteria 5649
456 Ga0373947_0022566 3300035725 Bacteria 3651
457 Ga0373947_0428124 3300035725 Unclassified 895
458 Ga0373925_0020720 3300037068 Bacteria 4790
459 Ga0373925_0395716 3300037068 Bacteria 1126
460 Ga0395900_0017492 3300037418 Bacteria 7316
461 Ga0395898_0445680 3300037466 Bacteria 1233
462 Ga0395905_0017820 3300037471 Bacteria 6747
463 Ga0436364_0366706 3300037853 Bacteria 1033
464 Ga0395901_1170945 3300038443 Bacteria 736
465 Ga0436365_1876033 3300039437 Bacteria 1050
466 Ga0436360_0878593 3300039438 Bacteria 556
467 Ga0451843_1429951 3300041509 Bacteria 586
468 Ga0466965_0122331 3300044683 Bacteria 1345
469 Ga0466966_0264371 3300044684 Bacteria 1036
470 Ga0466961_0205176 3300044693 Bacteria 1218
471 Ga0466963_0120377 3300044694 Bacteria 1806
472 Ga0466963_0200609 3300044694 Bacteria 1395
473 Ga0466964_0260280 3300044706 Bacteria 859
474 Ga0466971_0214642 3300044719 Bacteria 911
475 Ga0466970_0092937 3300044765 Bacteria 1638
476 Ga0466957_0895065 3300044842 Bacteria 634
477 Ga0466957_1231167 3300044842 Bacteria 542
478 Ga0466960_0141064 3300044901 Bacteria 1280
479 Ga0466959_0502420 3300045049 Unclassified 819
480 Ga0466959_0566975 3300045049 Bacteria 765
481 Ga0466958_0462571 3300045836 Bacteria 822
482 Ga0466967_0142421 3300045976 Bacteria 2234
483 Ga0466967_0493004 3300045976 Bacteria 1201
484 Ga0495603_0015759 3300046455 Bacteria 4571
485 Ga0495603_0822951 3300046455 Unclassified 529
486 Ga0495629_0019585 3300046459 Bacteria 4833
487 Ga0495651_1023508 3300046462 Unclassified 500
488 Ga0495580_0349287 3300046472 Unclassified 1002
489 Ga0495580_0538707 3300046472 Unclassified 776
490 Ga0495582_0053144 3300046473 Unclassified 2234
491 Ga0495664_0731295 3300046477 Unclassified 584
492 Ga0495594_0292248 3300046499 Bacteria 928
493 Ga0495594_0342060 3300046499 Bacteria 852
494 Ga0495633_0148229 3300046558 Bacteria 1084
495 Ga0495588_0053820 3300046674 Unclassified 2076
496 Ga0495647_0112607 3300046681 Unclassified 1137
497 Ga0495658_0016331 3300046683 Unclassified 3821
498 Ga0495658_0432713 3300046683 Unclassified 840
499 Ga0495658_0881926 3300046683 Unclassified 572
500 Ga0495613_0023604 3300046689 Bacteria 4584
501 Ga0495624_0368452 3300046690 Unclassified 864
502 Ga0495674_0600703 3300047319 Unclassified 872
503 Ga0495676_0148709 3300047321 Unclassified 1670
504 Ga0495680_0079899 3300047322 Bacteria 2472
505 Ga0495593_0021290 3300047673 Bacteria 3624
506 Ga0496100_0007741 3300048903 Bacteria 5950
507 Ga0496100_0079993 3300048903 Bacteria 2204
508 Ga0496100_0661171 3300048903 Unclassified 814
509 Ga0496101_0094583 3300048904 Bacteria 2227
510 Ga0496101_0425856 3300048904 Bacteria 1046
511 Ga0496101_0779546 3300048904 Unclassified 754
512 Ga0496102_0033504 3300048905 Bacteria 4617
513 Ga0496102_0420425 3300048905 Bacteria 1255
514 Ga0496102_0748248 3300048905 Bacteria 900
515 Ga0496102_1435258 3300048905 Bacteria 609
516 Ga0496103_0417818 3300048906 Bacteria 861
517 Ga0496103_0636065 3300048906 Bacteria 678
518 Ga0496104_0001388 3300048907 Bacteria 20943
519 Ga0496104_0007797 3300048907 Bacteria 9490
520 Ga0496104_0041943 3300048907 Bacteria 4291
521 Ga0496104_0808828 3300048907 Bacteria 843
522 Ga0496105_0013068 3300048908 Bacteria 6582
523 Ga0496105_0041899 3300048908 Bacteria 3773
524 Ga0496105_0071602 3300048908 Bacteria 2864
525 Ga0496105_0117871 3300048908 Unclassified 2190
526 Ga0496105_0298129 3300048908 Bacteria 1296
527 Ga0496106_0260789 3300048909 Bacteria 1387
528 Ga0496106_0919792 3300048909 Unclassified 690
529 Ga0496107_0081900 3300048910 Bacteria 2353
530 Ga0496107_0121909 3300048910 Bacteria 1921
531 Ga0496107_0123586 3300048910 Bacteria 1907
532 Ga0496107_0163357 3300048910 Bacteria 1651
533 Ga0496107_0191738 3300048910 Bacteria 1518
534 Ga0496107_0581446 3300048910 Bacteria 828
535 Ga0496108_0008964 3300048911 Bacteria 8108
536 Ga0496108_0044469 3300048911 Bacteria 3706
537 Ga0496108_0061198 3300048911 Bacteria 3167
538 Ga0496108_0167731 3300048911 Bacteria 1899
539 Ga0496108_0182717 3300048911 Bacteria 1816
540 Ga0496108_0643188 3300048911 Bacteria 922
541 Ga0496109_0044642 3300048912 Bacteria 4021
542 Ga0496109_0056999 3300048912 Bacteria 3565
543 Ga0496109_0057883 3300048912 Bacteria 3539
544 Ga0496109_0141901 3300048912 Bacteria 2246
545 Ga0496109_0169055 3300048912 Bacteria 2050
546 Ga0496110_0019127 3300048913 Bacteria 5756
547 Ga0496110_0356630 3300048913 Bacteria 1332
548 Ga0496110_0666941 3300048913 Unclassified 940
549 Ga0496111_0015345 3300048914 Bacteria 5255
550 Ga0496111_0073163 3300048914 Bacteria 2495
551 Ga0496111_0348295 3300048914 Bacteria 1096
552 Ga0496111_1325154 3300048914 Bacteria 507
553 Ga0496112_0000505 3300048915 Bacteria 26413
554 Ga0496112_0021485 3300048915 Bacteria 6138
555 Ga0496112_0082457 3300048915 Bacteria 3180
556 Ga0496112_0180576 3300048915 Bacteria 2074
557 Ga0496112_0321751 3300048915 Bacteria 1491
558 Ga0496113_0001614 3300048916 Bacteria 12687
559 Ga0496114_0004878 3300048917 Bacteria 10447
560 Ga0496114_0027607 3300048917 Bacteria 4652
561 Ga0496114_0057252 3300048917 Bacteria 3254
562 Ga0496115_0021536 3300048918 Bacteria 4982
563 Ga0496115_0042026 3300048918 Bacteria 3640
564 Ga0496115_0303530 3300048918 Bacteria 1308
565 Ga0496115_0555171 3300048918 Unclassified 917
566 Ga0496121_0310465 3300048924 Bacteria 1066
567 Ga0496124_0483963 3300048927 Bacteria 835
568 Ga0496126_0001546 3300048929 Bacteria 35366
569 Ga0501031_1017452 3300049568 Bacteria 529
570 Ga0501032_0768424 3300049569 Bacteria 609
571 Ga0501033_0510261 3300049570 Bacteria 831
572 Ga0501037_0144881 3300049573 Bacteria 1699
573 Ga0501047_0054357 3300049581 Bacteria 3873
574 Ga0501044_0031361 3300049823 Bacteria 5594
575 Ga0501044_0426653 3300049823 Bacteria 1235
576 nmdc:mga0k408_125781_c1 3300050493 Unclassified 1520
577 nmdc:mga0k408_22570_c1 3300050493 Bacteria 3543
578 nmdc:mga06z11_455468_c1 3300050494 Unclassified 773
579 nmdc:mga07m45_297855_c1 3300050496 Unclassified 938
580 nmdc:mga05p37_5456_c1 3300050507 Bacteria 14927
581 nmdc:mga09592_1901_c1 3300050508 Bacteria 16800
582 nmdc:mga0qj67_2438_c1 3300050509 Bacteria 13248
583 nmdc:mga08y16_8345_c1 3300050511 Bacteria 10837
584 nmdc:mga0n895_126769_c1 3300050512 Bacteria 2577
585 nmdc:mga0n895_41920_c1 3300050512 Bacteria 4452
586 nmdc:mga0n895_488022_c1 3300050512 Bacteria 1242
587 nmdc:mga0n895_908969_c1 3300050512 Bacteria 865
588 nmdc:mga0n895_96265_c1 3300050512 Bacteria 2965
589 nmdc:mga0rr50_22010_c1 3300050513 Bacteria 4366
590 nmdc:mga0rr50_251016_c1 3300050513 Bacteria 1469
591 nmdc:mga0rr50_262823_c1 3300050513 Bacteria 1436
592 nmdc:mga08x19_387817_c1 3300050514 Unclassified 979
593 nmdc:mga0a205_1733_c1 3300050515 Bacteria 18856
594 nmdc:mga0a205_683388_c1 3300050515 Bacteria 877
595 Ga0495619_0011543 3300053085 Bacteria 5569
596 Ga0500559_0000716 3300053136 Bacteria 21776
597 Ga0500622_0091380 3300053156 Bacteria 1510
598 Ga0157372_11142638
599 JGI24748J21848_1025472
600 Ga0065712_10081284
601 Ga0065715_10250984
602 Ga0070658_10063386
603 Ga0070658_10857225
604 Ga0070676_10006695
605 Ga0070676_10040066
606 Ga0070683_100358653
607 Ga0070683_101774379
608 Ga0070683_101780261
609 Ga0070690_100033621
610 Ga0070670_100033835
611 Ga0070670_100235277
612 Ga0068869_100066496
613 Ga0068869_100250332
614 Ga0068869_100542408
615 Ga0068869_100890996
616 Ga0070666_10017712
617 Ga0070680_100014202
618 Ga0070680_100980380
619 Ga0070682_100014897
620 Ga0070682_100022660
621 Ga0070682_101112353
622 Ga0068868_100042745
623 Ga0068868_100077643
624 Ga0068868_100160360
625 Ga0070660_100389146
626 Ga0070689_100011212
627 Ga0070689_100478440
628 Ga0070689_100561307
629 Ga0070689_100799567
630 Ga0070689_101217845
631 Ga0070691_10078028
632 Ga0070687_100555987
633 Ga0070661_100145215
634 Ga0070661_100151008
635 Ga0070661_100492319
636 Ga0070668_100001379
637 Ga0070668_100171912
638 Ga0070668_100302359
639 Ga0070669_100019385
640 Ga0070669_100245584
641 Ga0070675_100755029
642 Ga0070675_100773360
643 Ga0070675_101010128
644 Ga0070671_100031813
645 Ga0070671_100169126
646 Ga0070671_100204126
647 Ga0070671_100282889
648 Ga0070671_100333268
649 Ga0070671_100747156
650 Ga0070674_100006800
651 Ga0070674_100272470
652 Ga0070673_100024647
653 Ga0070673_100026988
654 Ga0070673_100068673
655 Ga0070673_100213313
656 Ga0070673_100559006
657 Ga0070673_101423816
658 Ga0070688_100084758
659 Ga0070688_100188124
660 Ga0070688_100494298
661 Ga0070688_100917870
662 Ga0070659_100168969
663 Ga0070659_100772967
664 Ga0070667_100043834
665 Ga0070667_100110958
666 Ga0070667_100245423
667 Ga0070667_100280185
668 Ga0070667_100333209
669 Ga0070667_101159926
670 Ga0070667_101547714
671 Ga0070709_10006294
672 Ga0070709_11278668
673 Ga0070714_100088052
674 Ga0070714_100689813
675 Ga0070714_101051951
676 Ga0070713_100010156
677 Ga0070713_100055904
678 Ga0070710_10326377
679 Ga0070711_100018319
680 Ga0070711_100079530
681 Ga0070711_100429725
682 Ga0070711_100939951
683 Ga0070705_100033340
684 Ga0070700_100417293
685 Ga0070694_100601735
686 Ga0070663_100008316
687 Ga0070663_100031636
688 Ga0070663_100298568
689 Ga0070663_100448830
690 Ga0070663_101209760
691 Ga0070678_100023311
692 Ga0070678_100035698
693 Ga0070678_100700222
694 Ga0070678_101704446
695 Ga0070662_100027211
696 Ga0070662_100207629
697 Ga0070662_100576506
698 Ga0070681_10003122
699 Ga0070681_10097705
700 Ga0068867_100622094
701 Ga0070685_10008342
702 Ga0070679_100218380
703 Ga0070679_102051197
704 Ga0070684_100321419
705 Ga0070684_100586463
706 Ga0070684_101010012
707 Ga0068853_101310254
708 Ga0070672_100054659
709 Ga0070672_100146586
710 Ga0070672_100366250
711 Ga0070672_100388253
712 Ga0070686_100010171
713 Ga0070686_100044085
714 Ga0070695_100978536
715 Ga0070696_100014177
716 Ga0070693_100003704
717 Ga0070693_100258557
718 Ga0070665_100118517
719 Ga0070665_100515395
720 Ga0070665_100646867
721 Ga0070704_101205336
722 Ga0068855_100017094
723 Ga0070664_100247877
724 Ga0070664_100346677
725 Ga0070664_100418982
726 Ga0070664_100722980
727 Ga0068854_100689440
728 Ga0068856_100010418
729 Ga0068856_101208572
730 Ga0070702_100063867
731 Ga0070702_100068917
732 Ga0070702_100142289
733 Ga0070702_101310477
734 Ga0070702_101811137
735 Ga0068852_100005404
736 Ga0068859_100011876
737 Ga0068859_100424131
738 Ga0068859_100513461
739 Ga0068859_102225317
740 Ga0068864_100028015
741 Ga0068864_100142380
742 Ga0068864_100745346
743 Ga0068866_10120669
744 Ga0068866_10490862
745 Ga0068861_100323368
746 Ga0068870_10572679
747 Ga0068863_100158962
748 Ga0068863_100359142
749 Ga0068863_100693377
750 Ga0068858_100011894
751 Ga0068858_100039121
752 Ga0068858_100406322
753 Ga0068860_100098409
754 Ga0068860_100522863
755 Ga0068860_101199102
756 Ga0068860_101300553
757 Ga0068860_102610898
758 Ga0068862_100048943
759 Ga0068862_100680955
760 Ga0068862_102144670
761 Ga0081455_10082967
762 Ga0081540_1083921
763 Ga0070717_10000933
764 Ga0070717_10489500
765 Ga0070717_10519238
766 Ga0070717_11055452
767 Ga0075432_10007574
768 Ga0070715_10006780
769 Ga0070716_100008938
770 Ga0070716_100064926
771 Ga0070712_100014848
772 Ga0070712_100469713
773 Ga0075367_10523434
774 Ga0075427_10000009
775 Ga0075366_10076854
776 Ga0075366_10129882
777 Ga0097621_100000666
778 Ga0097621_100040635
779 Ga0097621_100898629
780 Ga0075370_10336811
781 Ga0068871_100001336
782 Ga0068871_100013597
783 Ga0068871_100065305
784 Ga0068871_101389391
785 Ga0075430_100003439
786 Ga0075434_100128121
787 Ga0075429_100667404
788 Ga0068865_100043504
789 Ga0068865_100050517
790 Ga0068865_100164329
791 Ga0068865_100313978
792 Ga0075436_100193717
793 Ga0097620_100011876
794 Ga0097620_100424146
795 Ga0097620_100513449
796 Ga0097620_102224660
797 Ga0075435_100232898
798 Ga0105251_10027052
799 Ga0105251_10088188
800 Ga0105251_10199655
801 Ga0105250_10037596
802 Ga0105250_10073248
803 Ga0105240_10001672
804 Ga0111539_11414601
805 Ga0105245_10018207
806 Ga0105245_10145289
807 Ga0105245_10149545
808 Ga0105245_10201770
809 Ga0105247_10200223
810 Ga0105247_10295375
811 Ga0105247_10357734
812 Ga0114129_10182637
813 Ga0105243_10118755
814 Ga0105243_10638357
815 Ga0105243_10843821
816 Ga0105241_10033841
817 Ga0105241_10079047
818 Ga0105241_11000001
819 Ga0105241_11052828
820 Ga0105242_10015199
821 Ga0105242_10015761
822 Ga0105242_10813815
823 Ga0105242_11129857
824 Ga0105248_10019149
825 Ga0105248_10019687
826 Ga0105248_10043340
827 Ga0105248_10073240
828 Ga0105248_10077432
829 Ga0105248_10115900
830 Ga0105237_10000430
831 Ga0105237_10090558
832 Ga0105238_10031928
833 Ga0105249_10053483
834 Ga0105249_11872045
835 Ga0105249_12621044
836 Ga0105239_10058559
837 Ga0105239_10090355
838 Ga0105239_10200548
839 Ga0105239_10783516
840 Ga0105239_11593453
841 Ga0105246_10116216
842 Ga0105246_10346059
843 Ga0157338_1026307
844 Ga0157373_10584251
845 Ga0157369_10000185
846 Ga0157374_10039259
847 Ga0157374_10409445
848 Ga0157374_12501790
849 Ga0157374_12638879
850 Ga0157378_10014693
851 Ga0157378_10015420
852 Ga0157378_11162186
853 Ga0157378_11368788
854 Ga0163162_10076604
855 Ga0163162_10087850
856 Ga0163162_10615236
857 Ga0163162_10818810
858 Ga0157372_10299252
859 Ga0157372_11734944
860 Ga0157372_13089311
861 Ga0157375_10072318
862 Ga0157375_10236709
863 Ga0157375_10331944
864 Ga0157375_10556956
865 Ga0157375_10847714
866 Ga0157375_10856468
867 Ga0157375_11532396
868 Ga0157375_12204399
869 Ga0163163_10052405
870 Ga0163163_10076257
871 Ga0163163_10112147
872 Ga0163163_10338545
873 Ga0163163_10666861
874 Ga0157380_10833921
875 Ga0182008_10784151
876 Ga0157379_10027185
877 Ga0157379_10047435
878 Ga0157379_10090196
879 Ga0157376_10024794
880 Ga0157376_10113642
881 Ga0157376_10315873
882 Ga0157376_10410550
883 Ga0157376_10840553
884 Ga0157376_11305384
885 Ga0163161_10725626
886 Ga0213876_10204264
887 Ga0213876_10694423
888 Ga0213875_10214221
889 Ga0207696_1040342
890 Ga0207713_1039400
891 Ga0207692_10031485
892 Ga0207692_10358061
893 Ga0207642_10083344
894 Ga0207642_10296374
895 Ga0207710_10013177
896 Ga0207688_10017748
897 Ga0207688_10098650
898 Ga0207685_10003301
899 Ga0207699_10008335
900 Ga0207645_10002717
901 Ga0207645_10054866
902 Ga0207645_10734815
903 Ga0207643_10300337
904 Ga0207705_10628406
905 Ga0207654_10023420
906 Ga0207654_10063873
907 Ga0207707_10060909
908 Ga0207707_10153767
909 Ga0207695_10001549
910 Ga0207671_10000523
911 Ga0207671_10253039
912 Ga0207693_10033808
913 Ga0207693_10502976
914 Ga0207663_10018049
915 Ga0207663_10512326
916 Ga0207660_10011920
917 Ga0207657_10228153
918 Ga0207649_10100415
919 Ga0207649_10170181
920 Ga0207649_10186550
921 Ga0207652_10002246
922 Ga0207652_10163720
923 Ga0207681_10512321
924 Ga0207681_11575072
925 Ga0207694_10060580
926 Ga0207650_10054325
927 Ga0207650_10060165
928 Ga0207650_10265069
929 Ga0207659_10436456
930 Ga0207659_10747267
931 Ga0207659_11171574
932 Ga0207687_10006688
933 Ga0207687_10025586
934 Ga0207700_10003532
935 Ga0207700_10697450
936 Ga0207664_10876667
937 Ga0207644_10010000
938 Ga0207644_10114582
939 Ga0207644_10212008
940 Ga0207644_11501800
941 Ga0207690_10115075
942 Ga0207690_10290142
943 Ga0207706_10029303
944 Ga0207706_10217901
945 Ga0207706_10302400
946 Ga0207686_10046331
947 Ga0207686_10075854
948 Ga0207686_10873631
949 Ga0207709_10017701
950 Ga0207670_10056396
951 Ga0207670_10314796
952 Ga0207670_10379414
953 Ga0207670_11004395
954 Ga0207669_10039166
955 Ga0207669_10195377
956 Ga0207704_11272836
957 Ga0207665_10005155
958 Ga0207691_10106444
959 Ga0207691_10131737
960 Ga0207691_10361495
961 Ga0207691_10757317
962 Ga0207711_10003234
963 Ga0207711_10020204
964 Ga0207711_10026441
965 Ga0207711_10117801
966 Ga0207711_10466233
967 Ga0207689_10297769
968 Ga0207689_10542434
969 Ga0207661_10120792
970 Ga0207661_11203517
971 Ga0207679_10280788
972 Ga0207667_10015424
973 Ga0207651_10005748
974 Ga0207651_10143991
975 Ga0207651_10437507
976 Ga0207651_11181883
977 Ga0207712_10587560
978 Ga0207712_11115288
979 Ga0207712_11659022
980 Ga0207668_10000271
981 Ga0207668_10105530
982 Ga0207668_10166504
983 Ga0207668_10175369
984 Ga0207658_10019151
985 Ga0207658_10027098
986 Ga0207658_10050332
987 Ga0207658_10053895
988 Ga0207658_10062993
989 Ga0207658_10252895
990 Ga0207658_10321866
991 Ga0207658_10407069
992 Ga0207677_10019455
993 Ga0207677_10394744
994 Ga0207703_10001212
995 Ga0207703_10035046
996 Ga0207703_10215264
997 Ga0207678_10006861
998 Ga0207678_10081334
999 Ga0207678_10108671
1000 Ga0207678_10177803
1001 Ga0207678_10582998
1002 Ga0207678_10646434
1003 Ga0207708_11527723
1004 Ga0207702_10029415
1005 Ga0207702_12407616
1006 Ga0207641_10002972
1007 Ga0207648_10004936
1008 Ga0207648_10169433
1009 Ga0207648_11109339
1010 Ga0207676_10026046
1011 Ga0207676_10044015
1012 Ga0207676_10547391
1013 Ga0207676_11138449
1014 Ga0207676_11603663
1015 Ga0207675_100151491
1016 Ga0207675_100765723
1017 Ga0207683_10002999
1018 Ga0207683_10025150
1019 Ga0207683_11416526
1020 Ga0207698_10002233
1021 Ga0268266_10022241
1022 Ga0268266_10195759
1023 Ga0268266_11789909
1024 Ga0268265_10024511
1025 Ga0268265_10178283
1026 Ga0268264_10272261
1027 Ga0307410_11314872
1028 Ga0307412_10420908
1029 Ga0307414_10287197
1030 Ga0373958_0101406
1031 Ga0373926_0276033
1032 Ga0373928_0028059
1033 Ga0373949_0007811
1034 Ga0373932_0042869
1035 Ga0373932_0051019
1036 Ga0373932_0065118
1037 Ga0373941_0309690
1038 Ga0373945_0148524
1039 Ga0373945_0169064
1040 Ga0373960_0149113
1041 Ga0373943_0055242
1042 Ga0373943_0600778
1043 Ga0373946_0037226
1044 Ga0373942_0258275
1045 Ga0373961_0186206
1046 Ga0373931_0120080
1047 Ga0373931_0300706
1048 Ga0373931_0574950
1049 Ga0373935_0044114
1050 Ga0373927_0029461
1051 Ga0373927_0050928
1052 Ga0373947_0009292
1053 Ga0373947_0022566
1054 Ga0373947_0428124
1055 Ga0373925_0020720
1056 Ga0373925_0395716
1057 Ga0395900_0017492
1058 Ga0395898_0445680
1059 Ga0395905_0017820
1060 Ga0436364_0366706
1061 Ga0395901_1170945
1062 Ga0436365_1876033
1063 Ga0436360_0878593
1064 Ga0451843_1429951
1065 Ga0466965_0122331
1066 Ga0466966_0264371
1067 Ga0466961_0205176
1068 Ga0466963_0120377
1069 Ga0466963_0200609
1070 Ga0466964_0260280
1071 Ga0466971_0214642
1072 Ga0466970_0092937
1073 Ga0466957_0895065
1074 Ga0466957_1231167
1075 Ga0466960_0141064
1076 Ga0466959_0502420
1077 Ga0466959_0566975
1078 Ga0466958_0462571
1079 Ga0466967_0142421
1080 Ga0466967_0493004
1081 Ga0495603_0015759
1082 Ga0495603_0822951
1083 Ga0495629_0019585
1084 Ga0495651_1023508
1085 Ga0495580_0349287
1086 Ga0495580_0538707
1087 Ga0495582_0053144
1088 Ga0495664_0731295
1089 Ga0495594_0292248
1090 Ga0495594_0342060
1091 Ga0495633_0148229
1092 Ga0495588_0053820
1093 Ga0495647_0112607
1094 Ga0495658_0016331
1095 Ga0495658_0432713
1096 Ga0495658_0881926
1097 Ga0495613_0023604
1098 Ga0495624_0368452
1099 Ga0495674_0600703
1100 Ga0495676_0148709
1101 Ga0495680_0079899
1102 Ga0495593_0021290
1103 Ga0496100_0007741
1104 Ga0496100_0079993
1105 Ga0496100_0661171
1106 Ga0496101_0094583
1107 Ga0496101_0425856
1108 Ga0496101_0779546
1109 Ga0496102_0033504
1110 Ga0496102_0420425
1111 Ga0496102_0748248
1112 Ga0496102_1435258
1113 Ga0496103_0417818
1114 Ga0496103_0636065
1115 Ga0496104_0001388
1116 Ga0496104_0007797
1117 Ga0496104_0041943
1118 Ga0496104_0808828
1119 Ga0496105_0013068
1120 Ga0496105_0041899
1121 Ga0496105_0071602
1122 Ga0496105_0117871
1123 Ga0496105_0298129
1124 Ga0496106_0260789
1125 Ga0496106_0919792
1126 Ga0496107_0081900
1127 Ga0496107_0121909
1128 Ga0496107_0123586
1129 Ga0496107_0163357
1130 Ga0496107_0191738
1131 Ga0496107_0581446
1132 Ga0496108_0008964
1133 Ga0496108_0044469
1134 Ga0496108_0061198
1135 Ga0496108_0167731
1136 Ga0496108_0182717
1137 Ga0496108_0643188
1138 Ga0496109_0044642
1139 Ga0496109_0056999
1140 Ga0496109_0057883
1141 Ga0496109_0141901
1142 Ga0496109_0169055
1143 Ga0496110_0019127
1144 Ga0496110_0356630
1145 Ga0496110_0666941
1146 Ga0496111_0015345
1147 Ga0496111_0073163
1148 Ga0496111_0348295
1149 Ga0496111_1325154
1150 Ga0496112_0000505
1151 Ga0496112_0021485
1152 Ga0496112_0082457
1153 Ga0496112_0180576
1154 Ga0496112_0321751
1155 Ga0496113_0001614
1156 Ga0496114_0004878
1157 Ga0496114_0027607
1158 Ga0496114_0057252
1159 Ga0496115_0021536
1160 Ga0496115_0042026
1161 Ga0496115_0303530
1162 Ga0496115_0555171
1163 Ga0496121_0310465
1164 Ga0496124_0483963
1165 Ga0496126_0001546
1166 Ga0501031_1017452
1167 Ga0501032_0768424
1168 Ga0501033_0510261
1169 Ga0501037_0144881
1170 Ga0501047_0054357
1171 Ga0501044_0031361
1172 Ga0501044_0426653
1173 nmdc:mga0k408_125781_c1
1174 nmdc:mga0k408_22570_c1
1175 nmdc:mga06z11_455468_c1
1176 nmdc:mga07m45_297855_c1
1177 nmdc:mga05p37_5456_c1
1178 nmdc:mga09592_1901_c1
1179 nmdc:mga0qj67_2438_c1
1180 nmdc:mga08y16_8345_c1
1181 nmdc:mga0n895_126769_c1
1182 nmdc:mga0n895_41920_c1
1183 nmdc:mga0n895_488022_c1
1184 nmdc:mga0n895_908969_c1
1185 nmdc:mga0n895_96265_c1
1186 nmdc:mga0rr50_22010_c1
1187 nmdc:mga0rr50_251016_c1
1188 nmdc:mga0rr50_262823_c1
1189 nmdc:mga08x19_387817_c1
1190 nmdc:mga0a205_1733_c1
1191 nmdc:mga0a205_683388_c1
1192 Ga0495619_0011543
1193 Ga0500559_0000716
1194 Ga0500622_0091380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07784

DUF1622

Protein of unknown function (DUF1622)

37

116

0.91

Map