F467670

General Info

Members Datasets Scaffolds Average Seq Length
597 306 592 323

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10514900|Ga0163163_105149001
Length 364
Sequence MEKGTLMGFKPTRRAAALVAAGLVSTLPVTLSLVAYSTPQAAYEKIIAAFQKTDAGKNVKFTQSYGASGDQSRAVAAGLPADFVEFSLETDMTRLVDAKMVDPSWNTDEYKGMVTDSVVSLVTRKGNPKHIKSFEDLAKPGVEVITPNPFSSGAARWNIMGAYGSQTQTGKSEAEATAFLAKVMSNVAVQDDSGRAALQTFTGGKGDVLVSYENEAIFAQQNGQDVDYVVPDNTLLIENPAAVTSTSKHPKEAKAFLDFVRSDEAQKIFAENGYRPVSKTADTAGQDFPTPSGLFTIQDLGGWDAVATKFFDADKGIVTDIERKLGELGIELVGDTPEEFARYIRAEIPKWSRVIEDAGARVDR

Samples

Sample ID Description Type Environment
1 2643221641 Nocardioides sp. Root122 Isolate Unclassified
2 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
3 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
4 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
5 2891562705 Microbispora tritici MT50 Isolate Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
186 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
192 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
193 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
194 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
195 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
299 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0.17
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 14.74
Rhizosphere 79.56
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100003225 3300005329 Bacteria 13167
2 Ga0070683_100015581 3300005329 Bacteria 6682
3 Ga0070683_100030455 3300005329 Bacteria 4899
4 Ga0070683_100039278 3300005329 Bacteria 4344
5 Ga0070666_10107850 3300005335 Bacteria 1924
6 Ga0070680_100002170 3300005336 Bacteria 14460
7 Ga0070680_100010521 3300005336 Bacteria 7135
8 Ga0070682_100049865 3300005337 Bacteria 2611
9 Ga0070682_100052056 3300005337 Bacteria 2561
10 Ga0070682_100072884 3300005337 Bacteria 2202
11 Ga0070682_100080812 3300005337 Bacteria 2103
12 Ga0068868_100023214 3300005338 Bacteria 4693
13 Ga0068868_100028653 3300005338 Bacteria 4259
14 Ga0068868_100069246 3300005338 Bacteria 2811
15 Ga0070660_100008777 3300005339 Bacteria 7079
16 Ga0070691_10007083 3300005341 Bacteria 5140
17 Ga0070687_100061509 3300005343 Bacteria 1985
18 Ga0070692_10005087 3300005345 Bacteria 5561
19 Ga0070668_100173074 3300005347 Bacteria 1759
20 Ga0070671_100046207 3300005355 Bacteria 3621
21 Ga0070671_100184943 3300005355 Bacteria 1765
22 Ga0070659_100019489 3300005366 Bacteria 5142
23 Ga0070659_100116133 3300005366 Bacteria 2163
24 Ga0070659_100241529 3300005366 Bacteria 1495
25 Ga0070667_100009366 3300005367 Bacteria 8119
26 Ga0070709_10175924 3300005434 Bacteria 1499
27 Ga0070714_100163275 3300005435 Unclassified 2017
28 Ga0070714_100211772 3300005435 Bacteria 1777
29 Ga0070713_100048274 3300005436 Bacteria 3504
30 Ga0070713_100070322 3300005436 Bacteria 2954
31 Ga0070713_100236245 3300005436 Bacteria 1663
32 Ga0070710_10028698 3300005437 Bacteria 2978
33 Ga0070710_10103619 3300005437 Bacteria 1698
34 Ga0070711_100019758 3300005439 Bacteria 4328
35 Ga0070705_100021168 3300005440 Bacteria 3455
36 Ga0070700_100005180 3300005441 Bacteria 6887
37 Ga0070700_100182381 3300005441 Unclassified 1462
38 Ga0070694_100030564 3300005444 Bacteria 3525
39 Ga0070663_100262326 3300005455 Bacteria 1371
40 Ga0070678_100014820 3300005456 Bacteria 4932
41 Ga0070678_100136784 3300005456 Bacteria 1955
42 Ga0070662_100015570 3300005457 Bacteria 5096
43 Ga0070681_10000389 3300005458 Bacteria 35630
44 Ga0070681_10036940 3300005458 Bacteria 4902
45 Ga0070681_10043873 3300005458 Bacteria 4476
46 Ga0068867_100015132 3300005459 Bacteria 5471
47 Ga0068867_100053246 3300005459 Bacteria 2989
48 Ga0070698_100015738 3300005471 Bacteria 7990
49 Ga0070679_100000432 3300005530 Bacteria 35542
50 Ga0070679_100001364 3300005530 Bacteria 21559
51 Ga0070679_100067321 3300005530 Bacteria 3571
52 Ga0070679_100073354 3300005530 Bacteria 3414
53 Ga0070679_100084818 3300005530 Bacteria 3155
54 Ga0070679_100186674 3300005530 Bacteria 2043
55 Ga0070679_100342170 3300005530 Bacteria 1444
56 Ga0070684_100014577 3300005535 Bacteria 6372
57 Ga0070684_100021769 3300005535 Bacteria 5340
58 Ga0070684_100034944 3300005535 Bacteria 4300
59 Ga0070684_100047128 3300005535 Bacteria 3735
60 Ga0070684_100109026 3300005535 Bacteria 2481
61 Ga0070684_100250706 3300005535 Bacteria 1618
62 Ga0068853_100065858 3300005539 Bacteria 3144
63 Ga0068853_100222962 3300005539 Bacteria 1723
64 Ga0070686_100045397 3300005544 Bacteria 2767
65 Ga0070686_100051309 3300005544 Bacteria 2625
66 Ga0070696_100011731 3300005546 Bacteria 5873
67 Ga0070696_100021145 3300005546 Bacteria 4411
68 Ga0070693_100004465 3300005547 Bacteria 6620
69 Ga0070693_100014558 3300005547 Bacteria 4033
70 Ga0070665_100149968 3300005548 Bacteria 2334
71 Ga0070665_100171449 3300005548 Bacteria 2171
72 Ga0070704_100063834 3300005549 Bacteria 2644
73 Ga0068855_100025453 3300005563 Bacteria 7080
74 Ga0068855_100056258 3300005563 Bacteria 4616
75 Ga0068855_100062246 3300005563 Bacteria 4356
76 Ga0068855_100187441 3300005563 Bacteria 2336
77 Ga0068855_100312630 3300005563 Bacteria 1738
78 Ga0070664_100005588 3300005564 Bacteria 10104
79 Ga0070664_100037399 3300005564 Bacteria 4082
80 Ga0068857_100060610 3300005577 Bacteria 3361
81 Ga0068854_100028280 3300005578 Bacteria 3872
82 Ga0068856_100085745 3300005614 Bacteria 3129
83 Ga0068856_100243628 3300005614 Bacteria 1813
84 Ga0070702_100019322 3300005615 Bacteria 3551
85 Ga0068852_100018755 3300005616 Bacteria 5457
86 Ga0068852_100047997 3300005616 Bacteria 3646
87 Ga0068859_100119675 3300005617 Bacteria 2700
88 Ga0068864_100058454 3300005618 Bacteria 3333
89 Ga0068864_100082227 3300005618 Bacteria 2825
90 Ga0068864_100097262 3300005618 Bacteria 2606
91 Ga0068866_10002851 3300005718 Bacteria 7129
92 Ga0068866_10030984 3300005718 Bacteria 2572
93 Ga0068861_100041688 3300005719 Bacteria 3439
94 Ga0068861_100248361 3300005719 Bacteria 1517
95 Ga0068863_100098528 3300005841 Bacteria 2776
96 Ga0068858_100066785 3300005842 Bacteria 3330
97 Ga0068860_100197881 3300005843 Bacteria 1947
98 Ga0068860_100257417 3300005843 Bacteria 1701
99 Ga0068862_100000510 3300005844 Bacteria 41329
100 Ga0068862_100031590 3300005844 Bacteria 4472
101 Ga0081455_10010784 3300005937 Bacteria 9234
102 Ga0081455_10038446 3300005937 Bacteria 4238
103 Ga0081538_10016041 3300005981 Bacteria 5765
104 Ga0081540_1009141 3300005983 Bacteria 6839
105 Ga0081540_1014982 3300005983 Bacteria 4929
106 Ga0070717_10033367 3300006028 Bacteria 4153
107 Ga0070717_10060400 3300006028 Bacteria 3139
108 Ga0070717_10297670 3300006028 Bacteria 1434
109 Ga0075432_10014031 3300006058 Bacteria 2728
110 Ga0070715_10083554 3300006163 Bacteria 1454
111 Ga0070716_100103814 3300006173 Bacteria 1748
112 Ga0070716_100177489 3300006173 Bacteria 1395
113 Ga0070712_100017253 3300006175 Bacteria 4671
114 Ga0097621_100046456 3300006237 Bacteria 3513
115 Ga0068871_100040342 3300006358 Bacteria 3739
116 Ga0075428_100018030 3300006844 Bacteria 7801
117 Ga0075428_100114132 3300006844 Bacteria 2943
118 Ga0075428_100221146 3300006844 Bacteria 2045
119 Ga0075430_100002429 3300006846 Bacteria 15503
120 Ga0075430_100143414 3300006846 Bacteria 1989
121 Ga0075433_10082568 3300006852 Bacteria 2834
122 Ga0075433_10091074 3300006852 Bacteria 2695
123 Ga0075434_100005674 3300006871 Bacteria 11389
124 Ga0075429_100259703 3300006880 Bacteria 1521
125 Ga0068865_100077167 3300006881 Bacteria 2380
126 Ga0075436_100055638 3300006914 Bacteria 2732
127 Ga0075436_100114204 3300006914 Bacteria 1886
128 Ga0075436_100120628 3300006914 Bacteria 1834
129 Ga0097620_100119672 3300006931 Bacteria 2700
130 Ga0075435_100011150 3300007076 Bacteria 6594
131 Ga0075435_100019858 3300007076 Bacteria 5140
132 Ga0075435_100287453 3300007076 Bacteria 1404
133 Ga0105240_10012405 3300009093 Bacteria 11765
134 Ga0105240_10019995 3300009093 Bacteria 8939
135 Ga0105240_10113791 3300009093 Bacteria 3269
136 Ga0105240_10224947 3300009093 Bacteria 2184
137 Ga0105240_10418448 3300009093 Unclassified 1506
138 Ga0111539_10045842 3300009094 Bacteria 5232
139 Ga0111539_10111312 3300009094 Bacteria 3213
140 Ga0105245_10025810 3300009098 Bacteria 5167
141 Ga0105245_10036032 3300009098 Bacteria 4393
142 Ga0105245_10052738 3300009098 Bacteria 3648
143 Ga0105245_10109325 3300009098 Bacteria 2569
144 Ga0105245_10127540 3300009098 Bacteria 2383
145 Ga0105245_10136565 3300009098 Bacteria 2305
146 Ga0105245_10574636 3300009098 Bacteria 1151
147 Ga0114129_10094114 3300009147 Bacteria 4150
148 Ga0114129_10200400 3300009147 Bacteria 2704
149 Ga0105243_10008961 3300009148 Bacteria 7647
150 Ga0105243_10019768 3300009148 Bacteria 5106
151 Ga0105243_10039302 3300009148 Bacteria 3687
152 Ga0105243_10135297 3300009148 Bacteria 2096
153 Ga0105243_10252719 3300009148 Bacteria 1574
154 Ga0105241_10204309 3300009174 Bacteria 1652
155 Ga0105241_10241227 3300009174 Bacteria 1528
156 Ga0105242_10062841 3300009176 Bacteria 3057
157 Ga0105242_10222032 3300009176 Bacteria 1689
158 Ga0105248_10015966 3300009177 Bacteria 8268
159 Ga0105248_10059254 3300009177 Bacteria 4300
160 Ga0105248_10083536 3300009177 Bacteria 3592
161 Ga0105248_10095780 3300009177 Bacteria 3342
162 Ga0105248_10110073 3300009177 Bacteria 3106
163 Ga0105248_10134337 3300009177 Bacteria 2791
164 Ga0105237_10019493 3300009545 Bacteria 7005
165 Ga0105237_10349014 3300009545 Bacteria 1484
166 Ga0105237_10415289 3300009545 Bacteria 1351
167 Ga0105238_10078038 3300009551 Bacteria 3303
168 Ga0105238_10287409 3300009551 Bacteria 1626
169 Ga0105238_10387089 3300009551 Bacteria 1390
170 Ga0105249_10007467 3300009553 Bacteria 9538
171 Ga0105249_10060351 3300009553 Bacteria 3478
172 Ga0105249_10351355 3300009553 Bacteria 1494
173 Ga0105239_10063124 3300010375 Bacteria 4067
174 Ga0105239_10108285 3300010375 Bacteria 3079
175 Ga0105239_10113310 3300010375 Bacteria 3007
176 Ga0105246_10186550 3300011119 Bacteria 1602
177 Ga0157373_10107256 3300013100 Bacteria 1964
178 Ga0157373_10153164 3300013100 Bacteria 1622
179 Ga0157371_10045730 3300013102 Bacteria 3114
180 Ga0157370_10006514 3300013104 Bacteria 12857
181 Ga0157370_10507520 3300013104 Bacteria 1107
182 Ga0157369_10029323 3300013105 Bacteria 6081
183 Ga0157369_10150590 3300013105 Bacteria 2458
184 Ga0157369_10188938 3300013105 Bacteria 2165
185 Ga0157369_10345041 3300013105 Bacteria 1547
186 Ga0157374_10416544 3300013296 Bacteria 1342
187 Ga0157374_10437009 3300013296 Bacteria 1309
188 Ga0157378_10007242 3300013297 Bacteria 9688
189 Ga0157378_10028732 3300013297 Bacteria 4910
190 Ga0157378_10425071 3300013297 Bacteria 1314
191 Ga0163162_10363552 3300013306 Bacteria 1580
192 Ga0157372_10166394 3300013307 Bacteria 2550
193 Ga0157372_10384278 3300013307 Bacteria 1636
194 Ga0157372_10744608 3300013307 Bacteria 1140
195 Ga0157375_10007894 3300013308 Bacteria 9316
196 Ga0157375_10014719 3300013308 Bacteria 6989
197 Ga0157375_10103294 3300013308 Bacteria 2937
198 Ga0163163_10011817 3300014325 Bacteria 7938
199 Ga0163163_10048708 3300014325 Bacteria 4168
200 Ga0163163_10514900 3300014325 Bacteria 1259
201 Ga0157380_10027943 3300014326 Bacteria 4296
202 Ga0157380_10225162 3300014326 Bacteria 1680
203 Ga0182008_10025657 3300014497 Bacteria 2993
204 Ga0157377_10019488 3300014745 Bacteria 3545
205 Ga0157377_10224521 3300014745 Unclassified 1204
206 Ga0157379_10027267 3300014968 Bacteria 5085
207 Ga0157379_10122190 3300014968 Bacteria 2343
208 Ga0157379_10150641 3300014968 Bacteria 2098
209 Ga0157379_10211601 3300014968 Bacteria 1755
210 Ga0157376_10005763 3300014969 Bacteria 8678
211 Ga0157376_10045765 3300014969 Bacteria 3605
212 Ga0157376_10266673 3300014969 Bacteria 1607
213 Ga0206356_11468302 3300020070 Bacteria 1857
214 Ga0207653_10018292 3300025885 Bacteria 2207
215 Ga0207692_10007180 3300025898 Bacteria 4552
216 Ga0207692_10087907 3300025898 Bacteria 1678
217 Ga0207710_10060327 3300025900 Bacteria 1719
218 Ga0207688_10184900 3300025901 Bacteria 1244
219 Ga0207680_10129001 3300025903 Bacteria 1664
220 Ga0207680_10164595 3300025903 Unclassified 1490
221 Ga0207645_10050880 3300025907 Bacteria 2646
222 Ga0207705_10166810 3300025909 Bacteria 1656
223 Ga0207707_10000109 3300025912 Bacteria 82750
224 Ga0207707_10111890 3300025912 Bacteria 2387
225 Ga0207707_10240268 3300025912 Bacteria 1575
226 Ga0207695_10013638 3300025913 Bacteria 9678
227 Ga0207695_10066307 3300025913 Bacteria 3708
228 Ga0207671_10027216 3300025914 Bacteria 4275
229 Ga0207671_10052836 3300025914 Bacteria 3011
230 Ga0207671_10176636 3300025914 Bacteria 1660
231 Ga0207693_10001725 3300025915 Bacteria 19220
232 Ga0207693_10309857 3300025915 Bacteria 1236
233 Ga0207663_10002887 3300025916 Bacteria 8302
234 Ga0207663_10060963 3300025916 Bacteria 2392
235 Ga0207663_10173341 3300025916 Bacteria 1534
236 Ga0207660_10001772 3300025917 Bacteria 14445
237 Ga0207660_10144556 3300025917 Bacteria 1821
238 Ga0207660_10321231 3300025917 Bacteria 1236
239 Ga0207662_10031709 3300025918 Bacteria 3071
240 Ga0207657_10013373 3300025919 Bacteria 8052
241 Ga0207657_10020652 3300025919 Bacteria 6218
242 Ga0207649_10152166 3300025920 Bacteria 1594
243 Ga0207652_10000248 3300025921 Bacteria 56095
244 Ga0207652_10000900 3300025921 Bacteria 28122
245 Ga0207652_10004169 3300025921 Bacteria 11790
246 Ga0207652_10010262 3300025921 Bacteria 7538
247 Ga0207652_10025461 3300025921 Bacteria 4920
248 Ga0207652_10063390 3300025921 Bacteria 3197
249 Ga0207687_10036898 3300025927 Bacteria 3332
250 Ga0207687_10188322 3300025927 Bacteria 1604
251 Ga0207687_10416058 3300025927 Bacteria 1108
252 Ga0207700_10229960 3300025928 Bacteria 1576
253 Ga0207664_10100558 3300025929 Bacteria 2388
254 Ga0207664_10207290 3300025929 Bacteria 1695
255 Ga0207644_10160417 3300025931 Bacteria 1747
256 Ga0207690_10009698 3300025932 Bacteria 5718
257 Ga0207690_10075595 3300025932 Bacteria 2336
258 Ga0207706_10006396 3300025933 Bacteria 10944
259 Ga0207686_10050979 3300025934 Bacteria 2576
260 Ga0207686_10107130 3300025934 Bacteria 1878
261 Ga0207686_10203788 3300025934 Bacteria 1418
262 Ga0207709_10031650 3300025935 Bacteria 3092
263 Ga0207670_10147339 3300025936 Bacteria 1742
264 Ga0207665_10003605 3300025939 Bacteria 10341
265 Ga0207691_10083617 3300025940 Bacteria 2866
266 Ga0207711_10053203 3300025941 Bacteria 3472
267 Ga0207711_10075258 3300025941 Bacteria 2938
268 Ga0207711_10098258 3300025941 Bacteria 2586
269 Ga0207661_10001916 3300025944 Bacteria 14287
270 Ga0207661_10096635 3300025944 Bacteria 2472
271 Ga0207679_10003163 3300025945 Bacteria 10164
272 Ga0207667_10033092 3300025949 Bacteria 5562
273 Ga0207667_10115465 3300025949 Bacteria 2767
274 Ga0207667_10116708 3300025949 Bacteria 2750
275 Ga0207667_10438239 3300025949 Unclassified 1328
276 Ga0207712_10104357 3300025961 Bacteria 2113
277 Ga0207712_10216493 3300025961 Bacteria 1529
278 Ga0207640_10061687 3300025981 Bacteria 2484
279 Ga0207640_10067280 3300025981 Bacteria 2396
280 Ga0207658_10024480 3300025986 Bacteria 4225
281 Ga0207658_10059699 3300025986 Bacteria 2842
282 Ga0207677_10030239 3300026023 Bacteria 3453
283 Ga0207677_10031180 3300026023 Bacteria 3412
284 Ga0207677_10163002 3300026023 Bacteria 1734
285 Ga0207703_10039091 3300026035 Bacteria 3790
286 Ga0207639_10133735 3300026041 Bacteria 2056
287 Ga0207678_10005158 3300026067 Bacteria 11710
288 Ga0207678_10045634 3300026067 Bacteria 3789
289 Ga0207702_10020480 3300026078 Bacteria 5475
290 Ga0207702_10126349 3300026078 Bacteria 2296
291 Ga0207702_10128485 3300026078 Bacteria 2278
292 Ga0207648_10027472 3300026089 Bacteria 5051
293 Ga0207648_10108218 3300026089 Bacteria 2440
294 Ga0207676_10223721 3300026095 Bacteria 1678
295 Ga0207674_10033681 3300026116 Bacteria 5362
296 Ga0207674_10076069 3300026116 Bacteria 3366
297 Ga0207674_10080449 3300026116 Bacteria 3262
298 Ga0207675_100017588 3300026118 Bacteria 6670
299 Ga0207675_100037798 3300026118 Bacteria 4503
300 Ga0207675_100083040 3300026118 Bacteria 3004
301 Ga0207683_10004132 3300026121 Bacteria 12556
302 Ga0207683_10056920 3300026121 Bacteria 3431
303 Ga0207683_10089503 3300026121 Bacteria 2740
304 Ga0207698_10038080 3300026142 Bacteria 3549
305 Ga0207698_10118278 3300026142 Bacteria 2237
306 Ga0209998_10011918 3300027717 Bacteria 1805
307 Ga0207428_10029242 3300027907 Bacteria 4570
308 Ga0207428_10064950 3300027907 Bacteria 2881
309 Ga0268266_10000406 3300028379 Bacteria 65477
310 Ga0268265_10009761 3300028380 Bacteria 6481
311 Ga0268264_10052743 3300028381 Bacteria 3391
312 Ga0265319_1014850 3300028563 Bacteria 3039
313 Ga0265319_1040462 3300028563 Bacteria 1576
314 Ga0265334_10002240 3300028573 Bacteria 9091
315 Ga0265318_10010527 3300028577 Bacteria 4022
316 Ga0265338_10026055 3300028800 Bacteria 5912
317 Ga0265338_10087525 3300028800 Bacteria 2588
318 Ga0265338_10152283 3300028800 Bacteria 1795
319 Ga0265332_10012597 3300031238 Bacteria 3750
320 Ga0265325_10006999 3300031241 Bacteria 6795
321 Ga0265325_10015611 3300031241 Bacteria 4266
322 Ga0265340_10004670 3300031247 Bacteria 7621
323 Ga0265339_10108802 3300031249 Bacteria 1436
324 Ga0265316_10021507 3300031344 Bacteria 5461
325 Ga0265314_10025523 3300031711 Bacteria 4455
326 Ga0307405_10285287 3300031731 Bacteria 1245
327 Ga0307416_100055068 3300032002 Bacteria 3201
328 Ga0307415_100190534 3300032126 Bacteria 1618
329 Ga0373928_0035301 3300035084 Bacteria 1126
330 Ga0373944_0048942 3300035089 Bacteria 1327
331 Ga0373951_0008911 3300035091 Bacteria 2262
332 Ga0373945_0009448 3300035116 Bacteria 3196
333 Ga0373943_0009954 3300035170 Bacteria 4261
334 Ga0373943_0207871 3300035170 Bacteria 1086
335 Ga0373946_0017246 3300035171 Bacteria 2761
336 Ga0373955_0166791 3300035172 Bacteria 1302
337 Ga0373961_0071088 3300035241 Bacteria 1076
338 Ga0373927_0085845 3300035695 Bacteria 2043
339 Ga0373947_0007670 3300035725 Bacteria 6237
340 Ga0373937_0625391 3300036401 Bacteria 1022
341 Ga0373925_0105351 3300037068 Bacteria 2173
342 Ga0395899_0000614 3300037312 Bacteria 37099
343 Ga0395898_0008093 3300037466 Bacteria 11131
344 Ga0395898_0308714 3300037466 Bacteria 1509
345 Ga0395905_0003094 3300037471 Bacteria 17973
346 Ga0395901_0001542 3300038443 Bacteria 23884
347 Ga0395901_0131053 3300038443 Bacteria 2635
348 Ga0395901_0216405 3300038443 Bacteria 2004
349 Ga0451795_1063198 3300041456 Bacteria 3361
350 Ga0451798_0138267 3300041458 Bacteria 1925
351 Ga0451800_0933833 3300041459 Bacteria 2591
352 Ga0451802_0241505 3300041460 Bacteria 3728
353 Ga0451804_0599873 3300041463 Bacteria 5172
354 Ga0451807_0826841 3300041486 Bacteria 2128
355 Ga0451839_1417283 3300041496 Bacteria 4083
356 Ga0451841_1173131 3300041498 Bacteria 2565
357 Ga0451845_0312446 3300041501 Bacteria 4159
358 Ga0451849_1446404 3300041505 Bacteria 3548
359 Ga0451851_0670690 3300041507 Bacteria 5107
360 Ga0451855_0466827 3300041511 Bacteria 2242
361 Ga0451853_1409041 3300041512 Bacteria 1579
362 Ga0451853_1985226 3300041512 Bacteria 1360
363 Ga0439448_0017142 3300042005 Bacteria 2210
364 Ga0439459_0022340 3300042438 Bacteria 1223
365 Ga0466965_0140011 3300044683 Bacteria 1259
366 Ga0466966_0005854 3300044684 Bacteria 8107
367 Ga0466961_0009629 3300044693 Bacteria 6151
368 Ga0466963_0002778 3300044694 Bacteria 9868
369 Ga0466963_0002920 3300044694 Bacteria 9654
370 Ga0466964_0001744 3300044706 Bacteria 7530
371 Ga0466971_0057252 3300044719 Bacteria 1758
372 Ga0466968_0034543 3300044735 Bacteria 2110
373 Ga0466970_0108799 3300044765 Bacteria 1513
374 Ga0466957_0117616 3300044842 Bacteria 1692
375 Ga0466960_0000003 3300044901 Bacteria 86010
376 Ga0466960_0066433 3300044901 Bacteria 1783
377 Ga0466960_0108778 3300044901 Bacteria 1437
378 Ga0466960_0127366 3300044901 Bacteria 1340
379 Ga0466959_0076933 3300045049 Bacteria 2409
380 Ga0466959_0143353 3300045049 Bacteria 1687
381 Ga0466958_0021497 3300045836 Bacteria 3772
382 Ga0466958_0123305 3300045836 Bacteria 1623
383 Ga0466967_0004040 3300045976 Bacteria 9787
384 Ga0466967_0024629 3300045976 Bacteria 4951
385 Ga0466967_0031792 3300045976 Bacteria 4449
386 Ga0466967_0032332 3300045976 Bacteria 4416
387 Ga0466967_0203090 3300045976 Bacteria 1877
388 Ga0495603_0000065 3300046455 Bacteria 46432
389 Ga0495641_0006525 3300046461 Bacteria 7538
390 Ga0495653_0160342 3300046463 Bacteria 1562
391 Ga0495650_0000053 3300046471 Bacteria 316684
392 Ga0495580_0032597 3300046472 Bacteria 3759
393 Ga0495582_0005435 3300046473 Bacteria 7110
394 Ga0495664_0000007 3300046477 Bacteria 386710
395 Ga0495664_0018844 3300046477 Bacteria 3961
396 Ga0495594_0005133 3300046499 Bacteria 6734
397 Ga0495594_0006993 3300046499 Bacteria 5799
398 Ga0495596_0109799 3300046500 Bacteria 1071
399 Ga0495608_0042395 3300046511 Bacteria 3044
400 Ga0495628_0000891 3300046516 Bacteria 27515
401 Ga0495652_0342603 3300046529 Bacteria 1073
402 Ga0495587_0021592 3300046536 Bacteria 3971
403 Ga0495645_0163728 3300046543 Bacteria 1536
404 Ga0495634_0058532 3300046642 Bacteria 2568
405 Ga0495657_0114175 3300046675 Bacteria 1708
406 Ga0495599_0028906 3300046678 Bacteria 3474
407 Ga0495646_0012695 3300046680 Bacteria 5353
408 Ga0495658_0029271 3300046683 Bacteria 2980
409 Ga0495674_0059682 3300047319 Bacteria 3331
410 Ga0495676_0000444 3300047321 Bacteria 33833
411 Ga0495676_0042791 3300047321 Bacteria 3714
412 Ga0495680_0229809 3300047322 Bacteria 1321
413 Ga0495684_0044420 3300047471 Bacteria 3402
414 Ga0495684_0089440 3300047471 Bacteria 2333
415 Ga0495686_0107931 3300047472 Unclassified 1673
416 Ga0495602_0000533 3300048088 Bacteria 35335
417 Ga0496100_0002209 3300048903 Bacteria 9825
418 Ga0496100_0019691 3300048903 Bacteria 4032
419 Ga0496100_0039134 3300048903 Bacteria 3010
420 Ga0496100_0111672 3300048903 Bacteria 1900
421 Ga0496100_0220841 3300048903 Bacteria 1390
422 Ga0496100_0326809 3300048903 Bacteria 1153
423 Ga0496101_0004150 3300048904 Bacteria 9075
424 Ga0496101_0059585 3300048904 Bacteria 2767
425 Ga0496101_0101867 3300048904 Bacteria 2150
426 Ga0496101_0106736 3300048904 Bacteria 2103
427 Ga0496102_0023310 3300048905 Bacteria 5495
428 Ga0496102_0047737 3300048905 Bacteria 3892
429 Ga0496102_0057030 3300048905 Bacteria 3564
430 Ga0496102_0125159 3300048905 Bacteria 2402
431 Ga0496102_0180760 3300048905 Bacteria 1987
432 Ga0496102_0306499 3300048905 Bacteria 1497
433 Ga0496102_0508472 3300048905 Bacteria 1127
434 Ga0496102_0524115 3300048905 Bacteria 1107
435 Ga0496103_0044000 3300048906 Bacteria 2750
436 Ga0496104_0000647 3300048907 Bacteria 29839
437 Ga0496104_0005379 3300048907 Bacteria 11209
438 Ga0496104_0014887 3300048907 Bacteria 7031
439 Ga0496104_0069697 3300048907 Bacteria 3342
440 Ga0496104_0072012 3300048907 Bacteria 3286
441 Ga0496104_0092404 3300048907 Bacteria 2893
442 Ga0496104_0113418 3300048907 Bacteria 2599
443 Ga0496105_0008415 3300048908 Bacteria 8019
444 Ga0496105_0014471 3300048908 Bacteria 6281
445 Ga0496105_0026893 3300048908 Bacteria 4695
446 Ga0496105_0043284 3300048908 Bacteria 3713
447 Ga0496105_0043926 3300048908 Bacteria 3685
448 Ga0496105_0049153 3300048908 Bacteria 3481
449 Ga0496105_0132175 3300048908 Bacteria 2057
450 Ga0496106_0006195 3300048909 Bacteria 8849
451 Ga0496106_0016306 3300048909 Bacteria 5497
452 Ga0496106_0093541 3300048909 Bacteria 2323
453 Ga0496106_0123354 3300048909 Bacteria 2027
454 Ga0496107_0025569 3300048910 Bacteria 4180
455 Ga0496107_0053818 3300048910 Bacteria 2903
456 Ga0496107_0077461 3300048910 Bacteria 2422
457 Ga0496107_0180676 3300048910 Bacteria 1566
458 Ga0496107_0373857 3300048910 Bacteria 1060
459 Ga0496108_0000632 3300048911 Bacteria 27472
460 Ga0496108_0009048 3300048911 Bacteria 8067
461 Ga0496108_0034929 3300048911 Bacteria 4177
462 Ga0496108_0065740 3300048911 Bacteria 3057
463 Ga0496108_0164281 3300048911 Bacteria 1919
464 Ga0496109_0003540 3300048912 Bacteria 13033
465 Ga0496109_0041443 3300048912 Bacteria 4170
466 Ga0496109_0174082 3300048912 Bacteria 2020
467 Ga0496109_0182112 3300048912 Bacteria 1973
468 Ga0496110_0009847 3300048913 Bacteria 7746
469 Ga0496110_0015250 3300048913 Bacteria 6390
470 Ga0496110_0050894 3300048913 Bacteria 3639
471 Ga0496110_0052536 3300048913 Bacteria 3581
472 Ga0496110_0135835 3300048913 Bacteria 2222
473 Ga0496110_0294870 3300048913 Bacteria 1477
474 Ga0496111_0000319 3300048914 Bacteria 23843
475 Ga0496111_0005473 3300048914 Bacteria 8144
476 Ga0496111_0006910 3300048914 Bacteria 7406
477 Ga0496111_0014498 3300048914 Bacteria 5386
478 Ga0496111_0025487 3300048914 Bacteria 4172
479 Ga0496111_0036669 3300048914 Bacteria 3507
480 Ga0496111_0038057 3300048914 Bacteria 3445
481 Ga0496112_0021172 3300048915 Bacteria 6179
482 Ga0496112_0021993 3300048915 Bacteria 6070
483 Ga0496112_0022291 3300048915 Bacteria 6034
484 Ga0496112_0042483 3300048915 Bacteria 4447
485 Ga0496112_0049387 3300048915 Bacteria 4124
486 Ga0496112_0400164 3300048915 Bacteria 1313
487 Ga0496112_0408811 3300048915 Bacteria 1296
488 Ga0496113_0001938 3300048916 Bacteria 11845
489 Ga0496114_0014110 3300048917 Bacteria 6405
490 Ga0496114_0031553 3300048917 Bacteria 4359
491 Ga0496114_0037283 3300048917 Bacteria 4020
492 Ga0496114_0039612 3300048917 Bacteria 3900
493 Ga0496114_0101409 3300048917 Bacteria 2458
494 Ga0496114_0112164 3300048917 Bacteria 2337
495 Ga0496115_0001134 3300048918 Bacteria 19237
496 Ga0496115_0140350 3300048918 Bacteria 1994
497 Ga0496115_0208708 3300048918 Bacteria 1613
498 Ga0496115_0360806 3300048918 Bacteria 1184
499 Ga0496116_0000441 3300048919 Bacteria 58149
500 Ga0496117_0025669 3300048920 Bacteria 4627
501 Ga0496118_0005040 3300048921 Bacteria 15236
502 Ga0496118_0075915 3300048921 Bacteria 2393
503 Ga0496118_0084957 3300048921 Bacteria 2206
504 Ga0496119_0001484 3300048922 Bacteria 28124
505 Ga0496119_0021019 3300048922 Bacteria 4733
506 Ga0496119_0031659 3300048922 Bacteria 3540
507 Ga0496120_0001894 3300048923 Bacteria 23214
508 Ga0496121_0032823 3300048924 Bacteria 4710
509 Ga0496121_0052296 3300048924 Bacteria 3432
510 Ga0496124_0063748 3300048927 Bacteria 3078
511 Ga0496125_0060265 3300048928 Bacteria 3052
512 Ga0496125_0269580 3300048928 Bacteria 1062
513 Ga0496126_0020971 3300048929 Bacteria 6395
514 Ga0496126_0230653 3300048929 Bacteria 1551
515 Ga0501031_0000058 3300049568 Bacteria 59109
516 Ga0501032_0002722 3300049569 Bacteria 13772
517 Ga0501033_0015135 3300049570 Bacteria 5853
518 Ga0501034_0017696 3300049571 Bacteria 7308
519 Ga0501034_0042047 3300049571 Bacteria 4625
520 Ga0501034_0269645 3300049571 Bacteria 1643
521 Ga0501036_0143599 3300049572 Bacteria 2013
522 Ga0501037_0002322 3300049573 Bacteria 13746
523 Ga0501038_0000485 3300049574 Bacteria 34975
524 Ga0501039_0091953 3300049575 Bacteria 2365
525 Ga0501039_0255958 3300049575 Bacteria 1376
526 Ga0501042_0050607 3300049578 Bacteria 2963
527 Ga0501042_0096561 3300049578 Bacteria 2123
528 Ga0501043_0002786 3300049579 Bacteria 14607
529 Ga0501043_0065129 3300049579 Bacteria 2862
530 Ga0501046_0003436 3300049580 Bacteria 14532
531 Ga0501047_0000647 3300049581 Bacteria 36587
532 Ga0501047_0050484 3300049581 Bacteria 4017
533 Ga0501047_0226448 3300049581 Bacteria 1724
534 Ga0501047_0268533 3300049581 Bacteria 1552
535 Ga0501048_0002614 3300049582 Bacteria 13786
536 Ga0501048_0031782 3300049582 Bacteria 3818
537 Ga0501067_0000031 3300049583 Bacteria 87732
538 Ga0501067_0017294 3300049583 Bacteria 3984
539 Ga0501067_0259559 3300049583 Bacteria 967
540 Ga0501068_0000010 3300049584 Bacteria 66003
541 Ga0501068_0099840 3300049584 Bacteria 1798
542 Ga0501069_0000032 3300049585 Bacteria 96425
543 Ga0501069_0013992 3300049585 Bacteria 4286
544 Ga0501069_0018008 3300049585 Bacteria 3809
545 Ga0501069_0168996 3300049585 Unclassified 1261
546 Ga0501070_0000309 3300049586 Bacteria 44629
547 Ga0501070_0039396 3300049586 Bacteria 3942
548 Ga0501071_0032605 3300049587 Bacteria 3700
549 Ga0501072_0194301 3300049588 Bacteria 1618
550 Ga0501073_0109804 3300049589 Bacteria 1913
551 Ga0501074_0077931 3300049590 Bacteria 2378
552 Ga0501079_0034967 3300049741 Bacteria 3866
553 Ga0501079_0044196 3300049741 Bacteria 3438
554 Ga0501079_0253760 3300049741 Bacteria 1375
555 Ga0501080_0228964 3300049742 Bacteria 1699
556 Ga0501081_0050372 3300049743 Bacteria 2869
557 Ga0501035_0020800 3300049822 Bacteria 6028
558 Ga0501044_0001651 3300049823 Bacteria 26204
559 Ga0501044_0097969 3300049823 Bacteria 2952
560 nmdc:mga05p37_319075_c1 3300050507 Bacteria 1839
561 nmdc:mga09592_63716_c1 3300050508 Bacteria 3120
562 nmdc:mga08y16_495077_c1 3300050511 Bacteria 1243
563 nmdc:mga0n895_131020_c1 3300050512 Bacteria 2533
564 nmdc:mga0n895_247783_c1 3300050512 Bacteria 1808
565 nmdc:mga0n895_88486_c1 3300050512 Bacteria 3097
566 nmdc:mga0rr50_300509_c1 3300050513 Bacteria 1343
567 nmdc:mga0rr50_46336_c1 3300050513 Bacteria 3201
568 nmdc:mga08x19_100039_c1 3300050514 Bacteria 1923
569 nmdc:mga08x19_5861_c1 3300050514 Bacteria 7270
570 nmdc:mga08x19_62918_c1 3300050514 Bacteria 2407
571 nmdc:mga0a205_80362_c1 3300050515 Bacteria 3151
572 nmdc:mga0a205_86634_c1 3300050515 Bacteria 3025
573 Ga0495601_0004984 3300053077 Bacteria 7709
574 Ga0495601_0079238 3300053077 Bacteria 2106
575 Ga0495601_0082129 3300053077 Bacteria 2068
576 Ga0495601_0219218 3300053077 Bacteria 1243
577 Ga0495595_0001606 3300053084 Bacteria 8818
578 Ga0495595_0088039 3300053084 Bacteria 1487
579 Ga0495619_0009718 3300053085 Bacteria 6064
580 Ga0495619_0193450 3300053085 Bacteria 1408
581 Ga0500566_0054748 3300053094 Bacteria 2274
582 Ga0500572_030666 3300053111 Bacteria 1497
583 Ga0500658_0066416 3300053134 Bacteria 1513
584 Ga0500568_0044074 3300053139 Bacteria 1781
585 Ga0500616_0029955 3300053153 Bacteria 2991
586 Ga0501084_0029513 3300054114 Bacteria 4587
587 Ga0501082_0013634 3300060353 Bacteria 6986
588 Ga0466962_0032772 3300061719 Bacteria 2486
589 Ga0466962_0091691 3300061719 Bacteria 1456
590 Ga0530510_0010459 3300061734 Bacteria 6506
591 Ga0530510_0063714 3300061734 Bacteria 2669
592 Ga0530510_0165667 3300061734 Bacteria 1636

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0058532 Ga0495634_0058532_56_913 282
2 3300047319 Ga0495674_0059682 Ga0495674_0059682_1864_2721 282
3 3300047471 Ga0495684_0089440 Ga0495684_0089440_1219_2076 282
4 3300053077 Ga0495601_0082129 Ga0495601_0082129_910_1767 282
5 3300053084 Ga0495595_0001606 Ga0495595_0001606_7048_7905 282
6 3300053085 Ga0495619_0009718 Ga0495619_0009718_616_1473 282
7 3300006914 Ga0075436_100055638 Ga0075436_1000556382 283
8 3300009094 Ga0111539_10045842 Ga0111539_100458422 283
9 3300035170 Ga0373943_0207871 Ga0373943_0207871_204_1076 284
10 3300046529 Ga0495652_0342603 Ga0495652_0342603_26_898 284
11 3300006058 Ga0075432_10014031 Ga0075432_100140314 285
12 3300006844 Ga0075428_100221146 Ga0075428_1002211462 285
13 3300006852 Ga0075433_10082568 Ga0075433_100825682 285
14 3300007076 Ga0075435_100287453 Ga0075435_1002874532 285
15 3300027907 Ga0207428_10029242 Ga0207428_100292425 285
16 3300050515 nmdc:mga0a205_80362_c1 nmdc:mga0a205_80362_c1_1711_2700 285
17 3300013105 Ga0157369_10345041 Ga0157369_103450412 287
18 3300028800 Ga0265338_10087525 Ga0265338_100875252 287
19 3300044901 Ga0466960_0000003 Ga0466960_0000003_75322_76350 288
20 3300028381 Ga0268264_10052743 Ga0268264_100527433 290
21 3300046516 Ga0495628_0000891 Ga0495628_0000891_1290_2282 291
22 3300048088 Ga0495602_0000533 Ga0495602_0000533_19547_20539 291
23 3300009551 Ga0105238_10078038 Ga0105238_100780382 292
24 3300048928 Ga0496125_0269580 Ga0496125_0269580_18_1046 292
25 3300044901 Ga0466960_0127366 Ga0466960_0127366_225_1256 293
26 3300048905 Ga0496102_0180760 Ga0496102_0180760_10_969 293
27 3300005329 Ga0070683_100030455 Ga0070683_1000304556 294
28 3300005336 Ga0070680_100010521 Ga0070680_1000105219 294
29 3300005337 Ga0070682_100072884 Ga0070682_1000728842 294
30 3300005339 Ga0070660_100008777 Ga0070660_1000087776 294
31 3300005366 Ga0070659_100019489 Ga0070659_1000194894 294
32 3300005458 Ga0070681_10043873 Ga0070681_100438732 294
33 3300005530 Ga0070679_100067321 Ga0070679_1000673214 294
34 3300005535 Ga0070684_100014577 Ga0070684_1000145773 294
35 3300005539 Ga0068853_100065858 Ga0068853_1000658584 294
36 3300005563 Ga0068855_100187441 Ga0068855_1001874412 294
37 3300005564 Ga0070664_100037399 Ga0070664_1000373996 294
38 3300005614 Ga0068856_100085745 Ga0068856_1000857454 294
39 3300005616 Ga0068852_100018755 Ga0068852_1000187551 294
40 3300009093 Ga0105240_10019995 Ga0105240_100199958 294
41 3300009545 Ga0105237_10019493 Ga0105237_100194934 294
42 3300013102 Ga0157371_10045730 Ga0157371_100457302 294
43 3300013104 Ga0157370_10006514 Ga0157370_100065146 294
44 3300013105 Ga0157369_10029323 Ga0157369_100293238 294
45 3300025913 Ga0207695_10066307 Ga0207695_100663072 294
46 3300025914 Ga0207671_10027216 Ga0207671_100272166 294
47 3300025917 Ga0207660_10321231 Ga0207660_103212312 294
48 3300025919 Ga0207657_10020652 Ga0207657_100206526 294
49 3300025932 Ga0207690_10009698 Ga0207690_100096986 294
50 3300026142 Ga0207698_10038080 Ga0207698_100380805 294
51 3300046477 Ga0495664_0018844 Ga0495664_0018844_2694_3710 294
52 3300048915 Ga0496112_0021993 Ga0496112_0021993_2922_3956 294
53 3300044706 Ga0466964_0001744 Ga0466964_0001744_3979_4944 295
54 3300044735 Ga0466968_0034543 Ga0466968_0034543_244_1209 295
55 3300045976 Ga0466967_0032332 Ga0466967_0032332_3015_3980 295
56 3300009147 Ga0114129_10094114 Ga0114129_100941144 296
57 3300049583 Ga0501067_0259559 Ga0501067_0259559_34_939 296
58 3300053094 Ga0500566_0054748 Ga0500566_0054748_46_951 296
59 3300053153 Ga0500616_0029955 Ga0500616_0029955_22_1053 296
60 3300048915 Ga0496112_0022291 Ga0496112_0022291_397_1389 297
61 3300005338 Ga0068868_100069246 Ga0068868_1000692462 298
62 3300005458 Ga0070681_10036940 Ga0070681_100369402 298
63 3300005615 Ga0070702_100019322 Ga0070702_1000193224 298
64 3300005981 Ga0081538_10016041 Ga0081538_100160413 298
65 3300009174 Ga0105241_10204309 Ga0105241_102043092 298
66 3300026023 Ga0207677_10030239 Ga0207677_100302394 298
67 3300026089 Ga0207648_10108218 Ga0207648_101082183 298
68 3300037068 Ga0373925_0105351 Ga0373925_0105351_308_1288 298
69 3300047321 Ga0495676_0042791 Ga0495676_0042791_1248_2228 298
70 3300046471 Ga0495650_0000053 Ga0495650_0000053_162293_163321 299
71 3300045976 Ga0466967_0031792 Ga0466967_0031792_3033_4064 300
72 3300013297 Ga0157378_10425071 Ga0157378_104250712 301
73 3300036401 Ga0373937_0625391 Ga0373937_0625391_20_943 301
74 3300046500 Ga0495596_0109799 Ga0495596_0109799_11_1018 301
75 3300005355 Ga0070671_100184943 Ga0070671_1001849432 302
76 3300005437 Ga0070710_10103619 Ga0070710_101036191 302
77 3300005439 Ga0070711_100019758 Ga0070711_1000197585 302
78 3300005719 Ga0068861_100248361 Ga0068861_1002483612 302
79 3300006163 Ga0070715_10083554 Ga0070715_100835542 302
80 3300006173 Ga0070716_100177489 Ga0070716_1001774892 302
81 3300006175 Ga0070712_100017253 Ga0070712_1000172531 302
82 3300009545 Ga0105237_10349014 Ga0105237_103490142 302
83 3300025898 Ga0207692_10087907 Ga0207692_100879072 302
84 3300025915 Ga0207693_10001725 Ga0207693_1000172518 302
85 3300025916 Ga0207663_10002887 Ga0207663_100028873 302
86 3300005435 Ga0070714_100163275 Ga0070714_1001632752 303
87 3300005436 Ga0070713_100048274 Ga0070713_1000482743 303
88 3300037466 Ga0395898_0308714 Ga0395898_0308714_466_1491 303
89 3300038443 Ga0395901_0216405 Ga0395901_0216405_919_1944 303
90 3300044694 Ga0466963_0002920 Ga0466963_0002920_1711_2742 303
91 3300044842 Ga0466957_0117616 Ga0466957_0117616_100_1131 303
92 3300045836 Ga0466958_0021497 Ga0466958_0021497_27_1058 303
93 3300045976 Ga0466967_0203090 Ga0466967_0203090_582_1613 303
94 3300047472 Ga0495686_0107931 Ga0495686_0107931_85_1173 303
95 3300048903 Ga0496100_0039134 Ga0496100_0039134_1228_2226 303
96 3300048904 Ga0496101_0106736 Ga0496101_0106736_841_1839 303
97 3300048907 Ga0496104_0000647 Ga0496104_0000647_16414_17412 303
98 3300048908 Ga0496105_0043284 Ga0496105_0043284_1670_2668 303
99 3300048919 Ga0496116_0000441 Ga0496116_0000441_26441_27523 303
100 3300048922 Ga0496119_0001484 Ga0496119_0001484_8806_9888 303
101 3300049585 Ga0501069_0168996 Ga0501069_0168996_205_1230 303
102 3300005616 Ga0068852_100047997 Ga0068852_1000479974 304
103 3300009098 Ga0105245_10052738 Ga0105245_100527382 304
104 3300013296 Ga0157374_10416544 Ga0157374_104165442 304
105 3300014745 Ga0157377_10019488 Ga0157377_100194883 304
106 3300025921 Ga0207652_10010262 Ga0207652_1001026210 304
107 3300025927 Ga0207687_10416058 Ga0207687_104160581 304
108 3300026023 Ga0207677_10031180 Ga0207677_100311803 304
109 3300031731 Ga0307405_10285287 Ga0307405_102852872 304
110 3300048911 Ga0496108_0034929 Ga0496108_0034929_2057_3091 304
111 3300048914 Ga0496111_0036669 Ga0496111_0036669_183_1217 304
112 3300009098 Ga0105245_10136565 Ga0105245_101365652 305
113 3300026078 Ga0207702_10126349 Ga0207702_101263491 305
114 3300048929 Ga0496126_0020971 Ga0496126_0020971_1651_2736 305
115 3300053077 Ga0495601_0219218 Ga0495601_0219218_46_1056 305
116 3300005335 Ga0070666_10107850 Ga0070666_101078502 306
117 3300009093 Ga0105240_10224947 Ga0105240_102249471 306
118 3300013307 Ga0157372_10166394 Ga0157372_101663943 306
119 3300025898 Ga0207692_10007180 Ga0207692_100071801 306
120 3300025900 Ga0207710_10060327 Ga0207710_100603272 306
121 3300025903 Ga0207680_10164595 Ga0207680_101645951 306
122 3300025916 Ga0207663_10060963 Ga0207663_100609633 306
123 3300025929 Ga0207664_10207290 Ga0207664_102072903 306
124 3300025934 Ga0207686_10203788 Ga0207686_102037882 306
125 3300025986 Ga0207658_10059699 Ga0207658_100596991 306
126 3300028379 Ga0268266_10000406 Ga0268266_1000040640 306
127 3300048927 Ga0496124_0063748 Ga0496124_0063748_1664_2761 306
128 3300050512 nmdc:mga0n895_247783_c1 nmdc:mga0n895_247783_c1_36_1067 306
129 3300005563 Ga0068855_100025453 Ga0068855_10002545310 307
130 3300006028 Ga0070717_10033367 Ga0070717_100333672 307
131 3300013104 Ga0157370_10507520 Ga0157370_105075201 307
132 3300025949 Ga0207667_10033092 Ga0207667_100330923 307
133 3300032126 Ga0307415_100190534 Ga0307415_1001905342 307
134 3300044683 Ga0466965_0140011 Ga0466965_0140011_158_1177 307
135 3300044765 Ga0466970_0108799 Ga0466970_0108799_76_1095 307
136 3300045049 Ga0466959_0076933 Ga0466959_0076933_929_1948 307
137 3300046675 Ga0495657_0114175 Ga0495657_0114175_259_1317 307
138 3300047322 Ga0495680_0229809 Ga0495680_0229809_203_1261 307
139 3300048910 Ga0496107_0373857 Ga0496107_0373857_49_1041 307
140 3300049571 Ga0501034_0042047 Ga0501034_0042047_647_1678 307
141 3300049572 Ga0501036_0143599 Ga0501036_0143599_47_1087 307
142 3300049575 Ga0501039_0255958 Ga0501039_0255958_222_1262 307
143 3300049578 Ga0501042_0096561 Ga0501042_0096561_669_1709 307
144 3300049582 Ga0501048_0031782 Ga0501048_0031782_2482_3528 307
145 3300049586 Ga0501070_0039396 Ga0501070_0039396_1427_2509 307
146 3300049743 Ga0501081_0050372 Ga0501081_0050372_1272_2318 307
147 3300054114 Ga0501084_0029513 Ga0501084_0029513_1286_2332 307
148 3300061719 Ga0466962_0091691 Ga0466962_0091691_42_1061 307
149 3300061734 Ga0530510_0063714 Ga0530510_0063714_303_1343 307
150 3300014969 Ga0157376_10266673 Ga0157376_102666731 308
151 3300044719 Ga0466971_0057252 Ga0466971_0057252_529_1563 308
152 3300045836 Ga0466958_0123305 Ga0466958_0123305_59_1093 308
153 3300048907 Ga0496104_0069697 Ga0496104_0069697_320_1417 308
154 3300048908 Ga0496105_0049153 Ga0496105_0049153_573_1670 308
155 3300048921 Ga0496118_0075915 Ga0496118_0075915_194_1273 308
156 3300048922 Ga0496119_0021019 Ga0496119_0021019_2312_3397 308
157 3300048922 Ga0496119_0031659 Ga0496119_0031659_1785_2882 308
158 3300048923 Ga0496120_0001894 Ga0496120_0001894_3520_4605 308
159 3300048924 Ga0496121_0032823 Ga0496121_0032823_357_1436 308
160 3300048924 Ga0496121_0052296 Ga0496121_0052296_1058_2155 308
161 3300048928 Ga0496125_0060265 Ga0496125_0060265_1822_2919 308
162 3300048929 Ga0496126_0230653 Ga0496126_0230653_51_1139 308
163 3300049579 Ga0501043_0065129 Ga0501043_0065129_855_1943 308
164 3300049581 Ga0501047_0226448 Ga0501047_0226448_86_1174 308
165 3300049585 Ga0501069_0018008 Ga0501069_0018008_558_1646 308
166 3300049587 Ga0501071_0032605 Ga0501071_0032605_718_1806 308
167 3300049590 Ga0501074_0077931 Ga0501074_0077931_1127_2215 308
168 3300049741 Ga0501079_0044196 Ga0501079_0044196_2193_3281 308
169 3300049823 Ga0501044_0097969 Ga0501044_0097969_19_1107 308
170 3300053134 Ga0500658_0066416 Ga0500658_0066416_290_1369 308
171 3300005563 Ga0068855_100312630 Ga0068855_1003126302 309
172 3300005983 Ga0081540_1014982 Ga0081540_10149824 309
173 3300014969 Ga0157376_10045765 Ga0157376_100457653 309
174 3300025949 Ga0207667_10438239 Ga0207667_104382392 309
175 3300031241 Ga0265325_10006999 Ga0265325_100069991 309
176 3300031711 Ga0265314_10025523 Ga0265314_100255234 309
177 3300041512 Ga0451853_1985226 Ga0451853_1985226_10_963 309
178 3300005456 Ga0070678_100136784 Ga0070678_1001367842 310
179 3300005547 Ga0070693_100004465 Ga0070693_1000044652 310
180 3300006914 Ga0075436_100120628 Ga0075436_1001206282 310
181 3300025914 Ga0207671_10052836 Ga0207671_100528362 310
182 3300025981 Ga0207640_10067280 Ga0207640_100672803 310
183 3300026041 Ga0207639_10133735 Ga0207639_101337353 310
184 3300026121 Ga0207683_10089503 Ga0207683_100895032 310
185 3300035170 Ga0373943_0009954 Ga0373943_0009954_2151_3110 310
186 3300048903 Ga0496100_0002209 Ga0496100_0002209_6532_7566 310
187 3300048904 Ga0496101_0004150 Ga0496101_0004150_1701_2735 310
188 3300048905 Ga0496102_0057030 Ga0496102_0057030_1639_2673 310
189 3300048905 Ga0496102_0306499 Ga0496102_0306499_69_1028 310
190 3300048907 Ga0496104_0072012 Ga0496104_0072012_1311_2345 310
191 3300048908 Ga0496105_0132175 Ga0496105_0132175_885_1919 310
192 3300048909 Ga0496106_0016306 Ga0496106_0016306_3405_4439 310
193 3300048910 Ga0496107_0025569 Ga0496107_0025569_2314_3348 310
194 3300048917 Ga0496114_0014110 Ga0496114_0014110_4130_5164 310
195 3300048921 Ga0496118_0084957 Ga0496118_0084957_845_1924 310
196 3300053139 Ga0500568_0044074 Ga0500568_0044074_576_1658 310
197 3300005337 Ga0070682_100049865 Ga0070682_1000498652 311
198 3300005471 Ga0070698_100015738 Ga0070698_1000157388 311
199 3300005530 Ga0070679_100084818 Ga0070679_1000848181 311
200 3300005539 Ga0068853_100222962 Ga0068853_1002229623 311
201 3300005563 Ga0068855_100062246 Ga0068855_1000622465 311
202 3300005841 Ga0068863_100098528 Ga0068863_1000985283 311
203 3300005937 Ga0081455_10010784 Ga0081455_1001078410 311
204 3300006852 Ga0075433_10091074 Ga0075433_100910744 311
205 3300006871 Ga0075434_100005674 Ga0075434_10000567414 311
206 3300007076 Ga0075435_100011150 Ga0075435_1000111504 311
207 3300009093 Ga0105240_10113791 Ga0105240_101137913 311
208 3300009098 Ga0105245_10574636 Ga0105245_105746361 311
209 3300009148 Ga0105243_10135297 Ga0105243_101352972 311
210 3300010375 Ga0105239_10108285 Ga0105239_101082853 311
211 3300013105 Ga0157369_10150590 Ga0157369_101505902 311
212 3300013105 Ga0157369_10188938 Ga0157369_101889383 311
213 3300013307 Ga0157372_10744608 Ga0157372_107446081 311
214 3300020070 Ga0206356_11468302 Ga0206356_114683022 311
215 3300025912 Ga0207707_10111890 Ga0207707_101118902 311
216 3300025914 Ga0207671_10176636 Ga0207671_101766363 311
217 3300025917 Ga0207660_10144556 Ga0207660_101445562 311
218 3300025920 Ga0207649_10152166 Ga0207649_101521661 311
219 3300025921 Ga0207652_10025461 Ga0207652_100254615 311
220 3300026116 Ga0207674_10033681 Ga0207674_100336814 311
221 3300026142 Ga0207698_10118278 Ga0207698_101182782 311
222 3300049581 Ga0501047_0268533 Ga0501047_0268533_425_1507 311
223 3300049583 Ga0501067_0017294 Ga0501067_0017294_478_1512 311
224 3300049585 Ga0501069_0013992 Ga0501069_0013992_472_1506 311
225 3300050512 nmdc:mga0n895_88486_c1 nmdc:mga0n895_88486_c1_679_1713 311
226 3300050513 nmdc:mga0rr50_46336_c1 nmdc:mga0rr50_46336_c1_1742_2776 311
227 3300050514 nmdc:mga08x19_5861_c1 nmdc:mga08x19_5861_c1_4886_5920 311
228 3300050515 nmdc:mga0a205_86634_c1 nmdc:mga0a205_86634_c1_749_1783 311
229 3300053077 Ga0495601_0079238 Ga0495601_0079238_318_1325 311
230 3300053085 Ga0495619_0193450 Ga0495619_0193450_199_1206 311
231 3300053111 Ga0500572_030666 Ga0500572_030666_359_1435 311
232 3300061734 Ga0530510_0165667 Ga0530510_0165667_134_1168 311
233 3300005329 Ga0070683_100039278 Ga0070683_1000392783 312
234 3300005336 Ga0070680_100002170 Ga0070680_1000021706 312
235 3300005458 Ga0070681_10000389 Ga0070681_100003896 312
236 3300005530 Ga0070679_100000432 Ga0070679_10000043235 312
237 3300005617 Ga0068859_100119675 Ga0068859_1001196753 312
238 3300006931 Ga0097620_100119672 Ga0097620_1001196723 312
239 3300025912 Ga0207707_10000109 Ga0207707_100001096 312
240 3300025917 Ga0207660_10001772 Ga0207660_100017726 312
241 3300025921 Ga0207652_10000248 Ga0207652_100002486 312
242 3300048920 Ga0496117_0025669 Ga0496117_0025669_149_1231 312
243 3300048921 Ga0496118_0005040 Ga0496118_0005040_3377_4459 312
244 3300048918 Ga0496115_0001134 Ga0496115_0001134_6088_7107 313
245 3300049583 Ga0501067_0000031 Ga0501067_0000031_86655_87614 313
246 3300049584 Ga0501068_0000010 Ga0501068_0000010_9643_10602 313
247 3300049585 Ga0501069_0000032 Ga0501069_0000032_3649_4608 313
248 3300061734 Ga0530510_0010459 Ga0530510_0010459_1295_2254 313
249 3300006846 Ga0075430_100002429 Ga0075430_10000242918 314
250 3300006846 Ga0075430_100143414 Ga0075430_1001434141 314
251 3300025901 Ga0207688_10184900 Ga0207688_101849002 314
252 3300025903 Ga0207680_10129001 Ga0207680_101290011 314
253 3300026118 Ga0207675_100083040 Ga0207675_1000830403 314
254 3300035172 Ga0373955_0166791 Ga0373955_0166791_212_1249 314
255 3300037312 Ga0395899_0000614 Ga0395899_0000614_10567_11574 314
256 3300048918 Ga0496115_0360806 Ga0496115_0360806_120_1160 314
257 3300049741 Ga0501079_0253760 Ga0501079_0253760_87_1100 314
258 3300005337 Ga0070682_100052056 Ga0070682_1000520563 315
259 3300005338 Ga0068868_100023214 Ga0068868_1000232142 315
260 3300005338 Ga0068868_100028653 Ga0068868_1000286536 315
261 3300005341 Ga0070691_10007083 Ga0070691_100070833 315
262 3300005345 Ga0070692_10005087 Ga0070692_100050872 315
263 3300005355 Ga0070671_100046207 Ga0070671_1000462073 315
264 3300005366 Ga0070659_100116133 Ga0070659_1001161332 315
265 3300005434 Ga0070709_10175924 Ga0070709_101759242 315
266 3300005437 Ga0070710_10028698 Ga0070710_100286982 315
267 3300005440 Ga0070705_100021168 Ga0070705_1000211684 315
268 3300005441 Ga0070700_100005180 Ga0070700_1000051807 315
269 3300005441 Ga0070700_100182381 Ga0070700_1001823812 315
270 3300005444 Ga0070694_100030564 Ga0070694_1000305643 315
271 3300005455 Ga0070663_100262326 Ga0070663_1002623261 315
272 3300005456 Ga0070678_100014820 Ga0070678_1000148204 315
273 3300005457 Ga0070662_100015570 Ga0070662_1000155706 315
274 3300005459 Ga0068867_100053246 Ga0068867_1000532462 315
275 3300005530 Ga0070679_100073354 Ga0070679_1000733542 315
276 3300005535 Ga0070684_100109026 Ga0070684_1001090262 315
277 3300005544 Ga0070686_100045397 Ga0070686_1000453973 315
278 3300005544 Ga0070686_100051309 Ga0070686_1000513093 315
279 3300005546 Ga0070696_100011731 Ga0070696_1000117317 315
280 3300005546 Ga0070696_100021145 Ga0070696_1000211453 315
281 3300005547 Ga0070693_100014558 Ga0070693_1000145583 315
282 3300005549 Ga0070704_100063834 Ga0070704_1000638343 315
283 3300005563 Ga0068855_100056258 Ga0068855_1000562583 315
284 3300005578 Ga0068854_100028280 Ga0068854_1000282803 315
285 3300005614 Ga0068856_100243628 Ga0068856_1002436281 315
286 3300005618 Ga0068864_100082227 Ga0068864_1000822272 315
287 3300005618 Ga0068864_100097262 Ga0068864_1000972622 315
288 3300005718 Ga0068866_10030984 Ga0068866_100309843 315
289 3300005719 Ga0068861_100041688 Ga0068861_1000416883 315
290 3300005843 Ga0068860_100257417 Ga0068860_1002574172 315
291 3300006173 Ga0070716_100103814 Ga0070716_1001038142 315
292 3300006237 Ga0097621_100046456 Ga0097621_1000464564 315
293 3300006358 Ga0068871_100040342 Ga0068871_1000403423 315
294 3300006844 Ga0075428_100114132 Ga0075428_1001141323 315
295 3300006914 Ga0075436_100114204 Ga0075436_1001142041 315
296 3300007076 Ga0075435_100019858 Ga0075435_1000198584 315
297 3300009093 Ga0105240_10418448 Ga0105240_104184482 315
298 3300009098 Ga0105245_10109325 Ga0105245_101093252 315
299 3300009098 Ga0105245_10127540 Ga0105245_101275403 315
300 3300009147 Ga0114129_10200400 Ga0114129_102004002 315
301 3300009148 Ga0105243_10008961 Ga0105243_100089616 315
302 3300009174 Ga0105241_10241227 Ga0105241_102412272 315
303 3300009176 Ga0105242_10062841 Ga0105242_100628413 315
304 3300009177 Ga0105248_10110073 Ga0105248_101100733 315
305 3300009177 Ga0105248_10134337 Ga0105248_101343372 315
306 3300009551 Ga0105238_10387089 Ga0105238_103870892 315
307 3300009553 Ga0105249_10060351 Ga0105249_100603512 315
308 3300010375 Ga0105239_10063124 Ga0105239_100631242 315
309 3300010375 Ga0105239_10113310 Ga0105239_101133102 315
310 3300013100 Ga0157373_10107256 Ga0157373_101072562 315
311 3300013297 Ga0157378_10028732 Ga0157378_100287324 315
312 3300013306 Ga0163162_10363552 Ga0163162_103635522 315
313 3300013308 Ga0157375_10014719 Ga0157375_100147197 315
314 3300013308 Ga0157375_10103294 Ga0157375_101032943 315
315 3300014326 Ga0157380_10027943 Ga0157380_100279433 315
316 3300014745 Ga0157377_10224521 Ga0157377_102245212 315
317 3300014968 Ga0157379_10211601 Ga0157379_102116012 315
318 3300014969 Ga0157376_10005763 Ga0157376_100057633 315
319 3300025885 Ga0207653_10018292 Ga0207653_100182922 315
320 3300025907 Ga0207645_10050880 Ga0207645_100508803 315
321 3300025915 Ga0207693_10309857 Ga0207693_103098571 315
322 3300025916 Ga0207663_10173341 Ga0207663_101733412 315
323 3300025919 Ga0207657_10013373 Ga0207657_100133738 315
324 3300025931 Ga0207644_10160417 Ga0207644_101604172 315
325 3300025932 Ga0207690_10075595 Ga0207690_100755952 315
326 3300025933 Ga0207706_10006396 Ga0207706_100063966 315
327 3300025934 Ga0207686_10050979 Ga0207686_100509792 315
328 3300025939 Ga0207665_10003605 Ga0207665_100036056 315
329 3300025940 Ga0207691_10083617 Ga0207691_100836172 315
330 3300025944 Ga0207661_10096635 Ga0207661_100966352 315
331 3300025949 Ga0207667_10115465 Ga0207667_101154651 315
332 3300025949 Ga0207667_10116708 Ga0207667_101167082 315
333 3300025961 Ga0207712_10216493 Ga0207712_102164932 315
334 3300025981 Ga0207640_10061687 Ga0207640_100616872 315
335 3300026067 Ga0207678_10045634 Ga0207678_100456343 315
336 3300026078 Ga0207702_10020480 Ga0207702_100204801 315
337 3300026078 Ga0207702_10128485 Ga0207702_101284853 315
338 3300026095 Ga0207676_10223721 Ga0207676_102237212 315
339 3300026118 Ga0207675_100017588 Ga0207675_1000175886 315
340 3300026118 Ga0207675_100037798 Ga0207675_1000377984 315
341 3300026121 Ga0207683_10004132 Ga0207683_1000413211 315
342 3300026121 Ga0207683_10056920 Ga0207683_100569204 315
343 3300027717 Ga0209998_10011918 Ga0209998_100119182 315
344 3300027907 Ga0207428_10064950 Ga0207428_100649501 315
345 3300032002 Ga0307416_100055068 Ga0307416_1000550685 315
346 3300035084 Ga0373928_0035301 Ga0373928_0035301_50_1030 315
347 3300035089 Ga0373944_0048942 Ga0373944_0048942_17_997 315
348 3300035091 Ga0373951_0008911 Ga0373951_0008911_438_1418 315
349 3300035116 Ga0373945_0009448 Ga0373945_0009448_2000_2980 315
350 3300035171 Ga0373946_0017246 Ga0373946_0017246_1212_2192 315
351 3300035241 Ga0373961_0071088 Ga0373961_0071088_61_1041 315
352 3300035695 Ga0373927_0085845 Ga0373927_0085845_279_1259 315
353 3300035725 Ga0373947_0007670 Ga0373947_0007670_3740_4720 315
354 3300037466 Ga0395898_0008093 Ga0395898_0008093_9487_10470 315
355 3300037471 Ga0395905_0003094 Ga0395905_0003094_14674_15657 315
356 3300038443 Ga0395901_0001542 Ga0395901_0001542_8463_9446 315
357 3300038443 Ga0395901_0131053 Ga0395901_0131053_375_1394 315
358 3300041486 Ga0451807_0826841 Ga0451807_0826841_11_985 315
359 3300041512 Ga0451853_1409041 Ga0451853_1409041_294_1274 315
360 3300042005 Ga0439448_0017142 Ga0439448_0017142_931_1911 315
361 3300042438 Ga0439459_0022340 Ga0439459_0022340_160_1140 315
362 3300044694 Ga0466963_0002778 Ga0466963_0002778_22_1056 315
363 3300044901 Ga0466960_0066433 Ga0466960_0066433_723_1757 315
364 3300044901 Ga0466960_0108778 Ga0466960_0108778_267_1280 315
365 3300045976 Ga0466967_0004040 Ga0466967_0004040_112_1146 315
366 3300045976 Ga0466967_0024629 Ga0466967_0024629_2233_3267 315
367 3300046455 Ga0495603_0000065 Ga0495603_0000065_31262_32242 315
368 3300046461 Ga0495641_0006525 Ga0495641_0006525_6073_7053 315
369 3300046472 Ga0495580_0032597 Ga0495580_0032597_753_1733 315
370 3300046473 Ga0495582_0005435 Ga0495582_0005435_354_1334 315
371 3300046499 Ga0495594_0005133 Ga0495594_0005133_5295_6326 315
372 3300046499 Ga0495594_0006993 Ga0495594_0006993_2679_3659 315
373 3300047321 Ga0495676_0000444 Ga0495676_0000444_27297_28277 315
374 3300048903 Ga0496100_0019691 Ga0496100_0019691_2349_3332 315
375 3300048903 Ga0496100_0111672 Ga0496100_0111672_51_1031 315
376 3300048903 Ga0496100_0220841 Ga0496100_0220841_96_1076 315
377 3300048904 Ga0496101_0059585 Ga0496101_0059585_701_1684 315
378 3300048904 Ga0496101_0101867 Ga0496101_0101867_797_1777 315
379 3300048905 Ga0496102_0023310 Ga0496102_0023310_4480_5460 315
380 3300048905 Ga0496102_0047737 Ga0496102_0047737_694_1674 315
381 3300048905 Ga0496102_0125159 Ga0496102_0125159_832_1815 315
382 3300048906 Ga0496103_0044000 Ga0496103_0044000_936_1916 315
383 3300048907 Ga0496104_0005379 Ga0496104_0005379_4493_5476 315
384 3300048907 Ga0496104_0014887 Ga0496104_0014887_812_1792 315
385 3300048908 Ga0496105_0008415 Ga0496105_0008415_4993_5976 315
386 3300048908 Ga0496105_0014471 Ga0496105_0014471_142_1122 315
387 3300048909 Ga0496106_0006195 Ga0496106_0006195_5259_6242 315
388 3300048909 Ga0496106_0123354 Ga0496106_0123354_332_1312 315
389 3300048910 Ga0496107_0077461 Ga0496107_0077461_1340_2320 315
390 3300048910 Ga0496107_0180676 Ga0496107_0180676_36_1016 315
391 3300048911 Ga0496108_0000632 Ga0496108_0000632_17119_18102 315
392 3300048911 Ga0496108_0009048 Ga0496108_0009048_5193_6173 315
393 3300048912 Ga0496109_0003540 Ga0496109_0003540_7689_8669 315
394 3300048912 Ga0496109_0041443 Ga0496109_0041443_2871_3854 315
395 3300048913 Ga0496110_0015250 Ga0496110_0015250_5129_6109 315
396 3300048913 Ga0496110_0135835 Ga0496110_0135835_133_1113 315
397 3300048914 Ga0496111_0000319 Ga0496111_0000319_17711_18691 315
398 3300048914 Ga0496111_0014498 Ga0496111_0014498_2360_3343 315
399 3300048915 Ga0496112_0042483 Ga0496112_0042483_2551_3534 315
400 3300048915 Ga0496112_0049387 Ga0496112_0049387_1817_2797 315
401 3300048915 Ga0496112_0408811 Ga0496112_0408811_54_1049 315
402 3300048916 Ga0496113_0001938 Ga0496113_0001938_5755_6735 315
403 3300048917 Ga0496114_0039612 Ga0496114_0039612_534_1517 315
404 3300048917 Ga0496114_0101409 Ga0496114_0101409_340_1320 315
405 3300048918 Ga0496115_0208708 Ga0496115_0208708_42_1022 315
406 3300050511 nmdc:mga08y16_495077_c1 nmdc:mga08y16_495077_c1_27_1007 315
407 3300050512 nmdc:mga0n895_131020_c1 nmdc:mga0n895_131020_c1_1028_2008 315
408 3300050513 nmdc:mga0rr50_300509_c1 nmdc:mga0rr50_300509_c1_177_1157 315
409 3300050514 nmdc:mga08x19_100039_c1 nmdc:mga08x19_100039_c1_874_1854 315
410 3300050514 nmdc:mga08x19_62918_c1 nmdc:mga08x19_62918_c1_26_1006 315
411 3300005347 Ga0070668_100173074 Ga0070668_1001730742 316
412 3300005367 Ga0070667_100009366 Ga0070667_1000093662 316
413 3300005436 Ga0070713_100236245 Ga0070713_1002362451 316
414 3300005530 Ga0070679_100001364 Ga0070679_10000136417 316
415 3300005548 Ga0070665_100171449 Ga0070665_1001714492 316
416 3300005843 Ga0068860_100197881 Ga0068860_1001978812 316
417 3300005844 Ga0068862_100000510 Ga0068862_10000051020 316
418 3300009553 Ga0105249_10007467 Ga0105249_1000746711 316
419 3300014968 Ga0157379_10150641 Ga0157379_101506412 316
420 3300025921 Ga0207652_10000900 Ga0207652_100009008 316
421 3300025986 Ga0207658_10024480 Ga0207658_100244802 316
422 3300026067 Ga0207678_10005158 Ga0207678_100051588 316
423 3300028380 Ga0268265_10009761 Ga0268265_100097612 316
424 3300046683 Ga0495658_0029271 Ga0495658_0029271_1949_2935 316
425 3300049568 Ga0501031_0000058 Ga0501031_0000058_57854_58942 316
426 3300049569 Ga0501032_0002722 Ga0501032_0002722_297_1385 316
427 3300049570 Ga0501033_0015135 Ga0501033_0015135_304_1392 316
428 3300049571 Ga0501034_0017696 Ga0501034_0017696_309_1397 316
429 3300049573 Ga0501037_0002322 Ga0501037_0002322_290_1378 316
430 3300049574 Ga0501038_0000485 Ga0501038_0000485_33564_34652 316
431 3300049575 Ga0501039_0091953 Ga0501039_0091953_698_1786 316
432 3300049578 Ga0501042_0050607 Ga0501042_0050607_1594_2682 316
433 3300049579 Ga0501043_0002786 Ga0501043_0002786_13208_14296 316
434 3300049580 Ga0501046_0003436 Ga0501046_0003436_183_1271 316
435 3300049581 Ga0501047_0000647 Ga0501047_0000647_301_1389 316
436 3300049581 Ga0501047_0050484 Ga0501047_0050484_136_1149 316
437 3300049582 Ga0501048_0002614 Ga0501048_0002614_309_1397 316
438 3300049584 Ga0501068_0099840 Ga0501068_0099840_695_1783 316
439 3300049586 Ga0501070_0000309 Ga0501070_0000309_309_1397 316
440 3300049588 Ga0501072_0194301 Ga0501072_0194301_426_1514 316
441 3300049589 Ga0501073_0109804 Ga0501073_0109804_193_1281 316
442 3300049741 Ga0501079_0034967 Ga0501079_0034967_310_1398 316
443 3300049742 Ga0501080_0228964 Ga0501080_0228964_475_1563 316
444 3300049822 Ga0501035_0020800 Ga0501035_0020800_4336_5424 316
445 3300049823 Ga0501044_0001651 Ga0501044_0001651_329_1417 316
446 3300060353 Ga0501082_0013634 Ga0501082_0013634_5626_6714 316
447 3300025941 Ga0207711_10075258 Ga0207711_100752583 317
448 3300045049 Ga0466959_0143353 Ga0466959_0143353_26_1072 317
449 3300009177 Ga0105248_10095780 Ga0105248_100957803 318
450 3300041456 Ga0451795_1063198 Ga0451795_1063198_2019_3008 318
451 3300041458 Ga0451798_0138267 Ga0451798_0138267_391_1380 318
452 3300041459 Ga0451800_0933833 Ga0451800_0933833_1318_2307 318
453 3300041460 Ga0451802_0241505 Ga0451802_0241505_2631_3620 318
454 3300041463 Ga0451804_0599873 Ga0451804_0599873_757_1746 318
455 3300041496 Ga0451839_1417283 Ga0451839_1417283_968_1957 318
456 3300041498 Ga0451841_1173131 Ga0451841_1173131_1378_2367 318
457 3300041501 Ga0451845_0312446 Ga0451845_0312446_1258_2247 318
458 3300041505 Ga0451849_1446404 Ga0451849_1446404_1965_2954 318
459 3300041507 Ga0451851_0670690 Ga0451851_0670690_3593_4582 318
460 3300041511 Ga0451855_0466827 Ga0451855_0466827_917_1906 318
461 3300049571 Ga0501034_0269645 Ga0501034_0269645_158_1240 318
462 3300005530 Ga0070679_100342170 Ga0070679_1003421702 319
463 3300005535 Ga0070684_100034944 Ga0070684_1000349444 319
464 3300009093 Ga0105240_10012405 Ga0105240_1001240511 319
465 3300013100 Ga0157373_10153164 Ga0157373_101531641 319
466 3300013307 Ga0157372_10384278 Ga0157372_103842782 319
467 3300025912 Ga0207707_10240268 Ga0207707_102402682 319
468 3300025913 Ga0207695_10013638 Ga0207695_100136382 319
469 3300046463 Ga0495653_0160342 Ga0495653_0160342_233_1228 319
470 3300046511 Ga0495608_0042395 Ga0495608_0042395_109_1104 319
471 3300046536 Ga0495587_0021592 Ga0495587_0021592_1220_2215 319
472 3300046543 Ga0495645_0163728 Ga0495645_0163728_284_1279 319
473 3300046678 Ga0495599_0028906 Ga0495599_0028906_2106_3101 319
474 3300047471 Ga0495684_0044420 Ga0495684_0044420_321_1316 319
475 3300053084 Ga0495595_0088039 Ga0495595_0088039_402_1397 319
476 3300005436 Ga0070713_100070322 Ga0070713_1000703223 320
477 3300006028 Ga0070717_10060400 Ga0070717_100604002 320
478 3300025929 Ga0207664_10100558 Ga0207664_101005584 320
479 3300028800 Ga0265338_10026055 Ga0265338_100260555 320
480 3300046477 Ga0495664_0000007 Ga0495664_0000007_359233_360261 320
481 iso_pu_bacteria 2643221641 2644229713 320
482 3300005435 Ga0070714_100211772 Ga0070714_1002117721 321
483 3300005842 Ga0068858_100066785 Ga0068858_1000667852 322
484 3300006881 Ga0068865_100077167 Ga0068865_1000771673 322
485 3300009553 Ga0105249_10351355 Ga0105249_103513551 322
486 3300025961 Ga0207712_10104357 Ga0207712_101043572 322
487 3300026023 Ga0207677_10163002 Ga0207677_101630021 322
488 3300026035 Ga0207703_10039091 Ga0207703_100390914 322
489 3300026116 Ga0207674_10076069 Ga0207674_100760693 322
490 3300048912 Ga0496109_0182112 Ga0496109_0182112_790_1833 322
491 3300048913 Ga0496110_0009847 Ga0496110_0009847_4027_5166 322
492 3300048914 Ga0496111_0006910 Ga0496111_0006910_5588_6727 322
493 3300048914 Ga0496111_0025487 Ga0496111_0025487_1513_2556 322
494 3300048915 Ga0496112_0021172 Ga0496112_0021172_5089_6132 322
495 3300048917 Ga0496114_0112164 Ga0496114_0112164_870_2009 322
496 3300005343 Ga0070687_100061509 Ga0070687_1000615092 323
497 3300005459 Ga0068867_100015132 Ga0068867_1000151325 323
498 3300005718 Ga0068866_10002851 Ga0068866_100028511 323
499 3300005844 Ga0068862_100031590 Ga0068862_1000315904 323
500 3300006028 Ga0070717_10297670 Ga0070717_102976702 323
501 3300009148 Ga0105243_10019768 Ga0105243_100197684 323
502 3300009177 Ga0105248_10059254 Ga0105248_100592544 323
503 3300013297 Ga0157378_10007242 Ga0157378_100072421 323
504 3300014326 Ga0157380_10225162 Ga0157380_102251622 323
505 3300025918 Ga0207662_10031709 Ga0207662_100317094 323
506 3300025935 Ga0207709_10031650 Ga0207709_100316504 323
507 3300025936 Ga0207670_10147339 Ga0207670_101473392 323
508 3300025941 Ga0207711_10053203 Ga0207711_100532035 323
509 3300026089 Ga0207648_10027472 Ga0207648_100274725 323
510 3300048903 Ga0496100_0326809 Ga0496100_0326809_82_1140 323
511 3300048905 Ga0496102_0508472 Ga0496102_0508472_50_1108 323
512 3300048907 Ga0496104_0113418 Ga0496104_0113418_164_1222 323
513 3300048908 Ga0496105_0043926 Ga0496105_0043926_536_1594 323
514 3300048909 Ga0496106_0093541 Ga0496106_0093541_289_1347 323
515 3300048910 Ga0496107_0053818 Ga0496107_0053818_914_1972 323
516 3300048911 Ga0496108_0065740 Ga0496108_0065740_1683_2831 323
517 3300048912 Ga0496109_0174082 Ga0496109_0174082_833_1891 323
518 3300048913 Ga0496110_0050894 Ga0496110_0050894_643_1701 323
519 3300048914 Ga0496111_0038057 Ga0496111_0038057_374_1432 323
520 3300048917 Ga0496114_0031553 Ga0496114_0031553_2806_3864 323
521 3300006880 Ga0075429_100259703 Ga0075429_1002597032 324
522 3300009098 Ga0105245_10036032 Ga0105245_100360323 324
523 3300013296 Ga0157374_10437009 Ga0157374_104370091 324
524 3300013308 Ga0157375_10007894 Ga0157375_100078948 324
525 3300014325 Ga0163163_10514900 Ga0163163_105149001 324
526 3300048905 Ga0496102_0524115 Ga0496102_0524115_13_1074 324
527 3300048913 Ga0496110_0052536 Ga0496110_0052536_34_1095 324
528 3300048915 Ga0496112_0400164 Ga0496112_0400164_253_1284 324
529 3300048917 Ga0496114_0037283 Ga0496114_0037283_1641_2702 324
530 3300014325 Ga0163163_10048708 Ga0163163_100487083 325
531 3300028563 Ga0265319_1040462 Ga0265319_10404622 325
532 3300028573 Ga0265334_10002240 Ga0265334_100022408 325
533 3300028800 Ga0265338_10152283 Ga0265338_101522832 325
534 3300031238 Ga0265332_10012597 Ga0265332_100125973 325
535 3300031241 Ga0265325_10015611 Ga0265325_100156115 325
536 3300031247 Ga0265340_10004670 Ga0265340_100046708 325
537 3300031249 Ga0265339_10108802 Ga0265339_101088021 325
538 3300031344 Ga0265316_10021507 Ga0265316_100215072 325
539 3300005983 Ga0081540_1009141 Ga0081540_10091417 326
540 3300009148 Ga0105243_10252719 Ga0105243_102527192 326
541 3300014497 Ga0182008_10025657 Ga0182008_100256572 326
542 3300025927 Ga0207687_10188322 Ga0207687_101883221 326
543 3300048911 Ga0496108_0164281 Ga0496108_0164281_808_1869 326
544 iso_pu_bacteria 2856741275 2856742721 326
545 iso_pu_bacteria 2891395885 2891404220 326
546 iso_pu_bacteria 2891554331 2891562045 326
547 iso_pu_bacteria 2891562705 2891565002 326
548 3300009177 Ga0105248_10015966 Ga0105248_100159665 327
549 3300009545 Ga0105237_10415289 Ga0105237_104152891 327
550 3300014325 Ga0163163_10011817 Ga0163163_100118175 327
551 3300014968 Ga0157379_10122190 Ga0157379_101221903 327
552 3300048907 Ga0496104_0092404 Ga0496104_0092404_1713_2732 327
553 3300048908 Ga0496105_0026893 Ga0496105_0026893_3371_4390 327
554 3300048914 Ga0496111_0005473 Ga0496111_0005473_763_1782 327
555 3300048918 Ga0496115_0140350 Ga0496115_0140350_16_1035 327
556 3300005548 Ga0070665_100149968 Ga0070665_1001499681 328
557 3300005618 Ga0068864_100058454 Ga0068864_1000584543 328
558 3300005937 Ga0081455_10038446 Ga0081455_100384464 328
559 3300009094 Ga0111539_10111312 Ga0111539_101113122 328
560 3300050507 nmdc:mga05p37_319075_c1 nmdc:mga05p37_319075_c1_147_1181 328
561 3300050508 nmdc:mga09592_63716_c1 nmdc:mga09592_63716_c1_1895_2932 328
562 3300025928 Ga0207700_10229960 Ga0207700_102299602 329
563 3300025941 Ga0207711_10098258 Ga0207711_100982582 329
564 3300006844 Ga0075428_100018030 Ga0075428_1000180308 330
565 3300009551 Ga0105238_10287409 Ga0105238_102874092 330
566 3300025921 Ga0207652_10063390 Ga0207652_100633902 330
567 3300005535 Ga0070684_100250706 Ga0070684_1002507062 331
568 3300014968 Ga0157379_10027267 Ga0157379_100272676 331
569 3300044684 Ga0466966_0005854 Ga0466966_0005854_586_1662 332
570 3300044693 Ga0466961_0009629 Ga0466961_0009629_1005_2081 332
571 3300046680 Ga0495646_0012695 Ga0495646_0012695_834_1871 332
572 3300053077 Ga0495601_0004984 Ga0495601_0004984_5680_6708 332
573 3300061719 Ga0466962_0032772 Ga0466962_0032772_586_1662 332
574 3300005329 Ga0070683_100015581 Ga0070683_1000155815 333
575 3300005337 Ga0070682_100080812 Ga0070682_1000808122 333
576 3300005530 Ga0070679_100186674 Ga0070679_1001866742 333
577 3300005535 Ga0070684_100047128 Ga0070684_1000471282 333
578 3300025909 Ga0207705_10166810 Ga0207705_101668101 333
579 3300025921 Ga0207652_10004169 Ga0207652_100041699 333
580 3300025944 Ga0207661_10001916 Ga0207661_100019164 333
581 3300028563 Ga0265319_1014850 Ga0265319_10148502 333
582 3300028577 Ga0265318_10010527 Ga0265318_100105272 333
583 3300005366 Ga0070659_100241529 Ga0070659_1002415291 334
584 3300009098 Ga0105245_10025810 Ga0105245_100258103 336
585 3300009148 Ga0105243_10039302 Ga0105243_100393022 336
586 3300009176 Ga0105242_10222032 Ga0105242_102220322 336
587 3300009177 Ga0105248_10083536 Ga0105248_100835363 336
588 3300011119 Ga0105246_10186550 Ga0105246_101865501 336
589 3300025927 Ga0207687_10036898 Ga0207687_100368981 336
590 3300025934 Ga0207686_10107130 Ga0207686_101071302 336
591 3300048913 Ga0496110_0294870 Ga0496110_0294870_178_1239 336
592 3300005329 Ga0070683_100003225 Ga0070683_10000322512 338
593 3300005535 Ga0070684_100021769 Ga0070684_1000217693 338
594 3300005564 Ga0070664_100005588 Ga0070664_1000055883 338
595 3300005577 Ga0068857_100060610 Ga0068857_1000606102 338
596 3300025945 Ga0207679_10003163 Ga0207679_100031638 338
597 3300026116 Ga0207674_10080449 Ga0207674_100804493 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

31

275

0.91

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

34

296

0.81

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

102

297

0.79

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

35

267

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.9685 35 316
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9496 35 326
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.9486 35 316
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9412 35 327
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.8959 35 326
ID Description Score Start End Superfamily
af_P71744_144_341_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9657 123 316 3.40.190.10
6ddnB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9558 123 316 3.40.190.10
6ddnB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9494 123 316 3.40.190.10
af_P71744_144_341_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9417 123 316 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9414 37 103 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5C4J6M7-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9968 35 335 GO:0042597
GO:1902358
AF-A0A4R4XS67-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9901 28 335 GO:0042597
GO:1902358
AF-A0A5C4J6M7-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9869 35 335 GO:0042597
GO:1902358
AF-A0A4R4XS67-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9837 28 335 GO:0042597
GO:1902358
AF-K6W9W5-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9777 33 114 GO:0016020
GO:0042597
GO:1902358

Feature Viewer

pLDDT pTM Quality
89.62 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map