F467670
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 597 | 306 | 592 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10514900|Ga0163163_105149001 |
| Length | 364 |
| Sequence | MEKGTLMGFKPTRRAAALVAAGLVSTLPVTLSLVAYSTPQAAYEKIIAAFQKTDAGKNVKFTQSYGASGDQSRAVAAGLPADFVEFSLETDMTRLVDAKMVDPSWNTDEYKGMVTDSVVSLVTRKGNPKHIKSFEDLAKPGVEVITPNPFSSGAARWNIMGAYGSQTQTGKSEAEATAFLAKVMSNVAVQDDSGRAALQTFTGGKGDVLVSYENEAIFAQQNGQDVDYVVPDNTLLIENPAAVTSTSKHPKEAKAFLDFVRSDEAQKIFAENGYRPVSKTADTAGQDFPTPSGLFTIQDLGGWDAVATKFFDADKGIVTDIERKLGELGIELVGDTPEEFARYIRAEIPKWSRVIEDAGARVDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 2 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 3 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 4 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 5 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 191 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 192 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 193 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 194 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 195 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 198 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 199 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 207 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 208 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 254 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 255 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 256 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 257 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 258 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 299 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 300 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 306 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.99 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.84 |
| Nodule | 0 |
| Rhizoplane | 14.74 |
| Rhizosphere | 79.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100003225 | 3300005329 | Bacteria | 13167 |
| 2 | Ga0070683_100015581 | 3300005329 | Bacteria | 6682 |
| 3 | Ga0070683_100030455 | 3300005329 | Bacteria | 4899 |
| 4 | Ga0070683_100039278 | 3300005329 | Bacteria | 4344 |
| 5 | Ga0070666_10107850 | 3300005335 | Bacteria | 1924 |
| 6 | Ga0070680_100002170 | 3300005336 | Bacteria | 14460 |
| 7 | Ga0070680_100010521 | 3300005336 | Bacteria | 7135 |
| 8 | Ga0070682_100049865 | 3300005337 | Bacteria | 2611 |
| 9 | Ga0070682_100052056 | 3300005337 | Bacteria | 2561 |
| 10 | Ga0070682_100072884 | 3300005337 | Bacteria | 2202 |
| 11 | Ga0070682_100080812 | 3300005337 | Bacteria | 2103 |
| 12 | Ga0068868_100023214 | 3300005338 | Bacteria | 4693 |
| 13 | Ga0068868_100028653 | 3300005338 | Bacteria | 4259 |
| 14 | Ga0068868_100069246 | 3300005338 | Bacteria | 2811 |
| 15 | Ga0070660_100008777 | 3300005339 | Bacteria | 7079 |
| 16 | Ga0070691_10007083 | 3300005341 | Bacteria | 5140 |
| 17 | Ga0070687_100061509 | 3300005343 | Bacteria | 1985 |
| 18 | Ga0070692_10005087 | 3300005345 | Bacteria | 5561 |
| 19 | Ga0070668_100173074 | 3300005347 | Bacteria | 1759 |
| 20 | Ga0070671_100046207 | 3300005355 | Bacteria | 3621 |
| 21 | Ga0070671_100184943 | 3300005355 | Bacteria | 1765 |
| 22 | Ga0070659_100019489 | 3300005366 | Bacteria | 5142 |
| 23 | Ga0070659_100116133 | 3300005366 | Bacteria | 2163 |
| 24 | Ga0070659_100241529 | 3300005366 | Bacteria | 1495 |
| 25 | Ga0070667_100009366 | 3300005367 | Bacteria | 8119 |
| 26 | Ga0070709_10175924 | 3300005434 | Bacteria | 1499 |
| 27 | Ga0070714_100163275 | 3300005435 | Unclassified | 2017 |
| 28 | Ga0070714_100211772 | 3300005435 | Bacteria | 1777 |
| 29 | Ga0070713_100048274 | 3300005436 | Bacteria | 3504 |
| 30 | Ga0070713_100070322 | 3300005436 | Bacteria | 2954 |
| 31 | Ga0070713_100236245 | 3300005436 | Bacteria | 1663 |
| 32 | Ga0070710_10028698 | 3300005437 | Bacteria | 2978 |
| 33 | Ga0070710_10103619 | 3300005437 | Bacteria | 1698 |
| 34 | Ga0070711_100019758 | 3300005439 | Bacteria | 4328 |
| 35 | Ga0070705_100021168 | 3300005440 | Bacteria | 3455 |
| 36 | Ga0070700_100005180 | 3300005441 | Bacteria | 6887 |
| 37 | Ga0070700_100182381 | 3300005441 | Unclassified | 1462 |
| 38 | Ga0070694_100030564 | 3300005444 | Bacteria | 3525 |
| 39 | Ga0070663_100262326 | 3300005455 | Bacteria | 1371 |
| 40 | Ga0070678_100014820 | 3300005456 | Bacteria | 4932 |
| 41 | Ga0070678_100136784 | 3300005456 | Bacteria | 1955 |
| 42 | Ga0070662_100015570 | 3300005457 | Bacteria | 5096 |
| 43 | Ga0070681_10000389 | 3300005458 | Bacteria | 35630 |
| 44 | Ga0070681_10036940 | 3300005458 | Bacteria | 4902 |
| 45 | Ga0070681_10043873 | 3300005458 | Bacteria | 4476 |
| 46 | Ga0068867_100015132 | 3300005459 | Bacteria | 5471 |
| 47 | Ga0068867_100053246 | 3300005459 | Bacteria | 2989 |
| 48 | Ga0070698_100015738 | 3300005471 | Bacteria | 7990 |
| 49 | Ga0070679_100000432 | 3300005530 | Bacteria | 35542 |
| 50 | Ga0070679_100001364 | 3300005530 | Bacteria | 21559 |
| 51 | Ga0070679_100067321 | 3300005530 | Bacteria | 3571 |
| 52 | Ga0070679_100073354 | 3300005530 | Bacteria | 3414 |
| 53 | Ga0070679_100084818 | 3300005530 | Bacteria | 3155 |
| 54 | Ga0070679_100186674 | 3300005530 | Bacteria | 2043 |
| 55 | Ga0070679_100342170 | 3300005530 | Bacteria | 1444 |
| 56 | Ga0070684_100014577 | 3300005535 | Bacteria | 6372 |
| 57 | Ga0070684_100021769 | 3300005535 | Bacteria | 5340 |
| 58 | Ga0070684_100034944 | 3300005535 | Bacteria | 4300 |
| 59 | Ga0070684_100047128 | 3300005535 | Bacteria | 3735 |
| 60 | Ga0070684_100109026 | 3300005535 | Bacteria | 2481 |
| 61 | Ga0070684_100250706 | 3300005535 | Bacteria | 1618 |
| 62 | Ga0068853_100065858 | 3300005539 | Bacteria | 3144 |
| 63 | Ga0068853_100222962 | 3300005539 | Bacteria | 1723 |
| 64 | Ga0070686_100045397 | 3300005544 | Bacteria | 2767 |
| 65 | Ga0070686_100051309 | 3300005544 | Bacteria | 2625 |
| 66 | Ga0070696_100011731 | 3300005546 | Bacteria | 5873 |
| 67 | Ga0070696_100021145 | 3300005546 | Bacteria | 4411 |
| 68 | Ga0070693_100004465 | 3300005547 | Bacteria | 6620 |
| 69 | Ga0070693_100014558 | 3300005547 | Bacteria | 4033 |
| 70 | Ga0070665_100149968 | 3300005548 | Bacteria | 2334 |
| 71 | Ga0070665_100171449 | 3300005548 | Bacteria | 2171 |
| 72 | Ga0070704_100063834 | 3300005549 | Bacteria | 2644 |
| 73 | Ga0068855_100025453 | 3300005563 | Bacteria | 7080 |
| 74 | Ga0068855_100056258 | 3300005563 | Bacteria | 4616 |
| 75 | Ga0068855_100062246 | 3300005563 | Bacteria | 4356 |
| 76 | Ga0068855_100187441 | 3300005563 | Bacteria | 2336 |
| 77 | Ga0068855_100312630 | 3300005563 | Bacteria | 1738 |
| 78 | Ga0070664_100005588 | 3300005564 | Bacteria | 10104 |
| 79 | Ga0070664_100037399 | 3300005564 | Bacteria | 4082 |
| 80 | Ga0068857_100060610 | 3300005577 | Bacteria | 3361 |
| 81 | Ga0068854_100028280 | 3300005578 | Bacteria | 3872 |
| 82 | Ga0068856_100085745 | 3300005614 | Bacteria | 3129 |
| 83 | Ga0068856_100243628 | 3300005614 | Bacteria | 1813 |
| 84 | Ga0070702_100019322 | 3300005615 | Bacteria | 3551 |
| 85 | Ga0068852_100018755 | 3300005616 | Bacteria | 5457 |
| 86 | Ga0068852_100047997 | 3300005616 | Bacteria | 3646 |
| 87 | Ga0068859_100119675 | 3300005617 | Bacteria | 2700 |
| 88 | Ga0068864_100058454 | 3300005618 | Bacteria | 3333 |
| 89 | Ga0068864_100082227 | 3300005618 | Bacteria | 2825 |
| 90 | Ga0068864_100097262 | 3300005618 | Bacteria | 2606 |
| 91 | Ga0068866_10002851 | 3300005718 | Bacteria | 7129 |
| 92 | Ga0068866_10030984 | 3300005718 | Bacteria | 2572 |
| 93 | Ga0068861_100041688 | 3300005719 | Bacteria | 3439 |
| 94 | Ga0068861_100248361 | 3300005719 | Bacteria | 1517 |
| 95 | Ga0068863_100098528 | 3300005841 | Bacteria | 2776 |
| 96 | Ga0068858_100066785 | 3300005842 | Bacteria | 3330 |
| 97 | Ga0068860_100197881 | 3300005843 | Bacteria | 1947 |
| 98 | Ga0068860_100257417 | 3300005843 | Bacteria | 1701 |
| 99 | Ga0068862_100000510 | 3300005844 | Bacteria | 41329 |
| 100 | Ga0068862_100031590 | 3300005844 | Bacteria | 4472 |
| 101 | Ga0081455_10010784 | 3300005937 | Bacteria | 9234 |
| 102 | Ga0081455_10038446 | 3300005937 | Bacteria | 4238 |
| 103 | Ga0081538_10016041 | 3300005981 | Bacteria | 5765 |
| 104 | Ga0081540_1009141 | 3300005983 | Bacteria | 6839 |
| 105 | Ga0081540_1014982 | 3300005983 | Bacteria | 4929 |
| 106 | Ga0070717_10033367 | 3300006028 | Bacteria | 4153 |
| 107 | Ga0070717_10060400 | 3300006028 | Bacteria | 3139 |
| 108 | Ga0070717_10297670 | 3300006028 | Bacteria | 1434 |
| 109 | Ga0075432_10014031 | 3300006058 | Bacteria | 2728 |
| 110 | Ga0070715_10083554 | 3300006163 | Bacteria | 1454 |
| 111 | Ga0070716_100103814 | 3300006173 | Bacteria | 1748 |
| 112 | Ga0070716_100177489 | 3300006173 | Bacteria | 1395 |
| 113 | Ga0070712_100017253 | 3300006175 | Bacteria | 4671 |
| 114 | Ga0097621_100046456 | 3300006237 | Bacteria | 3513 |
| 115 | Ga0068871_100040342 | 3300006358 | Bacteria | 3739 |
| 116 | Ga0075428_100018030 | 3300006844 | Bacteria | 7801 |
| 117 | Ga0075428_100114132 | 3300006844 | Bacteria | 2943 |
| 118 | Ga0075428_100221146 | 3300006844 | Bacteria | 2045 |
| 119 | Ga0075430_100002429 | 3300006846 | Bacteria | 15503 |
| 120 | Ga0075430_100143414 | 3300006846 | Bacteria | 1989 |
| 121 | Ga0075433_10082568 | 3300006852 | Bacteria | 2834 |
| 122 | Ga0075433_10091074 | 3300006852 | Bacteria | 2695 |
| 123 | Ga0075434_100005674 | 3300006871 | Bacteria | 11389 |
| 124 | Ga0075429_100259703 | 3300006880 | Bacteria | 1521 |
| 125 | Ga0068865_100077167 | 3300006881 | Bacteria | 2380 |
| 126 | Ga0075436_100055638 | 3300006914 | Bacteria | 2732 |
| 127 | Ga0075436_100114204 | 3300006914 | Bacteria | 1886 |
| 128 | Ga0075436_100120628 | 3300006914 | Bacteria | 1834 |
| 129 | Ga0097620_100119672 | 3300006931 | Bacteria | 2700 |
| 130 | Ga0075435_100011150 | 3300007076 | Bacteria | 6594 |
| 131 | Ga0075435_100019858 | 3300007076 | Bacteria | 5140 |
| 132 | Ga0075435_100287453 | 3300007076 | Bacteria | 1404 |
| 133 | Ga0105240_10012405 | 3300009093 | Bacteria | 11765 |
| 134 | Ga0105240_10019995 | 3300009093 | Bacteria | 8939 |
| 135 | Ga0105240_10113791 | 3300009093 | Bacteria | 3269 |
| 136 | Ga0105240_10224947 | 3300009093 | Bacteria | 2184 |
| 137 | Ga0105240_10418448 | 3300009093 | Unclassified | 1506 |
| 138 | Ga0111539_10045842 | 3300009094 | Bacteria | 5232 |
| 139 | Ga0111539_10111312 | 3300009094 | Bacteria | 3213 |
| 140 | Ga0105245_10025810 | 3300009098 | Bacteria | 5167 |
| 141 | Ga0105245_10036032 | 3300009098 | Bacteria | 4393 |
| 142 | Ga0105245_10052738 | 3300009098 | Bacteria | 3648 |
| 143 | Ga0105245_10109325 | 3300009098 | Bacteria | 2569 |
| 144 | Ga0105245_10127540 | 3300009098 | Bacteria | 2383 |
| 145 | Ga0105245_10136565 | 3300009098 | Bacteria | 2305 |
| 146 | Ga0105245_10574636 | 3300009098 | Bacteria | 1151 |
| 147 | Ga0114129_10094114 | 3300009147 | Bacteria | 4150 |
| 148 | Ga0114129_10200400 | 3300009147 | Bacteria | 2704 |
| 149 | Ga0105243_10008961 | 3300009148 | Bacteria | 7647 |
| 150 | Ga0105243_10019768 | 3300009148 | Bacteria | 5106 |
| 151 | Ga0105243_10039302 | 3300009148 | Bacteria | 3687 |
| 152 | Ga0105243_10135297 | 3300009148 | Bacteria | 2096 |
| 153 | Ga0105243_10252719 | 3300009148 | Bacteria | 1574 |
| 154 | Ga0105241_10204309 | 3300009174 | Bacteria | 1652 |
| 155 | Ga0105241_10241227 | 3300009174 | Bacteria | 1528 |
| 156 | Ga0105242_10062841 | 3300009176 | Bacteria | 3057 |
| 157 | Ga0105242_10222032 | 3300009176 | Bacteria | 1689 |
| 158 | Ga0105248_10015966 | 3300009177 | Bacteria | 8268 |
| 159 | Ga0105248_10059254 | 3300009177 | Bacteria | 4300 |
| 160 | Ga0105248_10083536 | 3300009177 | Bacteria | 3592 |
| 161 | Ga0105248_10095780 | 3300009177 | Bacteria | 3342 |
| 162 | Ga0105248_10110073 | 3300009177 | Bacteria | 3106 |
| 163 | Ga0105248_10134337 | 3300009177 | Bacteria | 2791 |
| 164 | Ga0105237_10019493 | 3300009545 | Bacteria | 7005 |
| 165 | Ga0105237_10349014 | 3300009545 | Bacteria | 1484 |
| 166 | Ga0105237_10415289 | 3300009545 | Bacteria | 1351 |
| 167 | Ga0105238_10078038 | 3300009551 | Bacteria | 3303 |
| 168 | Ga0105238_10287409 | 3300009551 | Bacteria | 1626 |
| 169 | Ga0105238_10387089 | 3300009551 | Bacteria | 1390 |
| 170 | Ga0105249_10007467 | 3300009553 | Bacteria | 9538 |
| 171 | Ga0105249_10060351 | 3300009553 | Bacteria | 3478 |
| 172 | Ga0105249_10351355 | 3300009553 | Bacteria | 1494 |
| 173 | Ga0105239_10063124 | 3300010375 | Bacteria | 4067 |
| 174 | Ga0105239_10108285 | 3300010375 | Bacteria | 3079 |
| 175 | Ga0105239_10113310 | 3300010375 | Bacteria | 3007 |
| 176 | Ga0105246_10186550 | 3300011119 | Bacteria | 1602 |
| 177 | Ga0157373_10107256 | 3300013100 | Bacteria | 1964 |
| 178 | Ga0157373_10153164 | 3300013100 | Bacteria | 1622 |
| 179 | Ga0157371_10045730 | 3300013102 | Bacteria | 3114 |
| 180 | Ga0157370_10006514 | 3300013104 | Bacteria | 12857 |
| 181 | Ga0157370_10507520 | 3300013104 | Bacteria | 1107 |
| 182 | Ga0157369_10029323 | 3300013105 | Bacteria | 6081 |
| 183 | Ga0157369_10150590 | 3300013105 | Bacteria | 2458 |
| 184 | Ga0157369_10188938 | 3300013105 | Bacteria | 2165 |
| 185 | Ga0157369_10345041 | 3300013105 | Bacteria | 1547 |
| 186 | Ga0157374_10416544 | 3300013296 | Bacteria | 1342 |
| 187 | Ga0157374_10437009 | 3300013296 | Bacteria | 1309 |
| 188 | Ga0157378_10007242 | 3300013297 | Bacteria | 9688 |
| 189 | Ga0157378_10028732 | 3300013297 | Bacteria | 4910 |
| 190 | Ga0157378_10425071 | 3300013297 | Bacteria | 1314 |
| 191 | Ga0163162_10363552 | 3300013306 | Bacteria | 1580 |
| 192 | Ga0157372_10166394 | 3300013307 | Bacteria | 2550 |
| 193 | Ga0157372_10384278 | 3300013307 | Bacteria | 1636 |
| 194 | Ga0157372_10744608 | 3300013307 | Bacteria | 1140 |
| 195 | Ga0157375_10007894 | 3300013308 | Bacteria | 9316 |
| 196 | Ga0157375_10014719 | 3300013308 | Bacteria | 6989 |
| 197 | Ga0157375_10103294 | 3300013308 | Bacteria | 2937 |
| 198 | Ga0163163_10011817 | 3300014325 | Bacteria | 7938 |
| 199 | Ga0163163_10048708 | 3300014325 | Bacteria | 4168 |
| 200 | Ga0163163_10514900 | 3300014325 | Bacteria | 1259 |
| 201 | Ga0157380_10027943 | 3300014326 | Bacteria | 4296 |
| 202 | Ga0157380_10225162 | 3300014326 | Bacteria | 1680 |
| 203 | Ga0182008_10025657 | 3300014497 | Bacteria | 2993 |
| 204 | Ga0157377_10019488 | 3300014745 | Bacteria | 3545 |
| 205 | Ga0157377_10224521 | 3300014745 | Unclassified | 1204 |
| 206 | Ga0157379_10027267 | 3300014968 | Bacteria | 5085 |
| 207 | Ga0157379_10122190 | 3300014968 | Bacteria | 2343 |
| 208 | Ga0157379_10150641 | 3300014968 | Bacteria | 2098 |
| 209 | Ga0157379_10211601 | 3300014968 | Bacteria | 1755 |
| 210 | Ga0157376_10005763 | 3300014969 | Bacteria | 8678 |
| 211 | Ga0157376_10045765 | 3300014969 | Bacteria | 3605 |
| 212 | Ga0157376_10266673 | 3300014969 | Bacteria | 1607 |
| 213 | Ga0206356_11468302 | 3300020070 | Bacteria | 1857 |
| 214 | Ga0207653_10018292 | 3300025885 | Bacteria | 2207 |
| 215 | Ga0207692_10007180 | 3300025898 | Bacteria | 4552 |
| 216 | Ga0207692_10087907 | 3300025898 | Bacteria | 1678 |
| 217 | Ga0207710_10060327 | 3300025900 | Bacteria | 1719 |
| 218 | Ga0207688_10184900 | 3300025901 | Bacteria | 1244 |
| 219 | Ga0207680_10129001 | 3300025903 | Bacteria | 1664 |
| 220 | Ga0207680_10164595 | 3300025903 | Unclassified | 1490 |
| 221 | Ga0207645_10050880 | 3300025907 | Bacteria | 2646 |
| 222 | Ga0207705_10166810 | 3300025909 | Bacteria | 1656 |
| 223 | Ga0207707_10000109 | 3300025912 | Bacteria | 82750 |
| 224 | Ga0207707_10111890 | 3300025912 | Bacteria | 2387 |
| 225 | Ga0207707_10240268 | 3300025912 | Bacteria | 1575 |
| 226 | Ga0207695_10013638 | 3300025913 | Bacteria | 9678 |
| 227 | Ga0207695_10066307 | 3300025913 | Bacteria | 3708 |
| 228 | Ga0207671_10027216 | 3300025914 | Bacteria | 4275 |
| 229 | Ga0207671_10052836 | 3300025914 | Bacteria | 3011 |
| 230 | Ga0207671_10176636 | 3300025914 | Bacteria | 1660 |
| 231 | Ga0207693_10001725 | 3300025915 | Bacteria | 19220 |
| 232 | Ga0207693_10309857 | 3300025915 | Bacteria | 1236 |
| 233 | Ga0207663_10002887 | 3300025916 | Bacteria | 8302 |
| 234 | Ga0207663_10060963 | 3300025916 | Bacteria | 2392 |
| 235 | Ga0207663_10173341 | 3300025916 | Bacteria | 1534 |
| 236 | Ga0207660_10001772 | 3300025917 | Bacteria | 14445 |
| 237 | Ga0207660_10144556 | 3300025917 | Bacteria | 1821 |
| 238 | Ga0207660_10321231 | 3300025917 | Bacteria | 1236 |
| 239 | Ga0207662_10031709 | 3300025918 | Bacteria | 3071 |
| 240 | Ga0207657_10013373 | 3300025919 | Bacteria | 8052 |
| 241 | Ga0207657_10020652 | 3300025919 | Bacteria | 6218 |
| 242 | Ga0207649_10152166 | 3300025920 | Bacteria | 1594 |
| 243 | Ga0207652_10000248 | 3300025921 | Bacteria | 56095 |
| 244 | Ga0207652_10000900 | 3300025921 | Bacteria | 28122 |
| 245 | Ga0207652_10004169 | 3300025921 | Bacteria | 11790 |
| 246 | Ga0207652_10010262 | 3300025921 | Bacteria | 7538 |
| 247 | Ga0207652_10025461 | 3300025921 | Bacteria | 4920 |
| 248 | Ga0207652_10063390 | 3300025921 | Bacteria | 3197 |
| 249 | Ga0207687_10036898 | 3300025927 | Bacteria | 3332 |
| 250 | Ga0207687_10188322 | 3300025927 | Bacteria | 1604 |
| 251 | Ga0207687_10416058 | 3300025927 | Bacteria | 1108 |
| 252 | Ga0207700_10229960 | 3300025928 | Bacteria | 1576 |
| 253 | Ga0207664_10100558 | 3300025929 | Bacteria | 2388 |
| 254 | Ga0207664_10207290 | 3300025929 | Bacteria | 1695 |
| 255 | Ga0207644_10160417 | 3300025931 | Bacteria | 1747 |
| 256 | Ga0207690_10009698 | 3300025932 | Bacteria | 5718 |
| 257 | Ga0207690_10075595 | 3300025932 | Bacteria | 2336 |
| 258 | Ga0207706_10006396 | 3300025933 | Bacteria | 10944 |
| 259 | Ga0207686_10050979 | 3300025934 | Bacteria | 2576 |
| 260 | Ga0207686_10107130 | 3300025934 | Bacteria | 1878 |
| 261 | Ga0207686_10203788 | 3300025934 | Bacteria | 1418 |
| 262 | Ga0207709_10031650 | 3300025935 | Bacteria | 3092 |
| 263 | Ga0207670_10147339 | 3300025936 | Bacteria | 1742 |
| 264 | Ga0207665_10003605 | 3300025939 | Bacteria | 10341 |
| 265 | Ga0207691_10083617 | 3300025940 | Bacteria | 2866 |
| 266 | Ga0207711_10053203 | 3300025941 | Bacteria | 3472 |
| 267 | Ga0207711_10075258 | 3300025941 | Bacteria | 2938 |
| 268 | Ga0207711_10098258 | 3300025941 | Bacteria | 2586 |
| 269 | Ga0207661_10001916 | 3300025944 | Bacteria | 14287 |
| 270 | Ga0207661_10096635 | 3300025944 | Bacteria | 2472 |
| 271 | Ga0207679_10003163 | 3300025945 | Bacteria | 10164 |
| 272 | Ga0207667_10033092 | 3300025949 | Bacteria | 5562 |
| 273 | Ga0207667_10115465 | 3300025949 | Bacteria | 2767 |
| 274 | Ga0207667_10116708 | 3300025949 | Bacteria | 2750 |
| 275 | Ga0207667_10438239 | 3300025949 | Unclassified | 1328 |
| 276 | Ga0207712_10104357 | 3300025961 | Bacteria | 2113 |
| 277 | Ga0207712_10216493 | 3300025961 | Bacteria | 1529 |
| 278 | Ga0207640_10061687 | 3300025981 | Bacteria | 2484 |
| 279 | Ga0207640_10067280 | 3300025981 | Bacteria | 2396 |
| 280 | Ga0207658_10024480 | 3300025986 | Bacteria | 4225 |
| 281 | Ga0207658_10059699 | 3300025986 | Bacteria | 2842 |
| 282 | Ga0207677_10030239 | 3300026023 | Bacteria | 3453 |
| 283 | Ga0207677_10031180 | 3300026023 | Bacteria | 3412 |
| 284 | Ga0207677_10163002 | 3300026023 | Bacteria | 1734 |
| 285 | Ga0207703_10039091 | 3300026035 | Bacteria | 3790 |
| 286 | Ga0207639_10133735 | 3300026041 | Bacteria | 2056 |
| 287 | Ga0207678_10005158 | 3300026067 | Bacteria | 11710 |
| 288 | Ga0207678_10045634 | 3300026067 | Bacteria | 3789 |
| 289 | Ga0207702_10020480 | 3300026078 | Bacteria | 5475 |
| 290 | Ga0207702_10126349 | 3300026078 | Bacteria | 2296 |
| 291 | Ga0207702_10128485 | 3300026078 | Bacteria | 2278 |
| 292 | Ga0207648_10027472 | 3300026089 | Bacteria | 5051 |
| 293 | Ga0207648_10108218 | 3300026089 | Bacteria | 2440 |
| 294 | Ga0207676_10223721 | 3300026095 | Bacteria | 1678 |
| 295 | Ga0207674_10033681 | 3300026116 | Bacteria | 5362 |
| 296 | Ga0207674_10076069 | 3300026116 | Bacteria | 3366 |
| 297 | Ga0207674_10080449 | 3300026116 | Bacteria | 3262 |
| 298 | Ga0207675_100017588 | 3300026118 | Bacteria | 6670 |
| 299 | Ga0207675_100037798 | 3300026118 | Bacteria | 4503 |
| 300 | Ga0207675_100083040 | 3300026118 | Bacteria | 3004 |
| 301 | Ga0207683_10004132 | 3300026121 | Bacteria | 12556 |
| 302 | Ga0207683_10056920 | 3300026121 | Bacteria | 3431 |
| 303 | Ga0207683_10089503 | 3300026121 | Bacteria | 2740 |
| 304 | Ga0207698_10038080 | 3300026142 | Bacteria | 3549 |
| 305 | Ga0207698_10118278 | 3300026142 | Bacteria | 2237 |
| 306 | Ga0209998_10011918 | 3300027717 | Bacteria | 1805 |
| 307 | Ga0207428_10029242 | 3300027907 | Bacteria | 4570 |
| 308 | Ga0207428_10064950 | 3300027907 | Bacteria | 2881 |
| 309 | Ga0268266_10000406 | 3300028379 | Bacteria | 65477 |
| 310 | Ga0268265_10009761 | 3300028380 | Bacteria | 6481 |
| 311 | Ga0268264_10052743 | 3300028381 | Bacteria | 3391 |
| 312 | Ga0265319_1014850 | 3300028563 | Bacteria | 3039 |
| 313 | Ga0265319_1040462 | 3300028563 | Bacteria | 1576 |
| 314 | Ga0265334_10002240 | 3300028573 | Bacteria | 9091 |
| 315 | Ga0265318_10010527 | 3300028577 | Bacteria | 4022 |
| 316 | Ga0265338_10026055 | 3300028800 | Bacteria | 5912 |
| 317 | Ga0265338_10087525 | 3300028800 | Bacteria | 2588 |
| 318 | Ga0265338_10152283 | 3300028800 | Bacteria | 1795 |
| 319 | Ga0265332_10012597 | 3300031238 | Bacteria | 3750 |
| 320 | Ga0265325_10006999 | 3300031241 | Bacteria | 6795 |
| 321 | Ga0265325_10015611 | 3300031241 | Bacteria | 4266 |
| 322 | Ga0265340_10004670 | 3300031247 | Bacteria | 7621 |
| 323 | Ga0265339_10108802 | 3300031249 | Bacteria | 1436 |
| 324 | Ga0265316_10021507 | 3300031344 | Bacteria | 5461 |
| 325 | Ga0265314_10025523 | 3300031711 | Bacteria | 4455 |
| 326 | Ga0307405_10285287 | 3300031731 | Bacteria | 1245 |
| 327 | Ga0307416_100055068 | 3300032002 | Bacteria | 3201 |
| 328 | Ga0307415_100190534 | 3300032126 | Bacteria | 1618 |
| 329 | Ga0373928_0035301 | 3300035084 | Bacteria | 1126 |
| 330 | Ga0373944_0048942 | 3300035089 | Bacteria | 1327 |
| 331 | Ga0373951_0008911 | 3300035091 | Bacteria | 2262 |
| 332 | Ga0373945_0009448 | 3300035116 | Bacteria | 3196 |
| 333 | Ga0373943_0009954 | 3300035170 | Bacteria | 4261 |
| 334 | Ga0373943_0207871 | 3300035170 | Bacteria | 1086 |
| 335 | Ga0373946_0017246 | 3300035171 | Bacteria | 2761 |
| 336 | Ga0373955_0166791 | 3300035172 | Bacteria | 1302 |
| 337 | Ga0373961_0071088 | 3300035241 | Bacteria | 1076 |
| 338 | Ga0373927_0085845 | 3300035695 | Bacteria | 2043 |
| 339 | Ga0373947_0007670 | 3300035725 | Bacteria | 6237 |
| 340 | Ga0373937_0625391 | 3300036401 | Bacteria | 1022 |
| 341 | Ga0373925_0105351 | 3300037068 | Bacteria | 2173 |
| 342 | Ga0395899_0000614 | 3300037312 | Bacteria | 37099 |
| 343 | Ga0395898_0008093 | 3300037466 | Bacteria | 11131 |
| 344 | Ga0395898_0308714 | 3300037466 | Bacteria | 1509 |
| 345 | Ga0395905_0003094 | 3300037471 | Bacteria | 17973 |
| 346 | Ga0395901_0001542 | 3300038443 | Bacteria | 23884 |
| 347 | Ga0395901_0131053 | 3300038443 | Bacteria | 2635 |
| 348 | Ga0395901_0216405 | 3300038443 | Bacteria | 2004 |
| 349 | Ga0451795_1063198 | 3300041456 | Bacteria | 3361 |
| 350 | Ga0451798_0138267 | 3300041458 | Bacteria | 1925 |
| 351 | Ga0451800_0933833 | 3300041459 | Bacteria | 2591 |
| 352 | Ga0451802_0241505 | 3300041460 | Bacteria | 3728 |
| 353 | Ga0451804_0599873 | 3300041463 | Bacteria | 5172 |
| 354 | Ga0451807_0826841 | 3300041486 | Bacteria | 2128 |
| 355 | Ga0451839_1417283 | 3300041496 | Bacteria | 4083 |
| 356 | Ga0451841_1173131 | 3300041498 | Bacteria | 2565 |
| 357 | Ga0451845_0312446 | 3300041501 | Bacteria | 4159 |
| 358 | Ga0451849_1446404 | 3300041505 | Bacteria | 3548 |
| 359 | Ga0451851_0670690 | 3300041507 | Bacteria | 5107 |
| 360 | Ga0451855_0466827 | 3300041511 | Bacteria | 2242 |
| 361 | Ga0451853_1409041 | 3300041512 | Bacteria | 1579 |
| 362 | Ga0451853_1985226 | 3300041512 | Bacteria | 1360 |
| 363 | Ga0439448_0017142 | 3300042005 | Bacteria | 2210 |
| 364 | Ga0439459_0022340 | 3300042438 | Bacteria | 1223 |
| 365 | Ga0466965_0140011 | 3300044683 | Bacteria | 1259 |
| 366 | Ga0466966_0005854 | 3300044684 | Bacteria | 8107 |
| 367 | Ga0466961_0009629 | 3300044693 | Bacteria | 6151 |
| 368 | Ga0466963_0002778 | 3300044694 | Bacteria | 9868 |
| 369 | Ga0466963_0002920 | 3300044694 | Bacteria | 9654 |
| 370 | Ga0466964_0001744 | 3300044706 | Bacteria | 7530 |
| 371 | Ga0466971_0057252 | 3300044719 | Bacteria | 1758 |
| 372 | Ga0466968_0034543 | 3300044735 | Bacteria | 2110 |
| 373 | Ga0466970_0108799 | 3300044765 | Bacteria | 1513 |
| 374 | Ga0466957_0117616 | 3300044842 | Bacteria | 1692 |
| 375 | Ga0466960_0000003 | 3300044901 | Bacteria | 86010 |
| 376 | Ga0466960_0066433 | 3300044901 | Bacteria | 1783 |
| 377 | Ga0466960_0108778 | 3300044901 | Bacteria | 1437 |
| 378 | Ga0466960_0127366 | 3300044901 | Bacteria | 1340 |
| 379 | Ga0466959_0076933 | 3300045049 | Bacteria | 2409 |
| 380 | Ga0466959_0143353 | 3300045049 | Bacteria | 1687 |
| 381 | Ga0466958_0021497 | 3300045836 | Bacteria | 3772 |
| 382 | Ga0466958_0123305 | 3300045836 | Bacteria | 1623 |
| 383 | Ga0466967_0004040 | 3300045976 | Bacteria | 9787 |
| 384 | Ga0466967_0024629 | 3300045976 | Bacteria | 4951 |
| 385 | Ga0466967_0031792 | 3300045976 | Bacteria | 4449 |
| 386 | Ga0466967_0032332 | 3300045976 | Bacteria | 4416 |
| 387 | Ga0466967_0203090 | 3300045976 | Bacteria | 1877 |
| 388 | Ga0495603_0000065 | 3300046455 | Bacteria | 46432 |
| 389 | Ga0495641_0006525 | 3300046461 | Bacteria | 7538 |
| 390 | Ga0495653_0160342 | 3300046463 | Bacteria | 1562 |
| 391 | Ga0495650_0000053 | 3300046471 | Bacteria | 316684 |
| 392 | Ga0495580_0032597 | 3300046472 | Bacteria | 3759 |
| 393 | Ga0495582_0005435 | 3300046473 | Bacteria | 7110 |
| 394 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 395 | Ga0495664_0018844 | 3300046477 | Bacteria | 3961 |
| 396 | Ga0495594_0005133 | 3300046499 | Bacteria | 6734 |
| 397 | Ga0495594_0006993 | 3300046499 | Bacteria | 5799 |
| 398 | Ga0495596_0109799 | 3300046500 | Bacteria | 1071 |
| 399 | Ga0495608_0042395 | 3300046511 | Bacteria | 3044 |
| 400 | Ga0495628_0000891 | 3300046516 | Bacteria | 27515 |
| 401 | Ga0495652_0342603 | 3300046529 | Bacteria | 1073 |
| 402 | Ga0495587_0021592 | 3300046536 | Bacteria | 3971 |
| 403 | Ga0495645_0163728 | 3300046543 | Bacteria | 1536 |
| 404 | Ga0495634_0058532 | 3300046642 | Bacteria | 2568 |
| 405 | Ga0495657_0114175 | 3300046675 | Bacteria | 1708 |
| 406 | Ga0495599_0028906 | 3300046678 | Bacteria | 3474 |
| 407 | Ga0495646_0012695 | 3300046680 | Bacteria | 5353 |
| 408 | Ga0495658_0029271 | 3300046683 | Bacteria | 2980 |
| 409 | Ga0495674_0059682 | 3300047319 | Bacteria | 3331 |
| 410 | Ga0495676_0000444 | 3300047321 | Bacteria | 33833 |
| 411 | Ga0495676_0042791 | 3300047321 | Bacteria | 3714 |
| 412 | Ga0495680_0229809 | 3300047322 | Bacteria | 1321 |
| 413 | Ga0495684_0044420 | 3300047471 | Bacteria | 3402 |
| 414 | Ga0495684_0089440 | 3300047471 | Bacteria | 2333 |
| 415 | Ga0495686_0107931 | 3300047472 | Unclassified | 1673 |
| 416 | Ga0495602_0000533 | 3300048088 | Bacteria | 35335 |
| 417 | Ga0496100_0002209 | 3300048903 | Bacteria | 9825 |
| 418 | Ga0496100_0019691 | 3300048903 | Bacteria | 4032 |
| 419 | Ga0496100_0039134 | 3300048903 | Bacteria | 3010 |
| 420 | Ga0496100_0111672 | 3300048903 | Bacteria | 1900 |
| 421 | Ga0496100_0220841 | 3300048903 | Bacteria | 1390 |
| 422 | Ga0496100_0326809 | 3300048903 | Bacteria | 1153 |
| 423 | Ga0496101_0004150 | 3300048904 | Bacteria | 9075 |
| 424 | Ga0496101_0059585 | 3300048904 | Bacteria | 2767 |
| 425 | Ga0496101_0101867 | 3300048904 | Bacteria | 2150 |
| 426 | Ga0496101_0106736 | 3300048904 | Bacteria | 2103 |
| 427 | Ga0496102_0023310 | 3300048905 | Bacteria | 5495 |
| 428 | Ga0496102_0047737 | 3300048905 | Bacteria | 3892 |
| 429 | Ga0496102_0057030 | 3300048905 | Bacteria | 3564 |
| 430 | Ga0496102_0125159 | 3300048905 | Bacteria | 2402 |
| 431 | Ga0496102_0180760 | 3300048905 | Bacteria | 1987 |
| 432 | Ga0496102_0306499 | 3300048905 | Bacteria | 1497 |
| 433 | Ga0496102_0508472 | 3300048905 | Bacteria | 1127 |
| 434 | Ga0496102_0524115 | 3300048905 | Bacteria | 1107 |
| 435 | Ga0496103_0044000 | 3300048906 | Bacteria | 2750 |
| 436 | Ga0496104_0000647 | 3300048907 | Bacteria | 29839 |
| 437 | Ga0496104_0005379 | 3300048907 | Bacteria | 11209 |
| 438 | Ga0496104_0014887 | 3300048907 | Bacteria | 7031 |
| 439 | Ga0496104_0069697 | 3300048907 | Bacteria | 3342 |
| 440 | Ga0496104_0072012 | 3300048907 | Bacteria | 3286 |
| 441 | Ga0496104_0092404 | 3300048907 | Bacteria | 2893 |
| 442 | Ga0496104_0113418 | 3300048907 | Bacteria | 2599 |
| 443 | Ga0496105_0008415 | 3300048908 | Bacteria | 8019 |
| 444 | Ga0496105_0014471 | 3300048908 | Bacteria | 6281 |
| 445 | Ga0496105_0026893 | 3300048908 | Bacteria | 4695 |
| 446 | Ga0496105_0043284 | 3300048908 | Bacteria | 3713 |
| 447 | Ga0496105_0043926 | 3300048908 | Bacteria | 3685 |
| 448 | Ga0496105_0049153 | 3300048908 | Bacteria | 3481 |
| 449 | Ga0496105_0132175 | 3300048908 | Bacteria | 2057 |
| 450 | Ga0496106_0006195 | 3300048909 | Bacteria | 8849 |
| 451 | Ga0496106_0016306 | 3300048909 | Bacteria | 5497 |
| 452 | Ga0496106_0093541 | 3300048909 | Bacteria | 2323 |
| 453 | Ga0496106_0123354 | 3300048909 | Bacteria | 2027 |
| 454 | Ga0496107_0025569 | 3300048910 | Bacteria | 4180 |
| 455 | Ga0496107_0053818 | 3300048910 | Bacteria | 2903 |
| 456 | Ga0496107_0077461 | 3300048910 | Bacteria | 2422 |
| 457 | Ga0496107_0180676 | 3300048910 | Bacteria | 1566 |
| 458 | Ga0496107_0373857 | 3300048910 | Bacteria | 1060 |
| 459 | Ga0496108_0000632 | 3300048911 | Bacteria | 27472 |
| 460 | Ga0496108_0009048 | 3300048911 | Bacteria | 8067 |
| 461 | Ga0496108_0034929 | 3300048911 | Bacteria | 4177 |
| 462 | Ga0496108_0065740 | 3300048911 | Bacteria | 3057 |
| 463 | Ga0496108_0164281 | 3300048911 | Bacteria | 1919 |
| 464 | Ga0496109_0003540 | 3300048912 | Bacteria | 13033 |
| 465 | Ga0496109_0041443 | 3300048912 | Bacteria | 4170 |
| 466 | Ga0496109_0174082 | 3300048912 | Bacteria | 2020 |
| 467 | Ga0496109_0182112 | 3300048912 | Bacteria | 1973 |
| 468 | Ga0496110_0009847 | 3300048913 | Bacteria | 7746 |
| 469 | Ga0496110_0015250 | 3300048913 | Bacteria | 6390 |
| 470 | Ga0496110_0050894 | 3300048913 | Bacteria | 3639 |
| 471 | Ga0496110_0052536 | 3300048913 | Bacteria | 3581 |
| 472 | Ga0496110_0135835 | 3300048913 | Bacteria | 2222 |
| 473 | Ga0496110_0294870 | 3300048913 | Bacteria | 1477 |
| 474 | Ga0496111_0000319 | 3300048914 | Bacteria | 23843 |
| 475 | Ga0496111_0005473 | 3300048914 | Bacteria | 8144 |
| 476 | Ga0496111_0006910 | 3300048914 | Bacteria | 7406 |
| 477 | Ga0496111_0014498 | 3300048914 | Bacteria | 5386 |
| 478 | Ga0496111_0025487 | 3300048914 | Bacteria | 4172 |
| 479 | Ga0496111_0036669 | 3300048914 | Bacteria | 3507 |
| 480 | Ga0496111_0038057 | 3300048914 | Bacteria | 3445 |
| 481 | Ga0496112_0021172 | 3300048915 | Bacteria | 6179 |
| 482 | Ga0496112_0021993 | 3300048915 | Bacteria | 6070 |
| 483 | Ga0496112_0022291 | 3300048915 | Bacteria | 6034 |
| 484 | Ga0496112_0042483 | 3300048915 | Bacteria | 4447 |
| 485 | Ga0496112_0049387 | 3300048915 | Bacteria | 4124 |
| 486 | Ga0496112_0400164 | 3300048915 | Bacteria | 1313 |
| 487 | Ga0496112_0408811 | 3300048915 | Bacteria | 1296 |
| 488 | Ga0496113_0001938 | 3300048916 | Bacteria | 11845 |
| 489 | Ga0496114_0014110 | 3300048917 | Bacteria | 6405 |
| 490 | Ga0496114_0031553 | 3300048917 | Bacteria | 4359 |
| 491 | Ga0496114_0037283 | 3300048917 | Bacteria | 4020 |
| 492 | Ga0496114_0039612 | 3300048917 | Bacteria | 3900 |
| 493 | Ga0496114_0101409 | 3300048917 | Bacteria | 2458 |
| 494 | Ga0496114_0112164 | 3300048917 | Bacteria | 2337 |
| 495 | Ga0496115_0001134 | 3300048918 | Bacteria | 19237 |
| 496 | Ga0496115_0140350 | 3300048918 | Bacteria | 1994 |
| 497 | Ga0496115_0208708 | 3300048918 | Bacteria | 1613 |
| 498 | Ga0496115_0360806 | 3300048918 | Bacteria | 1184 |
| 499 | Ga0496116_0000441 | 3300048919 | Bacteria | 58149 |
| 500 | Ga0496117_0025669 | 3300048920 | Bacteria | 4627 |
| 501 | Ga0496118_0005040 | 3300048921 | Bacteria | 15236 |
| 502 | Ga0496118_0075915 | 3300048921 | Bacteria | 2393 |
| 503 | Ga0496118_0084957 | 3300048921 | Bacteria | 2206 |
| 504 | Ga0496119_0001484 | 3300048922 | Bacteria | 28124 |
| 505 | Ga0496119_0021019 | 3300048922 | Bacteria | 4733 |
| 506 | Ga0496119_0031659 | 3300048922 | Bacteria | 3540 |
| 507 | Ga0496120_0001894 | 3300048923 | Bacteria | 23214 |
| 508 | Ga0496121_0032823 | 3300048924 | Bacteria | 4710 |
| 509 | Ga0496121_0052296 | 3300048924 | Bacteria | 3432 |
| 510 | Ga0496124_0063748 | 3300048927 | Bacteria | 3078 |
| 511 | Ga0496125_0060265 | 3300048928 | Bacteria | 3052 |
| 512 | Ga0496125_0269580 | 3300048928 | Bacteria | 1062 |
| 513 | Ga0496126_0020971 | 3300048929 | Bacteria | 6395 |
| 514 | Ga0496126_0230653 | 3300048929 | Bacteria | 1551 |
| 515 | Ga0501031_0000058 | 3300049568 | Bacteria | 59109 |
| 516 | Ga0501032_0002722 | 3300049569 | Bacteria | 13772 |
| 517 | Ga0501033_0015135 | 3300049570 | Bacteria | 5853 |
| 518 | Ga0501034_0017696 | 3300049571 | Bacteria | 7308 |
| 519 | Ga0501034_0042047 | 3300049571 | Bacteria | 4625 |
| 520 | Ga0501034_0269645 | 3300049571 | Bacteria | 1643 |
| 521 | Ga0501036_0143599 | 3300049572 | Bacteria | 2013 |
| 522 | Ga0501037_0002322 | 3300049573 | Bacteria | 13746 |
| 523 | Ga0501038_0000485 | 3300049574 | Bacteria | 34975 |
| 524 | Ga0501039_0091953 | 3300049575 | Bacteria | 2365 |
| 525 | Ga0501039_0255958 | 3300049575 | Bacteria | 1376 |
| 526 | Ga0501042_0050607 | 3300049578 | Bacteria | 2963 |
| 527 | Ga0501042_0096561 | 3300049578 | Bacteria | 2123 |
| 528 | Ga0501043_0002786 | 3300049579 | Bacteria | 14607 |
| 529 | Ga0501043_0065129 | 3300049579 | Bacteria | 2862 |
| 530 | Ga0501046_0003436 | 3300049580 | Bacteria | 14532 |
| 531 | Ga0501047_0000647 | 3300049581 | Bacteria | 36587 |
| 532 | Ga0501047_0050484 | 3300049581 | Bacteria | 4017 |
| 533 | Ga0501047_0226448 | 3300049581 | Bacteria | 1724 |
| 534 | Ga0501047_0268533 | 3300049581 | Bacteria | 1552 |
| 535 | Ga0501048_0002614 | 3300049582 | Bacteria | 13786 |
| 536 | Ga0501048_0031782 | 3300049582 | Bacteria | 3818 |
| 537 | Ga0501067_0000031 | 3300049583 | Bacteria | 87732 |
| 538 | Ga0501067_0017294 | 3300049583 | Bacteria | 3984 |
| 539 | Ga0501067_0259559 | 3300049583 | Bacteria | 967 |
| 540 | Ga0501068_0000010 | 3300049584 | Bacteria | 66003 |
| 541 | Ga0501068_0099840 | 3300049584 | Bacteria | 1798 |
| 542 | Ga0501069_0000032 | 3300049585 | Bacteria | 96425 |
| 543 | Ga0501069_0013992 | 3300049585 | Bacteria | 4286 |
| 544 | Ga0501069_0018008 | 3300049585 | Bacteria | 3809 |
| 545 | Ga0501069_0168996 | 3300049585 | Unclassified | 1261 |
| 546 | Ga0501070_0000309 | 3300049586 | Bacteria | 44629 |
| 547 | Ga0501070_0039396 | 3300049586 | Bacteria | 3942 |
| 548 | Ga0501071_0032605 | 3300049587 | Bacteria | 3700 |
| 549 | Ga0501072_0194301 | 3300049588 | Bacteria | 1618 |
| 550 | Ga0501073_0109804 | 3300049589 | Bacteria | 1913 |
| 551 | Ga0501074_0077931 | 3300049590 | Bacteria | 2378 |
| 552 | Ga0501079_0034967 | 3300049741 | Bacteria | 3866 |
| 553 | Ga0501079_0044196 | 3300049741 | Bacteria | 3438 |
| 554 | Ga0501079_0253760 | 3300049741 | Bacteria | 1375 |
| 555 | Ga0501080_0228964 | 3300049742 | Bacteria | 1699 |
| 556 | Ga0501081_0050372 | 3300049743 | Bacteria | 2869 |
| 557 | Ga0501035_0020800 | 3300049822 | Bacteria | 6028 |
| 558 | Ga0501044_0001651 | 3300049823 | Bacteria | 26204 |
| 559 | Ga0501044_0097969 | 3300049823 | Bacteria | 2952 |
| 560 | nmdc:mga05p37_319075_c1 | 3300050507 | Bacteria | 1839 |
| 561 | nmdc:mga09592_63716_c1 | 3300050508 | Bacteria | 3120 |
| 562 | nmdc:mga08y16_495077_c1 | 3300050511 | Bacteria | 1243 |
| 563 | nmdc:mga0n895_131020_c1 | 3300050512 | Bacteria | 2533 |
| 564 | nmdc:mga0n895_247783_c1 | 3300050512 | Bacteria | 1808 |
| 565 | nmdc:mga0n895_88486_c1 | 3300050512 | Bacteria | 3097 |
| 566 | nmdc:mga0rr50_300509_c1 | 3300050513 | Bacteria | 1343 |
| 567 | nmdc:mga0rr50_46336_c1 | 3300050513 | Bacteria | 3201 |
| 568 | nmdc:mga08x19_100039_c1 | 3300050514 | Bacteria | 1923 |
| 569 | nmdc:mga08x19_5861_c1 | 3300050514 | Bacteria | 7270 |
| 570 | nmdc:mga08x19_62918_c1 | 3300050514 | Bacteria | 2407 |
| 571 | nmdc:mga0a205_80362_c1 | 3300050515 | Bacteria | 3151 |
| 572 | nmdc:mga0a205_86634_c1 | 3300050515 | Bacteria | 3025 |
| 573 | Ga0495601_0004984 | 3300053077 | Bacteria | 7709 |
| 574 | Ga0495601_0079238 | 3300053077 | Bacteria | 2106 |
| 575 | Ga0495601_0082129 | 3300053077 | Bacteria | 2068 |
| 576 | Ga0495601_0219218 | 3300053077 | Bacteria | 1243 |
| 577 | Ga0495595_0001606 | 3300053084 | Bacteria | 8818 |
| 578 | Ga0495595_0088039 | 3300053084 | Bacteria | 1487 |
| 579 | Ga0495619_0009718 | 3300053085 | Bacteria | 6064 |
| 580 | Ga0495619_0193450 | 3300053085 | Bacteria | 1408 |
| 581 | Ga0500566_0054748 | 3300053094 | Bacteria | 2274 |
| 582 | Ga0500572_030666 | 3300053111 | Bacteria | 1497 |
| 583 | Ga0500658_0066416 | 3300053134 | Bacteria | 1513 |
| 584 | Ga0500568_0044074 | 3300053139 | Bacteria | 1781 |
| 585 | Ga0500616_0029955 | 3300053153 | Bacteria | 2991 |
| 586 | Ga0501084_0029513 | 3300054114 | Bacteria | 4587 |
| 587 | Ga0501082_0013634 | 3300060353 | Bacteria | 6986 |
| 588 | Ga0466962_0032772 | 3300061719 | Bacteria | 2486 |
| 589 | Ga0466962_0091691 | 3300061719 | Bacteria | 1456 |
| 590 | Ga0530510_0010459 | 3300061734 | Bacteria | 6506 |
| 591 | Ga0530510_0063714 | 3300061734 | Bacteria | 2669 |
| 592 | Ga0530510_0165667 | 3300061734 | Bacteria | 1636 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046642 | Ga0495634_0058532 | Ga0495634_0058532_56_913 | 282 |
| 2 | 3300047319 | Ga0495674_0059682 | Ga0495674_0059682_1864_2721 | 282 |
| 3 | 3300047471 | Ga0495684_0089440 | Ga0495684_0089440_1219_2076 | 282 |
| 4 | 3300053077 | Ga0495601_0082129 | Ga0495601_0082129_910_1767 | 282 |
| 5 | 3300053084 | Ga0495595_0001606 | Ga0495595_0001606_7048_7905 | 282 |
| 6 | 3300053085 | Ga0495619_0009718 | Ga0495619_0009718_616_1473 | 282 |
| 7 | 3300006914 | Ga0075436_100055638 | Ga0075436_1000556382 | 283 |
| 8 | 3300009094 | Ga0111539_10045842 | Ga0111539_100458422 | 283 |
| 9 | 3300035170 | Ga0373943_0207871 | Ga0373943_0207871_204_1076 | 284 |
| 10 | 3300046529 | Ga0495652_0342603 | Ga0495652_0342603_26_898 | 284 |
| 11 | 3300006058 | Ga0075432_10014031 | Ga0075432_100140314 | 285 |
| 12 | 3300006844 | Ga0075428_100221146 | Ga0075428_1002211462 | 285 |
| 13 | 3300006852 | Ga0075433_10082568 | Ga0075433_100825682 | 285 |
| 14 | 3300007076 | Ga0075435_100287453 | Ga0075435_1002874532 | 285 |
| 15 | 3300027907 | Ga0207428_10029242 | Ga0207428_100292425 | 285 |
| 16 | 3300050515 | nmdc:mga0a205_80362_c1 | nmdc:mga0a205_80362_c1_1711_2700 | 285 |
| 17 | 3300013105 | Ga0157369_10345041 | Ga0157369_103450412 | 287 |
| 18 | 3300028800 | Ga0265338_10087525 | Ga0265338_100875252 | 287 |
| 19 | 3300044901 | Ga0466960_0000003 | Ga0466960_0000003_75322_76350 | 288 |
| 20 | 3300028381 | Ga0268264_10052743 | Ga0268264_100527433 | 290 |
| 21 | 3300046516 | Ga0495628_0000891 | Ga0495628_0000891_1290_2282 | 291 |
| 22 | 3300048088 | Ga0495602_0000533 | Ga0495602_0000533_19547_20539 | 291 |
| 23 | 3300009551 | Ga0105238_10078038 | Ga0105238_100780382 | 292 |
| 24 | 3300048928 | Ga0496125_0269580 | Ga0496125_0269580_18_1046 | 292 |
| 25 | 3300044901 | Ga0466960_0127366 | Ga0466960_0127366_225_1256 | 293 |
| 26 | 3300048905 | Ga0496102_0180760 | Ga0496102_0180760_10_969 | 293 |
| 27 | 3300005329 | Ga0070683_100030455 | Ga0070683_1000304556 | 294 |
| 28 | 3300005336 | Ga0070680_100010521 | Ga0070680_1000105219 | 294 |
| 29 | 3300005337 | Ga0070682_100072884 | Ga0070682_1000728842 | 294 |
| 30 | 3300005339 | Ga0070660_100008777 | Ga0070660_1000087776 | 294 |
| 31 | 3300005366 | Ga0070659_100019489 | Ga0070659_1000194894 | 294 |
| 32 | 3300005458 | Ga0070681_10043873 | Ga0070681_100438732 | 294 |
| 33 | 3300005530 | Ga0070679_100067321 | Ga0070679_1000673214 | 294 |
| 34 | 3300005535 | Ga0070684_100014577 | Ga0070684_1000145773 | 294 |
| 35 | 3300005539 | Ga0068853_100065858 | Ga0068853_1000658584 | 294 |
| 36 | 3300005563 | Ga0068855_100187441 | Ga0068855_1001874412 | 294 |
| 37 | 3300005564 | Ga0070664_100037399 | Ga0070664_1000373996 | 294 |
| 38 | 3300005614 | Ga0068856_100085745 | Ga0068856_1000857454 | 294 |
| 39 | 3300005616 | Ga0068852_100018755 | Ga0068852_1000187551 | 294 |
| 40 | 3300009093 | Ga0105240_10019995 | Ga0105240_100199958 | 294 |
| 41 | 3300009545 | Ga0105237_10019493 | Ga0105237_100194934 | 294 |
| 42 | 3300013102 | Ga0157371_10045730 | Ga0157371_100457302 | 294 |
| 43 | 3300013104 | Ga0157370_10006514 | Ga0157370_100065146 | 294 |
| 44 | 3300013105 | Ga0157369_10029323 | Ga0157369_100293238 | 294 |
| 45 | 3300025913 | Ga0207695_10066307 | Ga0207695_100663072 | 294 |
| 46 | 3300025914 | Ga0207671_10027216 | Ga0207671_100272166 | 294 |
| 47 | 3300025917 | Ga0207660_10321231 | Ga0207660_103212312 | 294 |
| 48 | 3300025919 | Ga0207657_10020652 | Ga0207657_100206526 | 294 |
| 49 | 3300025932 | Ga0207690_10009698 | Ga0207690_100096986 | 294 |
| 50 | 3300026142 | Ga0207698_10038080 | Ga0207698_100380805 | 294 |
| 51 | 3300046477 | Ga0495664_0018844 | Ga0495664_0018844_2694_3710 | 294 |
| 52 | 3300048915 | Ga0496112_0021993 | Ga0496112_0021993_2922_3956 | 294 |
| 53 | 3300044706 | Ga0466964_0001744 | Ga0466964_0001744_3979_4944 | 295 |
| 54 | 3300044735 | Ga0466968_0034543 | Ga0466968_0034543_244_1209 | 295 |
| 55 | 3300045976 | Ga0466967_0032332 | Ga0466967_0032332_3015_3980 | 295 |
| 56 | 3300009147 | Ga0114129_10094114 | Ga0114129_100941144 | 296 |
| 57 | 3300049583 | Ga0501067_0259559 | Ga0501067_0259559_34_939 | 296 |
| 58 | 3300053094 | Ga0500566_0054748 | Ga0500566_0054748_46_951 | 296 |
| 59 | 3300053153 | Ga0500616_0029955 | Ga0500616_0029955_22_1053 | 296 |
| 60 | 3300048915 | Ga0496112_0022291 | Ga0496112_0022291_397_1389 | 297 |
| 61 | 3300005338 | Ga0068868_100069246 | Ga0068868_1000692462 | 298 |
| 62 | 3300005458 | Ga0070681_10036940 | Ga0070681_100369402 | 298 |
| 63 | 3300005615 | Ga0070702_100019322 | Ga0070702_1000193224 | 298 |
| 64 | 3300005981 | Ga0081538_10016041 | Ga0081538_100160413 | 298 |
| 65 | 3300009174 | Ga0105241_10204309 | Ga0105241_102043092 | 298 |
| 66 | 3300026023 | Ga0207677_10030239 | Ga0207677_100302394 | 298 |
| 67 | 3300026089 | Ga0207648_10108218 | Ga0207648_101082183 | 298 |
| 68 | 3300037068 | Ga0373925_0105351 | Ga0373925_0105351_308_1288 | 298 |
| 69 | 3300047321 | Ga0495676_0042791 | Ga0495676_0042791_1248_2228 | 298 |
| 70 | 3300046471 | Ga0495650_0000053 | Ga0495650_0000053_162293_163321 | 299 |
| 71 | 3300045976 | Ga0466967_0031792 | Ga0466967_0031792_3033_4064 | 300 |
| 72 | 3300013297 | Ga0157378_10425071 | Ga0157378_104250712 | 301 |
| 73 | 3300036401 | Ga0373937_0625391 | Ga0373937_0625391_20_943 | 301 |
| 74 | 3300046500 | Ga0495596_0109799 | Ga0495596_0109799_11_1018 | 301 |
| 75 | 3300005355 | Ga0070671_100184943 | Ga0070671_1001849432 | 302 |
| 76 | 3300005437 | Ga0070710_10103619 | Ga0070710_101036191 | 302 |
| 77 | 3300005439 | Ga0070711_100019758 | Ga0070711_1000197585 | 302 |
| 78 | 3300005719 | Ga0068861_100248361 | Ga0068861_1002483612 | 302 |
| 79 | 3300006163 | Ga0070715_10083554 | Ga0070715_100835542 | 302 |
| 80 | 3300006173 | Ga0070716_100177489 | Ga0070716_1001774892 | 302 |
| 81 | 3300006175 | Ga0070712_100017253 | Ga0070712_1000172531 | 302 |
| 82 | 3300009545 | Ga0105237_10349014 | Ga0105237_103490142 | 302 |
| 83 | 3300025898 | Ga0207692_10087907 | Ga0207692_100879072 | 302 |
| 84 | 3300025915 | Ga0207693_10001725 | Ga0207693_1000172518 | 302 |
| 85 | 3300025916 | Ga0207663_10002887 | Ga0207663_100028873 | 302 |
| 86 | 3300005435 | Ga0070714_100163275 | Ga0070714_1001632752 | 303 |
| 87 | 3300005436 | Ga0070713_100048274 | Ga0070713_1000482743 | 303 |
| 88 | 3300037466 | Ga0395898_0308714 | Ga0395898_0308714_466_1491 | 303 |
| 89 | 3300038443 | Ga0395901_0216405 | Ga0395901_0216405_919_1944 | 303 |
| 90 | 3300044694 | Ga0466963_0002920 | Ga0466963_0002920_1711_2742 | 303 |
| 91 | 3300044842 | Ga0466957_0117616 | Ga0466957_0117616_100_1131 | 303 |
| 92 | 3300045836 | Ga0466958_0021497 | Ga0466958_0021497_27_1058 | 303 |
| 93 | 3300045976 | Ga0466967_0203090 | Ga0466967_0203090_582_1613 | 303 |
| 94 | 3300047472 | Ga0495686_0107931 | Ga0495686_0107931_85_1173 | 303 |
| 95 | 3300048903 | Ga0496100_0039134 | Ga0496100_0039134_1228_2226 | 303 |
| 96 | 3300048904 | Ga0496101_0106736 | Ga0496101_0106736_841_1839 | 303 |
| 97 | 3300048907 | Ga0496104_0000647 | Ga0496104_0000647_16414_17412 | 303 |
| 98 | 3300048908 | Ga0496105_0043284 | Ga0496105_0043284_1670_2668 | 303 |
| 99 | 3300048919 | Ga0496116_0000441 | Ga0496116_0000441_26441_27523 | 303 |
| 100 | 3300048922 | Ga0496119_0001484 | Ga0496119_0001484_8806_9888 | 303 |
| 101 | 3300049585 | Ga0501069_0168996 | Ga0501069_0168996_205_1230 | 303 |
| 102 | 3300005616 | Ga0068852_100047997 | Ga0068852_1000479974 | 304 |
| 103 | 3300009098 | Ga0105245_10052738 | Ga0105245_100527382 | 304 |
| 104 | 3300013296 | Ga0157374_10416544 | Ga0157374_104165442 | 304 |
| 105 | 3300014745 | Ga0157377_10019488 | Ga0157377_100194883 | 304 |
| 106 | 3300025921 | Ga0207652_10010262 | Ga0207652_1001026210 | 304 |
| 107 | 3300025927 | Ga0207687_10416058 | Ga0207687_104160581 | 304 |
| 108 | 3300026023 | Ga0207677_10031180 | Ga0207677_100311803 | 304 |
| 109 | 3300031731 | Ga0307405_10285287 | Ga0307405_102852872 | 304 |
| 110 | 3300048911 | Ga0496108_0034929 | Ga0496108_0034929_2057_3091 | 304 |
| 111 | 3300048914 | Ga0496111_0036669 | Ga0496111_0036669_183_1217 | 304 |
| 112 | 3300009098 | Ga0105245_10136565 | Ga0105245_101365652 | 305 |
| 113 | 3300026078 | Ga0207702_10126349 | Ga0207702_101263491 | 305 |
| 114 | 3300048929 | Ga0496126_0020971 | Ga0496126_0020971_1651_2736 | 305 |
| 115 | 3300053077 | Ga0495601_0219218 | Ga0495601_0219218_46_1056 | 305 |
| 116 | 3300005335 | Ga0070666_10107850 | Ga0070666_101078502 | 306 |
| 117 | 3300009093 | Ga0105240_10224947 | Ga0105240_102249471 | 306 |
| 118 | 3300013307 | Ga0157372_10166394 | Ga0157372_101663943 | 306 |
| 119 | 3300025898 | Ga0207692_10007180 | Ga0207692_100071801 | 306 |
| 120 | 3300025900 | Ga0207710_10060327 | Ga0207710_100603272 | 306 |
| 121 | 3300025903 | Ga0207680_10164595 | Ga0207680_101645951 | 306 |
| 122 | 3300025916 | Ga0207663_10060963 | Ga0207663_100609633 | 306 |
| 123 | 3300025929 | Ga0207664_10207290 | Ga0207664_102072903 | 306 |
| 124 | 3300025934 | Ga0207686_10203788 | Ga0207686_102037882 | 306 |
| 125 | 3300025986 | Ga0207658_10059699 | Ga0207658_100596991 | 306 |
| 126 | 3300028379 | Ga0268266_10000406 | Ga0268266_1000040640 | 306 |
| 127 | 3300048927 | Ga0496124_0063748 | Ga0496124_0063748_1664_2761 | 306 |
| 128 | 3300050512 | nmdc:mga0n895_247783_c1 | nmdc:mga0n895_247783_c1_36_1067 | 306 |
| 129 | 3300005563 | Ga0068855_100025453 | Ga0068855_10002545310 | 307 |
| 130 | 3300006028 | Ga0070717_10033367 | Ga0070717_100333672 | 307 |
| 131 | 3300013104 | Ga0157370_10507520 | Ga0157370_105075201 | 307 |
| 132 | 3300025949 | Ga0207667_10033092 | Ga0207667_100330923 | 307 |
| 133 | 3300032126 | Ga0307415_100190534 | Ga0307415_1001905342 | 307 |
| 134 | 3300044683 | Ga0466965_0140011 | Ga0466965_0140011_158_1177 | 307 |
| 135 | 3300044765 | Ga0466970_0108799 | Ga0466970_0108799_76_1095 | 307 |
| 136 | 3300045049 | Ga0466959_0076933 | Ga0466959_0076933_929_1948 | 307 |
| 137 | 3300046675 | Ga0495657_0114175 | Ga0495657_0114175_259_1317 | 307 |
| 138 | 3300047322 | Ga0495680_0229809 | Ga0495680_0229809_203_1261 | 307 |
| 139 | 3300048910 | Ga0496107_0373857 | Ga0496107_0373857_49_1041 | 307 |
| 140 | 3300049571 | Ga0501034_0042047 | Ga0501034_0042047_647_1678 | 307 |
| 141 | 3300049572 | Ga0501036_0143599 | Ga0501036_0143599_47_1087 | 307 |
| 142 | 3300049575 | Ga0501039_0255958 | Ga0501039_0255958_222_1262 | 307 |
| 143 | 3300049578 | Ga0501042_0096561 | Ga0501042_0096561_669_1709 | 307 |
| 144 | 3300049582 | Ga0501048_0031782 | Ga0501048_0031782_2482_3528 | 307 |
| 145 | 3300049586 | Ga0501070_0039396 | Ga0501070_0039396_1427_2509 | 307 |
| 146 | 3300049743 | Ga0501081_0050372 | Ga0501081_0050372_1272_2318 | 307 |
| 147 | 3300054114 | Ga0501084_0029513 | Ga0501084_0029513_1286_2332 | 307 |
| 148 | 3300061719 | Ga0466962_0091691 | Ga0466962_0091691_42_1061 | 307 |
| 149 | 3300061734 | Ga0530510_0063714 | Ga0530510_0063714_303_1343 | 307 |
| 150 | 3300014969 | Ga0157376_10266673 | Ga0157376_102666731 | 308 |
| 151 | 3300044719 | Ga0466971_0057252 | Ga0466971_0057252_529_1563 | 308 |
| 152 | 3300045836 | Ga0466958_0123305 | Ga0466958_0123305_59_1093 | 308 |
| 153 | 3300048907 | Ga0496104_0069697 | Ga0496104_0069697_320_1417 | 308 |
| 154 | 3300048908 | Ga0496105_0049153 | Ga0496105_0049153_573_1670 | 308 |
| 155 | 3300048921 | Ga0496118_0075915 | Ga0496118_0075915_194_1273 | 308 |
| 156 | 3300048922 | Ga0496119_0021019 | Ga0496119_0021019_2312_3397 | 308 |
| 157 | 3300048922 | Ga0496119_0031659 | Ga0496119_0031659_1785_2882 | 308 |
| 158 | 3300048923 | Ga0496120_0001894 | Ga0496120_0001894_3520_4605 | 308 |
| 159 | 3300048924 | Ga0496121_0032823 | Ga0496121_0032823_357_1436 | 308 |
| 160 | 3300048924 | Ga0496121_0052296 | Ga0496121_0052296_1058_2155 | 308 |
| 161 | 3300048928 | Ga0496125_0060265 | Ga0496125_0060265_1822_2919 | 308 |
| 162 | 3300048929 | Ga0496126_0230653 | Ga0496126_0230653_51_1139 | 308 |
| 163 | 3300049579 | Ga0501043_0065129 | Ga0501043_0065129_855_1943 | 308 |
| 164 | 3300049581 | Ga0501047_0226448 | Ga0501047_0226448_86_1174 | 308 |
| 165 | 3300049585 | Ga0501069_0018008 | Ga0501069_0018008_558_1646 | 308 |
| 166 | 3300049587 | Ga0501071_0032605 | Ga0501071_0032605_718_1806 | 308 |
| 167 | 3300049590 | Ga0501074_0077931 | Ga0501074_0077931_1127_2215 | 308 |
| 168 | 3300049741 | Ga0501079_0044196 | Ga0501079_0044196_2193_3281 | 308 |
| 169 | 3300049823 | Ga0501044_0097969 | Ga0501044_0097969_19_1107 | 308 |
| 170 | 3300053134 | Ga0500658_0066416 | Ga0500658_0066416_290_1369 | 308 |
| 171 | 3300005563 | Ga0068855_100312630 | Ga0068855_1003126302 | 309 |
| 172 | 3300005983 | Ga0081540_1014982 | Ga0081540_10149824 | 309 |
| 173 | 3300014969 | Ga0157376_10045765 | Ga0157376_100457653 | 309 |
| 174 | 3300025949 | Ga0207667_10438239 | Ga0207667_104382392 | 309 |
| 175 | 3300031241 | Ga0265325_10006999 | Ga0265325_100069991 | 309 |
| 176 | 3300031711 | Ga0265314_10025523 | Ga0265314_100255234 | 309 |
| 177 | 3300041512 | Ga0451853_1985226 | Ga0451853_1985226_10_963 | 309 |
| 178 | 3300005456 | Ga0070678_100136784 | Ga0070678_1001367842 | 310 |
| 179 | 3300005547 | Ga0070693_100004465 | Ga0070693_1000044652 | 310 |
| 180 | 3300006914 | Ga0075436_100120628 | Ga0075436_1001206282 | 310 |
| 181 | 3300025914 | Ga0207671_10052836 | Ga0207671_100528362 | 310 |
| 182 | 3300025981 | Ga0207640_10067280 | Ga0207640_100672803 | 310 |
| 183 | 3300026041 | Ga0207639_10133735 | Ga0207639_101337353 | 310 |
| 184 | 3300026121 | Ga0207683_10089503 | Ga0207683_100895032 | 310 |
| 185 | 3300035170 | Ga0373943_0009954 | Ga0373943_0009954_2151_3110 | 310 |
| 186 | 3300048903 | Ga0496100_0002209 | Ga0496100_0002209_6532_7566 | 310 |
| 187 | 3300048904 | Ga0496101_0004150 | Ga0496101_0004150_1701_2735 | 310 |
| 188 | 3300048905 | Ga0496102_0057030 | Ga0496102_0057030_1639_2673 | 310 |
| 189 | 3300048905 | Ga0496102_0306499 | Ga0496102_0306499_69_1028 | 310 |
| 190 | 3300048907 | Ga0496104_0072012 | Ga0496104_0072012_1311_2345 | 310 |
| 191 | 3300048908 | Ga0496105_0132175 | Ga0496105_0132175_885_1919 | 310 |
| 192 | 3300048909 | Ga0496106_0016306 | Ga0496106_0016306_3405_4439 | 310 |
| 193 | 3300048910 | Ga0496107_0025569 | Ga0496107_0025569_2314_3348 | 310 |
| 194 | 3300048917 | Ga0496114_0014110 | Ga0496114_0014110_4130_5164 | 310 |
| 195 | 3300048921 | Ga0496118_0084957 | Ga0496118_0084957_845_1924 | 310 |
| 196 | 3300053139 | Ga0500568_0044074 | Ga0500568_0044074_576_1658 | 310 |
| 197 | 3300005337 | Ga0070682_100049865 | Ga0070682_1000498652 | 311 |
| 198 | 3300005471 | Ga0070698_100015738 | Ga0070698_1000157388 | 311 |
| 199 | 3300005530 | Ga0070679_100084818 | Ga0070679_1000848181 | 311 |
| 200 | 3300005539 | Ga0068853_100222962 | Ga0068853_1002229623 | 311 |
| 201 | 3300005563 | Ga0068855_100062246 | Ga0068855_1000622465 | 311 |
| 202 | 3300005841 | Ga0068863_100098528 | Ga0068863_1000985283 | 311 |
| 203 | 3300005937 | Ga0081455_10010784 | Ga0081455_1001078410 | 311 |
| 204 | 3300006852 | Ga0075433_10091074 | Ga0075433_100910744 | 311 |
| 205 | 3300006871 | Ga0075434_100005674 | Ga0075434_10000567414 | 311 |
| 206 | 3300007076 | Ga0075435_100011150 | Ga0075435_1000111504 | 311 |
| 207 | 3300009093 | Ga0105240_10113791 | Ga0105240_101137913 | 311 |
| 208 | 3300009098 | Ga0105245_10574636 | Ga0105245_105746361 | 311 |
| 209 | 3300009148 | Ga0105243_10135297 | Ga0105243_101352972 | 311 |
| 210 | 3300010375 | Ga0105239_10108285 | Ga0105239_101082853 | 311 |
| 211 | 3300013105 | Ga0157369_10150590 | Ga0157369_101505902 | 311 |
| 212 | 3300013105 | Ga0157369_10188938 | Ga0157369_101889383 | 311 |
| 213 | 3300013307 | Ga0157372_10744608 | Ga0157372_107446081 | 311 |
| 214 | 3300020070 | Ga0206356_11468302 | Ga0206356_114683022 | 311 |
| 215 | 3300025912 | Ga0207707_10111890 | Ga0207707_101118902 | 311 |
| 216 | 3300025914 | Ga0207671_10176636 | Ga0207671_101766363 | 311 |
| 217 | 3300025917 | Ga0207660_10144556 | Ga0207660_101445562 | 311 |
| 218 | 3300025920 | Ga0207649_10152166 | Ga0207649_101521661 | 311 |
| 219 | 3300025921 | Ga0207652_10025461 | Ga0207652_100254615 | 311 |
| 220 | 3300026116 | Ga0207674_10033681 | Ga0207674_100336814 | 311 |
| 221 | 3300026142 | Ga0207698_10118278 | Ga0207698_101182782 | 311 |
| 222 | 3300049581 | Ga0501047_0268533 | Ga0501047_0268533_425_1507 | 311 |
| 223 | 3300049583 | Ga0501067_0017294 | Ga0501067_0017294_478_1512 | 311 |
| 224 | 3300049585 | Ga0501069_0013992 | Ga0501069_0013992_472_1506 | 311 |
| 225 | 3300050512 | nmdc:mga0n895_88486_c1 | nmdc:mga0n895_88486_c1_679_1713 | 311 |
| 226 | 3300050513 | nmdc:mga0rr50_46336_c1 | nmdc:mga0rr50_46336_c1_1742_2776 | 311 |
| 227 | 3300050514 | nmdc:mga08x19_5861_c1 | nmdc:mga08x19_5861_c1_4886_5920 | 311 |
| 228 | 3300050515 | nmdc:mga0a205_86634_c1 | nmdc:mga0a205_86634_c1_749_1783 | 311 |
| 229 | 3300053077 | Ga0495601_0079238 | Ga0495601_0079238_318_1325 | 311 |
| 230 | 3300053085 | Ga0495619_0193450 | Ga0495619_0193450_199_1206 | 311 |
| 231 | 3300053111 | Ga0500572_030666 | Ga0500572_030666_359_1435 | 311 |
| 232 | 3300061734 | Ga0530510_0165667 | Ga0530510_0165667_134_1168 | 311 |
| 233 | 3300005329 | Ga0070683_100039278 | Ga0070683_1000392783 | 312 |
| 234 | 3300005336 | Ga0070680_100002170 | Ga0070680_1000021706 | 312 |
| 235 | 3300005458 | Ga0070681_10000389 | Ga0070681_100003896 | 312 |
| 236 | 3300005530 | Ga0070679_100000432 | Ga0070679_10000043235 | 312 |
| 237 | 3300005617 | Ga0068859_100119675 | Ga0068859_1001196753 | 312 |
| 238 | 3300006931 | Ga0097620_100119672 | Ga0097620_1001196723 | 312 |
| 239 | 3300025912 | Ga0207707_10000109 | Ga0207707_100001096 | 312 |
| 240 | 3300025917 | Ga0207660_10001772 | Ga0207660_100017726 | 312 |
| 241 | 3300025921 | Ga0207652_10000248 | Ga0207652_100002486 | 312 |
| 242 | 3300048920 | Ga0496117_0025669 | Ga0496117_0025669_149_1231 | 312 |
| 243 | 3300048921 | Ga0496118_0005040 | Ga0496118_0005040_3377_4459 | 312 |
| 244 | 3300048918 | Ga0496115_0001134 | Ga0496115_0001134_6088_7107 | 313 |
| 245 | 3300049583 | Ga0501067_0000031 | Ga0501067_0000031_86655_87614 | 313 |
| 246 | 3300049584 | Ga0501068_0000010 | Ga0501068_0000010_9643_10602 | 313 |
| 247 | 3300049585 | Ga0501069_0000032 | Ga0501069_0000032_3649_4608 | 313 |
| 248 | 3300061734 | Ga0530510_0010459 | Ga0530510_0010459_1295_2254 | 313 |
| 249 | 3300006846 | Ga0075430_100002429 | Ga0075430_10000242918 | 314 |
| 250 | 3300006846 | Ga0075430_100143414 | Ga0075430_1001434141 | 314 |
| 251 | 3300025901 | Ga0207688_10184900 | Ga0207688_101849002 | 314 |
| 252 | 3300025903 | Ga0207680_10129001 | Ga0207680_101290011 | 314 |
| 253 | 3300026118 | Ga0207675_100083040 | Ga0207675_1000830403 | 314 |
| 254 | 3300035172 | Ga0373955_0166791 | Ga0373955_0166791_212_1249 | 314 |
| 255 | 3300037312 | Ga0395899_0000614 | Ga0395899_0000614_10567_11574 | 314 |
| 256 | 3300048918 | Ga0496115_0360806 | Ga0496115_0360806_120_1160 | 314 |
| 257 | 3300049741 | Ga0501079_0253760 | Ga0501079_0253760_87_1100 | 314 |
| 258 | 3300005337 | Ga0070682_100052056 | Ga0070682_1000520563 | 315 |
| 259 | 3300005338 | Ga0068868_100023214 | Ga0068868_1000232142 | 315 |
| 260 | 3300005338 | Ga0068868_100028653 | Ga0068868_1000286536 | 315 |
| 261 | 3300005341 | Ga0070691_10007083 | Ga0070691_100070833 | 315 |
| 262 | 3300005345 | Ga0070692_10005087 | Ga0070692_100050872 | 315 |
| 263 | 3300005355 | Ga0070671_100046207 | Ga0070671_1000462073 | 315 |
| 264 | 3300005366 | Ga0070659_100116133 | Ga0070659_1001161332 | 315 |
| 265 | 3300005434 | Ga0070709_10175924 | Ga0070709_101759242 | 315 |
| 266 | 3300005437 | Ga0070710_10028698 | Ga0070710_100286982 | 315 |
| 267 | 3300005440 | Ga0070705_100021168 | Ga0070705_1000211684 | 315 |
| 268 | 3300005441 | Ga0070700_100005180 | Ga0070700_1000051807 | 315 |
| 269 | 3300005441 | Ga0070700_100182381 | Ga0070700_1001823812 | 315 |
| 270 | 3300005444 | Ga0070694_100030564 | Ga0070694_1000305643 | 315 |
| 271 | 3300005455 | Ga0070663_100262326 | Ga0070663_1002623261 | 315 |
| 272 | 3300005456 | Ga0070678_100014820 | Ga0070678_1000148204 | 315 |
| 273 | 3300005457 | Ga0070662_100015570 | Ga0070662_1000155706 | 315 |
| 274 | 3300005459 | Ga0068867_100053246 | Ga0068867_1000532462 | 315 |
| 275 | 3300005530 | Ga0070679_100073354 | Ga0070679_1000733542 | 315 |
| 276 | 3300005535 | Ga0070684_100109026 | Ga0070684_1001090262 | 315 |
| 277 | 3300005544 | Ga0070686_100045397 | Ga0070686_1000453973 | 315 |
| 278 | 3300005544 | Ga0070686_100051309 | Ga0070686_1000513093 | 315 |
| 279 | 3300005546 | Ga0070696_100011731 | Ga0070696_1000117317 | 315 |
| 280 | 3300005546 | Ga0070696_100021145 | Ga0070696_1000211453 | 315 |
| 281 | 3300005547 | Ga0070693_100014558 | Ga0070693_1000145583 | 315 |
| 282 | 3300005549 | Ga0070704_100063834 | Ga0070704_1000638343 | 315 |
| 283 | 3300005563 | Ga0068855_100056258 | Ga0068855_1000562583 | 315 |
| 284 | 3300005578 | Ga0068854_100028280 | Ga0068854_1000282803 | 315 |
| 285 | 3300005614 | Ga0068856_100243628 | Ga0068856_1002436281 | 315 |
| 286 | 3300005618 | Ga0068864_100082227 | Ga0068864_1000822272 | 315 |
| 287 | 3300005618 | Ga0068864_100097262 | Ga0068864_1000972622 | 315 |
| 288 | 3300005718 | Ga0068866_10030984 | Ga0068866_100309843 | 315 |
| 289 | 3300005719 | Ga0068861_100041688 | Ga0068861_1000416883 | 315 |
| 290 | 3300005843 | Ga0068860_100257417 | Ga0068860_1002574172 | 315 |
| 291 | 3300006173 | Ga0070716_100103814 | Ga0070716_1001038142 | 315 |
| 292 | 3300006237 | Ga0097621_100046456 | Ga0097621_1000464564 | 315 |
| 293 | 3300006358 | Ga0068871_100040342 | Ga0068871_1000403423 | 315 |
| 294 | 3300006844 | Ga0075428_100114132 | Ga0075428_1001141323 | 315 |
| 295 | 3300006914 | Ga0075436_100114204 | Ga0075436_1001142041 | 315 |
| 296 | 3300007076 | Ga0075435_100019858 | Ga0075435_1000198584 | 315 |
| 297 | 3300009093 | Ga0105240_10418448 | Ga0105240_104184482 | 315 |
| 298 | 3300009098 | Ga0105245_10109325 | Ga0105245_101093252 | 315 |
| 299 | 3300009098 | Ga0105245_10127540 | Ga0105245_101275403 | 315 |
| 300 | 3300009147 | Ga0114129_10200400 | Ga0114129_102004002 | 315 |
| 301 | 3300009148 | Ga0105243_10008961 | Ga0105243_100089616 | 315 |
| 302 | 3300009174 | Ga0105241_10241227 | Ga0105241_102412272 | 315 |
| 303 | 3300009176 | Ga0105242_10062841 | Ga0105242_100628413 | 315 |
| 304 | 3300009177 | Ga0105248_10110073 | Ga0105248_101100733 | 315 |
| 305 | 3300009177 | Ga0105248_10134337 | Ga0105248_101343372 | 315 |
| 306 | 3300009551 | Ga0105238_10387089 | Ga0105238_103870892 | 315 |
| 307 | 3300009553 | Ga0105249_10060351 | Ga0105249_100603512 | 315 |
| 308 | 3300010375 | Ga0105239_10063124 | Ga0105239_100631242 | 315 |
| 309 | 3300010375 | Ga0105239_10113310 | Ga0105239_101133102 | 315 |
| 310 | 3300013100 | Ga0157373_10107256 | Ga0157373_101072562 | 315 |
| 311 | 3300013297 | Ga0157378_10028732 | Ga0157378_100287324 | 315 |
| 312 | 3300013306 | Ga0163162_10363552 | Ga0163162_103635522 | 315 |
| 313 | 3300013308 | Ga0157375_10014719 | Ga0157375_100147197 | 315 |
| 314 | 3300013308 | Ga0157375_10103294 | Ga0157375_101032943 | 315 |
| 315 | 3300014326 | Ga0157380_10027943 | Ga0157380_100279433 | 315 |
| 316 | 3300014745 | Ga0157377_10224521 | Ga0157377_102245212 | 315 |
| 317 | 3300014968 | Ga0157379_10211601 | Ga0157379_102116012 | 315 |
| 318 | 3300014969 | Ga0157376_10005763 | Ga0157376_100057633 | 315 |
| 319 | 3300025885 | Ga0207653_10018292 | Ga0207653_100182922 | 315 |
| 320 | 3300025907 | Ga0207645_10050880 | Ga0207645_100508803 | 315 |
| 321 | 3300025915 | Ga0207693_10309857 | Ga0207693_103098571 | 315 |
| 322 | 3300025916 | Ga0207663_10173341 | Ga0207663_101733412 | 315 |
| 323 | 3300025919 | Ga0207657_10013373 | Ga0207657_100133738 | 315 |
| 324 | 3300025931 | Ga0207644_10160417 | Ga0207644_101604172 | 315 |
| 325 | 3300025932 | Ga0207690_10075595 | Ga0207690_100755952 | 315 |
| 326 | 3300025933 | Ga0207706_10006396 | Ga0207706_100063966 | 315 |
| 327 | 3300025934 | Ga0207686_10050979 | Ga0207686_100509792 | 315 |
| 328 | 3300025939 | Ga0207665_10003605 | Ga0207665_100036056 | 315 |
| 329 | 3300025940 | Ga0207691_10083617 | Ga0207691_100836172 | 315 |
| 330 | 3300025944 | Ga0207661_10096635 | Ga0207661_100966352 | 315 |
| 331 | 3300025949 | Ga0207667_10115465 | Ga0207667_101154651 | 315 |
| 332 | 3300025949 | Ga0207667_10116708 | Ga0207667_101167082 | 315 |
| 333 | 3300025961 | Ga0207712_10216493 | Ga0207712_102164932 | 315 |
| 334 | 3300025981 | Ga0207640_10061687 | Ga0207640_100616872 | 315 |
| 335 | 3300026067 | Ga0207678_10045634 | Ga0207678_100456343 | 315 |
| 336 | 3300026078 | Ga0207702_10020480 | Ga0207702_100204801 | 315 |
| 337 | 3300026078 | Ga0207702_10128485 | Ga0207702_101284853 | 315 |
| 338 | 3300026095 | Ga0207676_10223721 | Ga0207676_102237212 | 315 |
| 339 | 3300026118 | Ga0207675_100017588 | Ga0207675_1000175886 | 315 |
| 340 | 3300026118 | Ga0207675_100037798 | Ga0207675_1000377984 | 315 |
| 341 | 3300026121 | Ga0207683_10004132 | Ga0207683_1000413211 | 315 |
| 342 | 3300026121 | Ga0207683_10056920 | Ga0207683_100569204 | 315 |
| 343 | 3300027717 | Ga0209998_10011918 | Ga0209998_100119182 | 315 |
| 344 | 3300027907 | Ga0207428_10064950 | Ga0207428_100649501 | 315 |
| 345 | 3300032002 | Ga0307416_100055068 | Ga0307416_1000550685 | 315 |
| 346 | 3300035084 | Ga0373928_0035301 | Ga0373928_0035301_50_1030 | 315 |
| 347 | 3300035089 | Ga0373944_0048942 | Ga0373944_0048942_17_997 | 315 |
| 348 | 3300035091 | Ga0373951_0008911 | Ga0373951_0008911_438_1418 | 315 |
| 349 | 3300035116 | Ga0373945_0009448 | Ga0373945_0009448_2000_2980 | 315 |
| 350 | 3300035171 | Ga0373946_0017246 | Ga0373946_0017246_1212_2192 | 315 |
| 351 | 3300035241 | Ga0373961_0071088 | Ga0373961_0071088_61_1041 | 315 |
| 352 | 3300035695 | Ga0373927_0085845 | Ga0373927_0085845_279_1259 | 315 |
| 353 | 3300035725 | Ga0373947_0007670 | Ga0373947_0007670_3740_4720 | 315 |
| 354 | 3300037466 | Ga0395898_0008093 | Ga0395898_0008093_9487_10470 | 315 |
| 355 | 3300037471 | Ga0395905_0003094 | Ga0395905_0003094_14674_15657 | 315 |
| 356 | 3300038443 | Ga0395901_0001542 | Ga0395901_0001542_8463_9446 | 315 |
| 357 | 3300038443 | Ga0395901_0131053 | Ga0395901_0131053_375_1394 | 315 |
| 358 | 3300041486 | Ga0451807_0826841 | Ga0451807_0826841_11_985 | 315 |
| 359 | 3300041512 | Ga0451853_1409041 | Ga0451853_1409041_294_1274 | 315 |
| 360 | 3300042005 | Ga0439448_0017142 | Ga0439448_0017142_931_1911 | 315 |
| 361 | 3300042438 | Ga0439459_0022340 | Ga0439459_0022340_160_1140 | 315 |
| 362 | 3300044694 | Ga0466963_0002778 | Ga0466963_0002778_22_1056 | 315 |
| 363 | 3300044901 | Ga0466960_0066433 | Ga0466960_0066433_723_1757 | 315 |
| 364 | 3300044901 | Ga0466960_0108778 | Ga0466960_0108778_267_1280 | 315 |
| 365 | 3300045976 | Ga0466967_0004040 | Ga0466967_0004040_112_1146 | 315 |
| 366 | 3300045976 | Ga0466967_0024629 | Ga0466967_0024629_2233_3267 | 315 |
| 367 | 3300046455 | Ga0495603_0000065 | Ga0495603_0000065_31262_32242 | 315 |
| 368 | 3300046461 | Ga0495641_0006525 | Ga0495641_0006525_6073_7053 | 315 |
| 369 | 3300046472 | Ga0495580_0032597 | Ga0495580_0032597_753_1733 | 315 |
| 370 | 3300046473 | Ga0495582_0005435 | Ga0495582_0005435_354_1334 | 315 |
| 371 | 3300046499 | Ga0495594_0005133 | Ga0495594_0005133_5295_6326 | 315 |
| 372 | 3300046499 | Ga0495594_0006993 | Ga0495594_0006993_2679_3659 | 315 |
| 373 | 3300047321 | Ga0495676_0000444 | Ga0495676_0000444_27297_28277 | 315 |
| 374 | 3300048903 | Ga0496100_0019691 | Ga0496100_0019691_2349_3332 | 315 |
| 375 | 3300048903 | Ga0496100_0111672 | Ga0496100_0111672_51_1031 | 315 |
| 376 | 3300048903 | Ga0496100_0220841 | Ga0496100_0220841_96_1076 | 315 |
| 377 | 3300048904 | Ga0496101_0059585 | Ga0496101_0059585_701_1684 | 315 |
| 378 | 3300048904 | Ga0496101_0101867 | Ga0496101_0101867_797_1777 | 315 |
| 379 | 3300048905 | Ga0496102_0023310 | Ga0496102_0023310_4480_5460 | 315 |
| 380 | 3300048905 | Ga0496102_0047737 | Ga0496102_0047737_694_1674 | 315 |
| 381 | 3300048905 | Ga0496102_0125159 | Ga0496102_0125159_832_1815 | 315 |
| 382 | 3300048906 | Ga0496103_0044000 | Ga0496103_0044000_936_1916 | 315 |
| 383 | 3300048907 | Ga0496104_0005379 | Ga0496104_0005379_4493_5476 | 315 |
| 384 | 3300048907 | Ga0496104_0014887 | Ga0496104_0014887_812_1792 | 315 |
| 385 | 3300048908 | Ga0496105_0008415 | Ga0496105_0008415_4993_5976 | 315 |
| 386 | 3300048908 | Ga0496105_0014471 | Ga0496105_0014471_142_1122 | 315 |
| 387 | 3300048909 | Ga0496106_0006195 | Ga0496106_0006195_5259_6242 | 315 |
| 388 | 3300048909 | Ga0496106_0123354 | Ga0496106_0123354_332_1312 | 315 |
| 389 | 3300048910 | Ga0496107_0077461 | Ga0496107_0077461_1340_2320 | 315 |
| 390 | 3300048910 | Ga0496107_0180676 | Ga0496107_0180676_36_1016 | 315 |
| 391 | 3300048911 | Ga0496108_0000632 | Ga0496108_0000632_17119_18102 | 315 |
| 392 | 3300048911 | Ga0496108_0009048 | Ga0496108_0009048_5193_6173 | 315 |
| 393 | 3300048912 | Ga0496109_0003540 | Ga0496109_0003540_7689_8669 | 315 |
| 394 | 3300048912 | Ga0496109_0041443 | Ga0496109_0041443_2871_3854 | 315 |
| 395 | 3300048913 | Ga0496110_0015250 | Ga0496110_0015250_5129_6109 | 315 |
| 396 | 3300048913 | Ga0496110_0135835 | Ga0496110_0135835_133_1113 | 315 |
| 397 | 3300048914 | Ga0496111_0000319 | Ga0496111_0000319_17711_18691 | 315 |
| 398 | 3300048914 | Ga0496111_0014498 | Ga0496111_0014498_2360_3343 | 315 |
| 399 | 3300048915 | Ga0496112_0042483 | Ga0496112_0042483_2551_3534 | 315 |
| 400 | 3300048915 | Ga0496112_0049387 | Ga0496112_0049387_1817_2797 | 315 |
| 401 | 3300048915 | Ga0496112_0408811 | Ga0496112_0408811_54_1049 | 315 |
| 402 | 3300048916 | Ga0496113_0001938 | Ga0496113_0001938_5755_6735 | 315 |
| 403 | 3300048917 | Ga0496114_0039612 | Ga0496114_0039612_534_1517 | 315 |
| 404 | 3300048917 | Ga0496114_0101409 | Ga0496114_0101409_340_1320 | 315 |
| 405 | 3300048918 | Ga0496115_0208708 | Ga0496115_0208708_42_1022 | 315 |
| 406 | 3300050511 | nmdc:mga08y16_495077_c1 | nmdc:mga08y16_495077_c1_27_1007 | 315 |
| 407 | 3300050512 | nmdc:mga0n895_131020_c1 | nmdc:mga0n895_131020_c1_1028_2008 | 315 |
| 408 | 3300050513 | nmdc:mga0rr50_300509_c1 | nmdc:mga0rr50_300509_c1_177_1157 | 315 |
| 409 | 3300050514 | nmdc:mga08x19_100039_c1 | nmdc:mga08x19_100039_c1_874_1854 | 315 |
| 410 | 3300050514 | nmdc:mga08x19_62918_c1 | nmdc:mga08x19_62918_c1_26_1006 | 315 |
| 411 | 3300005347 | Ga0070668_100173074 | Ga0070668_1001730742 | 316 |
| 412 | 3300005367 | Ga0070667_100009366 | Ga0070667_1000093662 | 316 |
| 413 | 3300005436 | Ga0070713_100236245 | Ga0070713_1002362451 | 316 |
| 414 | 3300005530 | Ga0070679_100001364 | Ga0070679_10000136417 | 316 |
| 415 | 3300005548 | Ga0070665_100171449 | Ga0070665_1001714492 | 316 |
| 416 | 3300005843 | Ga0068860_100197881 | Ga0068860_1001978812 | 316 |
| 417 | 3300005844 | Ga0068862_100000510 | Ga0068862_10000051020 | 316 |
| 418 | 3300009553 | Ga0105249_10007467 | Ga0105249_1000746711 | 316 |
| 419 | 3300014968 | Ga0157379_10150641 | Ga0157379_101506412 | 316 |
| 420 | 3300025921 | Ga0207652_10000900 | Ga0207652_100009008 | 316 |
| 421 | 3300025986 | Ga0207658_10024480 | Ga0207658_100244802 | 316 |
| 422 | 3300026067 | Ga0207678_10005158 | Ga0207678_100051588 | 316 |
| 423 | 3300028380 | Ga0268265_10009761 | Ga0268265_100097612 | 316 |
| 424 | 3300046683 | Ga0495658_0029271 | Ga0495658_0029271_1949_2935 | 316 |
| 425 | 3300049568 | Ga0501031_0000058 | Ga0501031_0000058_57854_58942 | 316 |
| 426 | 3300049569 | Ga0501032_0002722 | Ga0501032_0002722_297_1385 | 316 |
| 427 | 3300049570 | Ga0501033_0015135 | Ga0501033_0015135_304_1392 | 316 |
| 428 | 3300049571 | Ga0501034_0017696 | Ga0501034_0017696_309_1397 | 316 |
| 429 | 3300049573 | Ga0501037_0002322 | Ga0501037_0002322_290_1378 | 316 |
| 430 | 3300049574 | Ga0501038_0000485 | Ga0501038_0000485_33564_34652 | 316 |
| 431 | 3300049575 | Ga0501039_0091953 | Ga0501039_0091953_698_1786 | 316 |
| 432 | 3300049578 | Ga0501042_0050607 | Ga0501042_0050607_1594_2682 | 316 |
| 433 | 3300049579 | Ga0501043_0002786 | Ga0501043_0002786_13208_14296 | 316 |
| 434 | 3300049580 | Ga0501046_0003436 | Ga0501046_0003436_183_1271 | 316 |
| 435 | 3300049581 | Ga0501047_0000647 | Ga0501047_0000647_301_1389 | 316 |
| 436 | 3300049581 | Ga0501047_0050484 | Ga0501047_0050484_136_1149 | 316 |
| 437 | 3300049582 | Ga0501048_0002614 | Ga0501048_0002614_309_1397 | 316 |
| 438 | 3300049584 | Ga0501068_0099840 | Ga0501068_0099840_695_1783 | 316 |
| 439 | 3300049586 | Ga0501070_0000309 | Ga0501070_0000309_309_1397 | 316 |
| 440 | 3300049588 | Ga0501072_0194301 | Ga0501072_0194301_426_1514 | 316 |
| 441 | 3300049589 | Ga0501073_0109804 | Ga0501073_0109804_193_1281 | 316 |
| 442 | 3300049741 | Ga0501079_0034967 | Ga0501079_0034967_310_1398 | 316 |
| 443 | 3300049742 | Ga0501080_0228964 | Ga0501080_0228964_475_1563 | 316 |
| 444 | 3300049822 | Ga0501035_0020800 | Ga0501035_0020800_4336_5424 | 316 |
| 445 | 3300049823 | Ga0501044_0001651 | Ga0501044_0001651_329_1417 | 316 |
| 446 | 3300060353 | Ga0501082_0013634 | Ga0501082_0013634_5626_6714 | 316 |
| 447 | 3300025941 | Ga0207711_10075258 | Ga0207711_100752583 | 317 |
| 448 | 3300045049 | Ga0466959_0143353 | Ga0466959_0143353_26_1072 | 317 |
| 449 | 3300009177 | Ga0105248_10095780 | Ga0105248_100957803 | 318 |
| 450 | 3300041456 | Ga0451795_1063198 | Ga0451795_1063198_2019_3008 | 318 |
| 451 | 3300041458 | Ga0451798_0138267 | Ga0451798_0138267_391_1380 | 318 |
| 452 | 3300041459 | Ga0451800_0933833 | Ga0451800_0933833_1318_2307 | 318 |
| 453 | 3300041460 | Ga0451802_0241505 | Ga0451802_0241505_2631_3620 | 318 |
| 454 | 3300041463 | Ga0451804_0599873 | Ga0451804_0599873_757_1746 | 318 |
| 455 | 3300041496 | Ga0451839_1417283 | Ga0451839_1417283_968_1957 | 318 |
| 456 | 3300041498 | Ga0451841_1173131 | Ga0451841_1173131_1378_2367 | 318 |
| 457 | 3300041501 | Ga0451845_0312446 | Ga0451845_0312446_1258_2247 | 318 |
| 458 | 3300041505 | Ga0451849_1446404 | Ga0451849_1446404_1965_2954 | 318 |
| 459 | 3300041507 | Ga0451851_0670690 | Ga0451851_0670690_3593_4582 | 318 |
| 460 | 3300041511 | Ga0451855_0466827 | Ga0451855_0466827_917_1906 | 318 |
| 461 | 3300049571 | Ga0501034_0269645 | Ga0501034_0269645_158_1240 | 318 |
| 462 | 3300005530 | Ga0070679_100342170 | Ga0070679_1003421702 | 319 |
| 463 | 3300005535 | Ga0070684_100034944 | Ga0070684_1000349444 | 319 |
| 464 | 3300009093 | Ga0105240_10012405 | Ga0105240_1001240511 | 319 |
| 465 | 3300013100 | Ga0157373_10153164 | Ga0157373_101531641 | 319 |
| 466 | 3300013307 | Ga0157372_10384278 | Ga0157372_103842782 | 319 |
| 467 | 3300025912 | Ga0207707_10240268 | Ga0207707_102402682 | 319 |
| 468 | 3300025913 | Ga0207695_10013638 | Ga0207695_100136382 | 319 |
| 469 | 3300046463 | Ga0495653_0160342 | Ga0495653_0160342_233_1228 | 319 |
| 470 | 3300046511 | Ga0495608_0042395 | Ga0495608_0042395_109_1104 | 319 |
| 471 | 3300046536 | Ga0495587_0021592 | Ga0495587_0021592_1220_2215 | 319 |
| 472 | 3300046543 | Ga0495645_0163728 | Ga0495645_0163728_284_1279 | 319 |
| 473 | 3300046678 | Ga0495599_0028906 | Ga0495599_0028906_2106_3101 | 319 |
| 474 | 3300047471 | Ga0495684_0044420 | Ga0495684_0044420_321_1316 | 319 |
| 475 | 3300053084 | Ga0495595_0088039 | Ga0495595_0088039_402_1397 | 319 |
| 476 | 3300005436 | Ga0070713_100070322 | Ga0070713_1000703223 | 320 |
| 477 | 3300006028 | Ga0070717_10060400 | Ga0070717_100604002 | 320 |
| 478 | 3300025929 | Ga0207664_10100558 | Ga0207664_101005584 | 320 |
| 479 | 3300028800 | Ga0265338_10026055 | Ga0265338_100260555 | 320 |
| 480 | 3300046477 | Ga0495664_0000007 | Ga0495664_0000007_359233_360261 | 320 |
| 481 | iso_pu_bacteria | 2643221641 | 2644229713 | 320 |
| 482 | 3300005435 | Ga0070714_100211772 | Ga0070714_1002117721 | 321 |
| 483 | 3300005842 | Ga0068858_100066785 | Ga0068858_1000667852 | 322 |
| 484 | 3300006881 | Ga0068865_100077167 | Ga0068865_1000771673 | 322 |
| 485 | 3300009553 | Ga0105249_10351355 | Ga0105249_103513551 | 322 |
| 486 | 3300025961 | Ga0207712_10104357 | Ga0207712_101043572 | 322 |
| 487 | 3300026023 | Ga0207677_10163002 | Ga0207677_101630021 | 322 |
| 488 | 3300026035 | Ga0207703_10039091 | Ga0207703_100390914 | 322 |
| 489 | 3300026116 | Ga0207674_10076069 | Ga0207674_100760693 | 322 |
| 490 | 3300048912 | Ga0496109_0182112 | Ga0496109_0182112_790_1833 | 322 |
| 491 | 3300048913 | Ga0496110_0009847 | Ga0496110_0009847_4027_5166 | 322 |
| 492 | 3300048914 | Ga0496111_0006910 | Ga0496111_0006910_5588_6727 | 322 |
| 493 | 3300048914 | Ga0496111_0025487 | Ga0496111_0025487_1513_2556 | 322 |
| 494 | 3300048915 | Ga0496112_0021172 | Ga0496112_0021172_5089_6132 | 322 |
| 495 | 3300048917 | Ga0496114_0112164 | Ga0496114_0112164_870_2009 | 322 |
| 496 | 3300005343 | Ga0070687_100061509 | Ga0070687_1000615092 | 323 |
| 497 | 3300005459 | Ga0068867_100015132 | Ga0068867_1000151325 | 323 |
| 498 | 3300005718 | Ga0068866_10002851 | Ga0068866_100028511 | 323 |
| 499 | 3300005844 | Ga0068862_100031590 | Ga0068862_1000315904 | 323 |
| 500 | 3300006028 | Ga0070717_10297670 | Ga0070717_102976702 | 323 |
| 501 | 3300009148 | Ga0105243_10019768 | Ga0105243_100197684 | 323 |
| 502 | 3300009177 | Ga0105248_10059254 | Ga0105248_100592544 | 323 |
| 503 | 3300013297 | Ga0157378_10007242 | Ga0157378_100072421 | 323 |
| 504 | 3300014326 | Ga0157380_10225162 | Ga0157380_102251622 | 323 |
| 505 | 3300025918 | Ga0207662_10031709 | Ga0207662_100317094 | 323 |
| 506 | 3300025935 | Ga0207709_10031650 | Ga0207709_100316504 | 323 |
| 507 | 3300025936 | Ga0207670_10147339 | Ga0207670_101473392 | 323 |
| 508 | 3300025941 | Ga0207711_10053203 | Ga0207711_100532035 | 323 |
| 509 | 3300026089 | Ga0207648_10027472 | Ga0207648_100274725 | 323 |
| 510 | 3300048903 | Ga0496100_0326809 | Ga0496100_0326809_82_1140 | 323 |
| 511 | 3300048905 | Ga0496102_0508472 | Ga0496102_0508472_50_1108 | 323 |
| 512 | 3300048907 | Ga0496104_0113418 | Ga0496104_0113418_164_1222 | 323 |
| 513 | 3300048908 | Ga0496105_0043926 | Ga0496105_0043926_536_1594 | 323 |
| 514 | 3300048909 | Ga0496106_0093541 | Ga0496106_0093541_289_1347 | 323 |
| 515 | 3300048910 | Ga0496107_0053818 | Ga0496107_0053818_914_1972 | 323 |
| 516 | 3300048911 | Ga0496108_0065740 | Ga0496108_0065740_1683_2831 | 323 |
| 517 | 3300048912 | Ga0496109_0174082 | Ga0496109_0174082_833_1891 | 323 |
| 518 | 3300048913 | Ga0496110_0050894 | Ga0496110_0050894_643_1701 | 323 |
| 519 | 3300048914 | Ga0496111_0038057 | Ga0496111_0038057_374_1432 | 323 |
| 520 | 3300048917 | Ga0496114_0031553 | Ga0496114_0031553_2806_3864 | 323 |
| 521 | 3300006880 | Ga0075429_100259703 | Ga0075429_1002597032 | 324 |
| 522 | 3300009098 | Ga0105245_10036032 | Ga0105245_100360323 | 324 |
| 523 | 3300013296 | Ga0157374_10437009 | Ga0157374_104370091 | 324 |
| 524 | 3300013308 | Ga0157375_10007894 | Ga0157375_100078948 | 324 |
| 525 | 3300014325 | Ga0163163_10514900 | Ga0163163_105149001 | 324 |
| 526 | 3300048905 | Ga0496102_0524115 | Ga0496102_0524115_13_1074 | 324 |
| 527 | 3300048913 | Ga0496110_0052536 | Ga0496110_0052536_34_1095 | 324 |
| 528 | 3300048915 | Ga0496112_0400164 | Ga0496112_0400164_253_1284 | 324 |
| 529 | 3300048917 | Ga0496114_0037283 | Ga0496114_0037283_1641_2702 | 324 |
| 530 | 3300014325 | Ga0163163_10048708 | Ga0163163_100487083 | 325 |
| 531 | 3300028563 | Ga0265319_1040462 | Ga0265319_10404622 | 325 |
| 532 | 3300028573 | Ga0265334_10002240 | Ga0265334_100022408 | 325 |
| 533 | 3300028800 | Ga0265338_10152283 | Ga0265338_101522832 | 325 |
| 534 | 3300031238 | Ga0265332_10012597 | Ga0265332_100125973 | 325 |
| 535 | 3300031241 | Ga0265325_10015611 | Ga0265325_100156115 | 325 |
| 536 | 3300031247 | Ga0265340_10004670 | Ga0265340_100046708 | 325 |
| 537 | 3300031249 | Ga0265339_10108802 | Ga0265339_101088021 | 325 |
| 538 | 3300031344 | Ga0265316_10021507 | Ga0265316_100215072 | 325 |
| 539 | 3300005983 | Ga0081540_1009141 | Ga0081540_10091417 | 326 |
| 540 | 3300009148 | Ga0105243_10252719 | Ga0105243_102527192 | 326 |
| 541 | 3300014497 | Ga0182008_10025657 | Ga0182008_100256572 | 326 |
| 542 | 3300025927 | Ga0207687_10188322 | Ga0207687_101883221 | 326 |
| 543 | 3300048911 | Ga0496108_0164281 | Ga0496108_0164281_808_1869 | 326 |
| 544 | iso_pu_bacteria | 2856741275 | 2856742721 | 326 |
| 545 | iso_pu_bacteria | 2891395885 | 2891404220 | 326 |
| 546 | iso_pu_bacteria | 2891554331 | 2891562045 | 326 |
| 547 | iso_pu_bacteria | 2891562705 | 2891565002 | 326 |
| 548 | 3300009177 | Ga0105248_10015966 | Ga0105248_100159665 | 327 |
| 549 | 3300009545 | Ga0105237_10415289 | Ga0105237_104152891 | 327 |
| 550 | 3300014325 | Ga0163163_10011817 | Ga0163163_100118175 | 327 |
| 551 | 3300014968 | Ga0157379_10122190 | Ga0157379_101221903 | 327 |
| 552 | 3300048907 | Ga0496104_0092404 | Ga0496104_0092404_1713_2732 | 327 |
| 553 | 3300048908 | Ga0496105_0026893 | Ga0496105_0026893_3371_4390 | 327 |
| 554 | 3300048914 | Ga0496111_0005473 | Ga0496111_0005473_763_1782 | 327 |
| 555 | 3300048918 | Ga0496115_0140350 | Ga0496115_0140350_16_1035 | 327 |
| 556 | 3300005548 | Ga0070665_100149968 | Ga0070665_1001499681 | 328 |
| 557 | 3300005618 | Ga0068864_100058454 | Ga0068864_1000584543 | 328 |
| 558 | 3300005937 | Ga0081455_10038446 | Ga0081455_100384464 | 328 |
| 559 | 3300009094 | Ga0111539_10111312 | Ga0111539_101113122 | 328 |
| 560 | 3300050507 | nmdc:mga05p37_319075_c1 | nmdc:mga05p37_319075_c1_147_1181 | 328 |
| 561 | 3300050508 | nmdc:mga09592_63716_c1 | nmdc:mga09592_63716_c1_1895_2932 | 328 |
| 562 | 3300025928 | Ga0207700_10229960 | Ga0207700_102299602 | 329 |
| 563 | 3300025941 | Ga0207711_10098258 | Ga0207711_100982582 | 329 |
| 564 | 3300006844 | Ga0075428_100018030 | Ga0075428_1000180308 | 330 |
| 565 | 3300009551 | Ga0105238_10287409 | Ga0105238_102874092 | 330 |
| 566 | 3300025921 | Ga0207652_10063390 | Ga0207652_100633902 | 330 |
| 567 | 3300005535 | Ga0070684_100250706 | Ga0070684_1002507062 | 331 |
| 568 | 3300014968 | Ga0157379_10027267 | Ga0157379_100272676 | 331 |
| 569 | 3300044684 | Ga0466966_0005854 | Ga0466966_0005854_586_1662 | 332 |
| 570 | 3300044693 | Ga0466961_0009629 | Ga0466961_0009629_1005_2081 | 332 |
| 571 | 3300046680 | Ga0495646_0012695 | Ga0495646_0012695_834_1871 | 332 |
| 572 | 3300053077 | Ga0495601_0004984 | Ga0495601_0004984_5680_6708 | 332 |
| 573 | 3300061719 | Ga0466962_0032772 | Ga0466962_0032772_586_1662 | 332 |
| 574 | 3300005329 | Ga0070683_100015581 | Ga0070683_1000155815 | 333 |
| 575 | 3300005337 | Ga0070682_100080812 | Ga0070682_1000808122 | 333 |
| 576 | 3300005530 | Ga0070679_100186674 | Ga0070679_1001866742 | 333 |
| 577 | 3300005535 | Ga0070684_100047128 | Ga0070684_1000471282 | 333 |
| 578 | 3300025909 | Ga0207705_10166810 | Ga0207705_101668101 | 333 |
| 579 | 3300025921 | Ga0207652_10004169 | Ga0207652_100041699 | 333 |
| 580 | 3300025944 | Ga0207661_10001916 | Ga0207661_100019164 | 333 |
| 581 | 3300028563 | Ga0265319_1014850 | Ga0265319_10148502 | 333 |
| 582 | 3300028577 | Ga0265318_10010527 | Ga0265318_100105272 | 333 |
| 583 | 3300005366 | Ga0070659_100241529 | Ga0070659_1002415291 | 334 |
| 584 | 3300009098 | Ga0105245_10025810 | Ga0105245_100258103 | 336 |
| 585 | 3300009148 | Ga0105243_10039302 | Ga0105243_100393022 | 336 |
| 586 | 3300009176 | Ga0105242_10222032 | Ga0105242_102220322 | 336 |
| 587 | 3300009177 | Ga0105248_10083536 | Ga0105248_100835363 | 336 |
| 588 | 3300011119 | Ga0105246_10186550 | Ga0105246_101865501 | 336 |
| 589 | 3300025927 | Ga0207687_10036898 | Ga0207687_100368981 | 336 |
| 590 | 3300025934 | Ga0207686_10107130 | Ga0207686_101071302 | 336 |
| 591 | 3300048913 | Ga0496110_0294870 | Ga0496110_0294870_178_1239 | 336 |
| 592 | 3300005329 | Ga0070683_100003225 | Ga0070683_10000322512 | 338 |
| 593 | 3300005535 | Ga0070684_100021769 | Ga0070684_1000217693 | 338 |
| 594 | 3300005564 | Ga0070664_100005588 | Ga0070664_1000055883 | 338 |
| 595 | 3300005577 | Ga0068857_100060610 | Ga0068857_1000606102 | 338 |
| 596 | 3300025945 | Ga0207679_10003163 | Ga0207679_100031638 | 338 |
| 597 | 3300026116 | Ga0207674_10080449 | Ga0207674_100804493 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ddn-assembly2.cif.gz_B | the sulfate-binding protein subi from mycobacterium tuberculosis h37rv | 0.9685 | 35 | 316 |
| 1sbp-assembly1.cif.gz_A | 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding | 0.9496 | 35 | 326 |
| 6ddn-assembly2.cif.gz_B | the sulfate-binding protein subi from mycobacterium tuberculosis h37rv | 0.9486 | 35 | 316 |
| 5um2-assembly1.cif.gz_A | functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri | 0.9412 | 35 | 327 |
| 1sbp-assembly1.cif.gz_A | 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding | 0.8959 | 35 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71744_144_341_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9657 | 123 | 316 | 3.40.190.10 |
| 6ddnB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9558 | 123 | 316 | 3.40.190.10 |
| 6ddnB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9494 | 123 | 316 | 3.40.190.10 |
| af_P71744_144_341_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9417 | 123 | 316 | 3.40.190.10 |
| af_Q2FVX4_42_108_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9414 | 37 | 103 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C4J6M7-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.9968 | 35 | 335 |
GO:0042597
GO:1902358 |
| AF-A0A4R4XS67-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.9901 | 28 | 335 |
GO:0042597
GO:1902358 |
| AF-A0A5C4J6M7-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.9869 | 35 | 335 |
GO:0042597
GO:1902358 |
| AF-A0A4R4XS67-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.9837 | 28 | 335 |
GO:0042597
GO:1902358 |
| AF-K6W9W5-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.9777 | 33 | 114 |
GO:0016020
GO:0042597 GO:1902358 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar