F467680

General Info

Members Datasets Scaffolds Average Seq Length
597 448 1194 129

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100190771|Ga0307409_1001907712
Length 152
Sequence MNEDRPAADMLPSDAAAPVSDPWDFDKTPEPLGPNATQATPVPGSALSAEEIERLSHQLVGALKTVYDPEIPADIYELGLIYKIDVDDDRNVEIDMTLTAPGCPVAGEMPGWVENAVGAVEGVGQVKVNLVFDPPWTVDRMSDEAKLALNMF

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
102 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
103 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
168 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
180 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
181 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
182 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
183 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
184 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
185 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
186 2512875024
187 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
188 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
189 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
190 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
191 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
192 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
193 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
194 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
195 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
196 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
197 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
198 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
199 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
200 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
201 2738543024 Aminobacter sp. AP02 Isolate Unclassified
202 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
203 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
204 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
205 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
206 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
207 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
208 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
209 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
210 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
211 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
212 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
213 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
214 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
215 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
216 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
217 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
218 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
219 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
220 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
221 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
222 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
223 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
224 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
225 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
226 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
227 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
228 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
229 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
230 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
231 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
232 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
233 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
234 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
235 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
236 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
237 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
238 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
239 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
240 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
241 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
242 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
243 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
244 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
245 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
246 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
247 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
248 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
249 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
250 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
251 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
252 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
253 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
254 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
255 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
256 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
257 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
258 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
259 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
260 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
261 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
262 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
263 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
264 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
265 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
266 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
267 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
268 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
269 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
270 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
271 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
272 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
273 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
274 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
275 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
276 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
277 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
278 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
279 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
280 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
281 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
282 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
283 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
284 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
285 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
286 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
287 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
288 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
289 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
290 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
291 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
292 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
293 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
294 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
295 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
296 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
297 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
298 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
299 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
300 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
301 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
302 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
303 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
304 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
305 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
306 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
307 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
308 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
309 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
310 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
311 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
312 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
313 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
314 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
315 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
316 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
317 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
318 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
319 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
320 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
321 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
322 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
323 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
324 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
325 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
326 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
327 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
328 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
329 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
330 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
331 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
332 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
333 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
334 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
335 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
336 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
337 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
338 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
339 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
340 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
341 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
342 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
343 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
344 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
345 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
346 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
347 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
348 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
349 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
350 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
351 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
352 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
353 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
354 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
355 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
356 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
357 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
358 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
359 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
360 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
361 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
362 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
363 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
364 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
365 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
366 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
367 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
368 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
369 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
370 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
371 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
372 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
373 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
374 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
375 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
376 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
377 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
378 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
379 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
380 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
381 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
382 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
383 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
384 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
385 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
386 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
387 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
388 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
389 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
390 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
391 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
392 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
393 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
394 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
395 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
396 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
397 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
398 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
399 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
400 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
401 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
402 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
403 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
404 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
405 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
406 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
407 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
408 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
409 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
410 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
411 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
412 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
413 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
414 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
415 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
416 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
417 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
418 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
419 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
420 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
421 3004167301 Mesorhizobium loti 582 Isolate Unclassified
422 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
423 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
424 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
425 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
426 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
427 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
428 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
429 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
430 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
431 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
432 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
433 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
434 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
435 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
436 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
437 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
438 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
439 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
440 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
441 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
442 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
443 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
444 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
445 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
446 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
447 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
448 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.27
Metatranscriptomes 1.34
Isolates 45.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.04
Nodule 38.86
Rhizoplane 1.84
Rhizosphere 43.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100190771 3300031995 Bacteria 1824
2 JGI24740J21852_10006526 3300001979 Bacteria 4821
3 JGI24739J22299_10069583 3300001989 Bacteria 1097
4 JGI24738J21930_10095540 3300002075 Bacteria 631
5 JGI25156J39149_1005879 3300002705 Bacteria 3454
6 JGI25154J39366_1024227 3300002738 Bacteria 558
7 JGI25157J39369_1000310 3300002741 Bacteria 35193
8 JGI25404J52841_10050821 3300003659 Bacteria 871
9 Ga0055542_1001387 3300003762 Bacteria 12276
10 Ga0055524_1006400 3300003775 Bacteria 5109
11 Ga0058692_1017684 3300003856 Bacteria 1559
12 Ga0065715_10434495 3300005293 Bacteria 843
13 Ga0070658_10546218 3300005327 Bacteria 1002
14 Ga0070666_10842087 3300005335 Bacteria 677
15 Ga0070663_100552684 3300005455 Bacteria 962
16 Ga0070663_100738329 3300005455 Bacteria 840
17 Ga0070663_102130129 3300005455 Bacteria 506
18 Ga0068867_100617183 3300005459 Bacteria 948
19 Ga0068853_100129311 3300005539 Bacteria 2259
20 Ga0068853_100170361 3300005539 Bacteria 1969
21 Ga0068853_100215029 3300005539 Bacteria 1753
22 Ga0070696_100081640 3300005546 Bacteria 2291
23 Ga0070665_100118741 3300005548 Bacteria 2647
24 Ga0070665_101429509 3300005548 Bacteria 700
25 Ga0068855_100344518 3300005563 Bacteria 1642
26 Ga0068855_100915217 3300005563 Bacteria 926
27 Ga0068855_102249088 3300005563 Bacteria 546
28 Ga0068857_100215324 3300005577 Bacteria 1753
29 Ga0068852_100036292 3300005616 Bacteria 4123
30 Ga0081455_10156809 3300005937 Bacteria 1749
31 Ga0081540_1049674 3300005983 Bacteria 2091
32 Ga0075365_10213968 3300006038 Bacteria 1351
33 Ga0075368_10290532 3300006042 Bacteria 704
34 Ga0075364_10072214 3300006051 Bacteria 2274
35 Ga0075362_10013712 3300006177 Bacteria 3251
36 Ga0075367_10026161 3300006178 Bacteria 3306
37 Ga0075367_10207025 3300006178 Bacteria 1226
38 Ga0075369_10012474 3300006186 Bacteria 3359
39 Ga0075369_10059427 3300006186 Bacteria 1665
40 Ga0075366_10592901 3300006195 Bacteria 687
41 Ga0075370_10062643 3300006353 Bacteria 2119
42 Ga0075370_10083187 3300006353 Bacteria 1841
43 Ga0075370_10558542 3300006353 Bacteria 692
44 Ga0075431_100055637 3300006847 Bacteria 4081
45 Ga0075429_100165035 3300006880 Bacteria 1940
46 Ga0105240_11099680 3300009093 Bacteria 846
47 Ga0105240_11730978 3300009093 Bacteria 652
48 Ga0105240_11763141 3300009093 Bacteria 646
49 Ga0105247_10641555 3300009101 Bacteria 792
50 Ga0114129_10013679 3300009147 Bacteria 11563
51 Ga0105241_10270560 3300009174 Bacteria 1447
52 Ga0105237_10023683 3300009545 Bacteria 6287
53 Ga0105237_10151878 3300009545 Bacteria 2312
54 Ga0105237_11401559 3300009545 Bacteria 705
55 Ga0105238_10027221 3300009551 Bacteria 5826
56 Ga0105238_10111109 3300009551 Bacteria 2721
57 Ga0105239_10026978 3300010375 Bacteria 6322
58 Ga0105239_10088951 3300010375 Bacteria 3405
59 Ga0105239_10113184 3300010375 Bacteria 3009
60 Ga0105239_10569465 3300010375 Bacteria 1291
61 Ga0105239_10625515 3300010375 Bacteria 1229
62 Ga0105239_10694237 3300010375 Bacteria 1163
63 Ga0105239_10859179 3300010375 Bacteria 1041
64 Ga0105239_11748393 3300010375 Bacteria 720
65 Ga0157370_10235579 3300013104 Bacteria 1694
66 Ga0157369_10320892 3300013105 Bacteria 1610
67 Ga0157374_11042943 3300013296 Bacteria 837
68 Ga0157372_11375568 3300013307 Bacteria 814
69 Ga0157375_11096187 3300013308 Bacteria 932
70 Ga0182008_10182313 3300014497 Bacteria 1063
71 Ga0182008_10501279 3300014497 Bacteria 668
72 Ga0157376_10655071 3300014969 Bacteria 1051
73 Ga0157376_13029952 3300014969 Bacteria 509
74 Ga0182007_10065798 3300015262 Bacteria 1187
75 Ga0214542_1037463 3300021321 Bacteria 1381
76 Ga0224712_10344195 3300022467 Bacteria 704
77 Ga0209646_1018862 3300025246 Bacteria 1007
78 Ga0209026_1000002 3300025250 Bacteria 1136158
79 Ga0209148_1000038 3300025254 Bacteria 493744
80 Ga0209759_1000062 3300025256 Bacteria 197996
81 Ga0209233_1000027 3300025261 Bacteria 652089
82 Ga0209233_1008255 3300025261 Bacteria 3234
83 Ga0209455_1000068 3300025272 Bacteria 310024
84 Ga0209673_1040852 3300025273 Bacteria 1323
85 Ga0209025_1043435 3300025294 Bacteria 1894
86 Ga0209564_1000570 3300025295 Bacteria 58555
87 Ga0209256_1007991 3300025299 Bacteria 5029
88 Ga0207697_10123092 3300025315 Bacteria 1117
89 Ga0207680_10619588 3300025903 Bacteria 774
90 Ga0207647_10016613 3300025904 Bacteria 5020
91 Ga0207705_10075918 3300025909 Bacteria 2442
92 Ga0207695_10147704 3300025913 Bacteria 2293
93 Ga0207695_10216111 3300025913 Bacteria 1826
94 Ga0207695_11665881 3300025913 Bacteria 519
95 Ga0207671_10042150 3300025914 Bacteria 3379
96 Ga0207671_10058948 3300025914 Bacteria 2846
97 Ga0207657_10119965 3300025919 Bacteria 2164
98 Ga0207657_10777605 3300025919 Bacteria 741
99 Ga0207694_10015234 3300025924 Bacteria 5799
100 Ga0207690_10735441 3300025932 Bacteria 813
101 Ga0207704_10697193 3300025938 Bacteria 840
102 Ga0207691_11293458 3300025940 Bacteria 602
103 Ga0207667_10689622 3300025949 Bacteria 1024
104 Ga0207667_11451986 3300025949 Bacteria 658
105 Ga0207639_10052450 3300026041 Bacteria 3108
106 Ga0207639_10181359 3300026041 Bacteria 1791
107 Ga0207639_10342692 3300026041 Bacteria 1333
108 Ga0207678_10191389 3300026067 Bacteria 1748
109 Ga0207678_10722360 3300026067 Bacteria 877
110 Ga0207641_10480923 3300026088 Bacteria 1204
111 Ga0207648_10160799 3300026089 Bacteria 1983
112 Ga0207674_10150620 3300026116 Bacteria 2283
113 Ga0207683_11905219 3300026121 Bacteria 543
114 Ga0207698_10054146 3300026142 Bacteria 3085
115 Ga0209813_10173226 3300027866 Bacteria 785
116 Ga0209974_10384938 3300027876 Bacteria 548
117 Ga0268266_12279192 3300028379 Bacteria 513
118 Ga0307515_10001876 3300028794 Bacteria 46792
119 Ga0307513_10517933 3300031456 Bacteria 908
120 Ga0307408_100259327 3300031548 Bacteria 1438
121 Ga0307408_100676487 3300031548 Bacteria 925
122 Ga0307405_10848993 3300031731 Bacteria 769
123 Ga0307405_11080098 3300031731 Bacteria 689
124 Ga0307406_11146106 3300031901 Bacteria 673
125 Ga0307407_10471832 3300031903 Bacteria 915
126 Ga0307414_10357832 3300032004 Bacteria 1255
127 Ga0307411_10606724 3300032005 Bacteria 942
128 Ga0307510_10345474 3300033180 Bacteria 939
129 Ga0395899_0000059 3300037312 Bacteria 213004
130 Ga0395900_0000017 3300037418 Bacteria 369602
131 Ga0395900_0176940 3300037418 Bacteria 2170
132 Ga0395900_0236022 3300037418 Bacteria 1837
133 Ga0395900_0244119 3300037418 Bacteria 1800
134 Ga0395900_0535606 3300037418 Bacteria 1117
135 Ga0395900_0780441 3300037418 Bacteria 884
136 Ga0395900_1152723 3300037418 Bacteria 691
137 Ga0395898_0000030 3300037466 Bacteria 369577
138 Ga0395898_0014421 3300037466 Bacteria 8118
139 Ga0395905_0000056 3300037471 Bacteria 209230
140 Ga0395905_0136447 3300037471 Bacteria 2308
141 Ga0395905_0873300 3300037471 Bacteria 802
142 Ga0395905_1396146 3300037471 Bacteria 604
143 Ga0395901_0000015 3300038443 Bacteria 373388
144 Ga0395901_0136833 3300038443 Bacteria 2574
145 Ga0395901_0231680 3300038443 Bacteria 1928
146 Ga0395901_0233173 3300038443 Bacteria 1921
147 Ga0395901_0383054 3300038443 Bacteria 1447
148 Ga0436361_1110975 3300039447 Bacteria 1448
149 Ga0439465_0155567 3300041413 Bacteria 818
150 Ga0439465_0176502 3300041413 Bacteria 772
151 Ga0451797_0025721 3300041453 Bacteria 802
152 Ga0451833_0285826 3300041491 Bacteria 513
153 Ga0451833_0868855 3300041491 Bacteria 621
154 Ga0439445_0024021 3300042004 Bacteria 1547
155 Ga0439458_0051484 3300042157 Bacteria 1017
156 Ga0466972_0073511 3300044658 Bacteria 1629
157 Ga0466972_0090033 3300044658 Bacteria 1455
158 Ga0466965_0033671 3300044683 Bacteria 2505
159 Ga0466970_0263701 3300044765 Bacteria 967
160 Ga0466960_0012136 3300044901 Bacteria 3627
161 Ga0495638_0069390 3300046460 Bacteria 2160
162 Ga0495606_0208117 3300046507 Bacteria 1110
163 Ga0495620_0416742 3300046515 Bacteria 508
164 Ga0495643_0070052 3300046522 Bacteria 1842
165 Ga0495597_0021952 3300046542 Bacteria 2964
166 Ga0495668_0104185 3300046616 Bacteria 1552
167 Ga0495625_0200741 3300046660 Bacteria 1316
168 Ga0495625_0678171 3300046660 Bacteria 611
169 Ga0495588_0313142 3300046674 Bacteria 826
170 Ga0495687_193393 3300047443 Bacteria 653
171 Ga0495686_0253091 3300047472 Bacteria 989
172 Ga0496102_0322306 3300048905 Bacteria 1456
173 Ga0496103_0214701 3300048906 Bacteria 1237
174 Ga0496103_0524755 3300048906 Bacteria 757
175 Ga0496109_0404480 3300048912 Bacteria 1290
176 Ga0496110_0665970 3300048913 Bacteria 941
177 Ga0496110_1218567 3300048913 Bacteria 661
178 Ga0496112_0021244 3300048915 Bacteria 6171
179 Ga0496112_1423715 3300048915 Bacteria 608
180 Ga0496118_0142508 3300048921 Bacteria 1516
181 Ga0496119_0093325 3300048922 Bacteria 1705
182 Ga0496119_0119511 3300048922 Bacteria 1451
183 Ga0496120_0011646 3300048923 Bacteria 6035
184 Ga0496120_0030232 3300048923 Bacteria 3296
185 Ga0496121_0498803 3300048924 Bacteria 773
186 Ga0496123_0237022 3300048926 Bacteria 909
187 Ga0496125_0176233 3300048928 Bacteria 1430
188 Ga0496125_0434092 3300048928 Bacteria 757
189 Ga0496126_0403746 3300048929 Bacteria 1108
190 Ga0501308_039701 3300049128 Bacteria 659
191 Ga0501031_0000018 3300049568 Bacteria 106734
192 Ga0501032_0000201 3300049569 Bacteria 49742
193 Ga0501032_0006279 3300049569 Bacteria 8753
194 Ga0501032_0023195 3300049569 Bacteria 4294
195 Ga0501032_0056642 3300049569 Bacteria 2634
196 Ga0501032_0157677 3300049569 Bacteria 1490
197 Ga0501033_0000328 3300049570 Bacteria 45346
198 Ga0501033_0005198 3300049570 Bacteria 10340
199 Ga0501033_0009424 3300049570 Bacteria 7517
200 Ga0501033_0033905 3300049570 Bacteria 3832
201 Ga0501033_0439796 3300049570 Bacteria 907
202 Ga0501033_0679754 3300049570 Bacteria 701
203 Ga0501034_0000005 3300049571 Bacteria 367512
204 Ga0501034_0059763 3300049571 Bacteria 3829
205 Ga0501034_0113529 3300049571 Bacteria 2699
206 Ga0501034_0186446 3300049571 Bacteria 2038
207 Ga0501034_0296701 3300049571 Bacteria 1553
208 Ga0501034_1055807 3300049571 Bacteria 694
209 Ga0501036_0000005 3300049572 Bacteria 246420
210 Ga0501036_0730627 3300049572 Bacteria 817
211 Ga0501036_0957331 3300049572 Bacteria 701
212 Ga0501036_1115738 3300049572 Bacteria 644
213 Ga0501036_1718803 3300049572 Bacteria 505
214 Ga0501037_0000045 3300049573 Bacteria 117148
215 Ga0501037_0000616 3300049573 Bacteria 27595
216 Ga0501037_0025364 3300049573 Bacteria 4381
217 Ga0501037_0166096 3300049573 Bacteria 1571
218 Ga0501037_0205767 3300049573 Bacteria 1389
219 Ga0501038_0000001 3300049574 Bacteria 375481
220 Ga0501038_0134651 3300049574 Bacteria 2025
221 Ga0501038_0265984 3300049574 Bacteria 1353
222 Ga0501038_0271142 3300049574 Bacteria 1338
223 Ga0501038_0401408 3300049574 Bacteria 1060
224 Ga0501038_0496864 3300049574 Bacteria 933
225 Ga0501039_0000007 3300049575 Bacteria 277831
226 Ga0501039_0091958 3300049575 Bacteria 2364
227 Ga0501039_0311947 3300049575 Bacteria 1236
228 Ga0501039_1148370 3300049575 Bacteria 601
229 Ga0501040_0156581 3300049576 Bacteria 1609
230 Ga0501041_0556167 3300049577 Bacteria 731
231 Ga0501043_0000107 3300049579 Bacteria 77469
232 Ga0501043_0005098 3300049579 Bacteria 10631
233 Ga0501043_0308672 3300049579 Bacteria 1207
234 Ga0501043_0374096 3300049579 Bacteria 1079
235 Ga0501043_0864752 3300049579 Bacteria 650
236 Ga0501046_0205851 3300049580 Bacteria 1462
237 Ga0501046_0253939 3300049580 Bacteria 1293
238 Ga0501047_0020996 3300049581 Bacteria 6273
239 Ga0501047_0100525 3300049581 Bacteria 2771
240 Ga0501047_0129470 3300049581 Bacteria 2404
241 Ga0501047_0131997 3300049581 Bacteria 2377
242 Ga0501047_0135361 3300049581 Bacteria 2344
243 Ga0501047_0340277 3300049581 Bacteria 1338
244 Ga0501048_0089579 3300049582 Bacteria 2170
245 Ga0501067_0130681 3300049583 Bacteria 1397
246 Ga0501067_0171026 3300049583 Bacteria 1210
247 Ga0501067_0174138 3300049583 Bacteria 1199
248 Ga0501068_0056136 3300049584 Bacteria 2387
249 Ga0501068_0163902 3300049584 Bacteria 1401
250 Ga0501068_1100302 3300049584 Bacteria 525
251 Ga0501069_0000039 3300049585 Bacteria 82361
252 Ga0501069_0013970 3300049585 Bacteria 4289
253 Ga0501069_0019200 3300049585 Bacteria 3694
254 Ga0501069_0138716 3300049585 Bacteria 1394
255 Ga0501069_0259905 3300049585 Bacteria 1014
256 Ga0501069_0325425 3300049585 Bacteria 904
257 Ga0501070_0000132 3300049586 Bacteria 67092
258 Ga0501070_0000299 3300049586 Bacteria 46014
259 Ga0501070_0002117 3300049586 Bacteria 17410
260 Ga0501070_0173199 3300049586 Bacteria 1777
261 Ga0501070_0385762 3300049586 Bacteria 1134
262 Ga0501070_0685067 3300049586 Bacteria 812
263 Ga0501070_0993112 3300049586 Bacteria 651
264 Ga0501071_0254652 3300049587 Bacteria 1325
265 Ga0501073_0048839 3300049589 Bacteria 2969
266 Ga0501073_0256843 3300049589 Bacteria 1206
267 Ga0501073_0335252 3300049589 Bacteria 1044
268 Ga0501074_0001123 3300049590 Bacteria 17513
269 Ga0501074_0010236 3300049590 Bacteria 6805
270 Ga0501074_0071899 3300049590 Bacteria 2486
271 Ga0501074_0089756 3300049590 Bacteria 2201
272 Ga0501079_0424566 3300049741 Bacteria 1044
273 Ga0501080_0001676 3300049742 Bacteria 18865
274 Ga0501080_0003023 3300049742 Bacteria 14830
275 Ga0501080_0054458 3300049742 Bacteria 3725
276 Ga0501080_0070941 3300049742 Bacteria 3240
277 Ga0501080_0240612 3300049742 Bacteria 1652
278 Ga0501080_0927245 3300049742 Bacteria 758
279 Ga0501080_1139867 3300049742 Bacteria 672
280 Ga0501083_0002416 3300049744 Bacteria 12766
281 Ga0501083_0627898 3300049744 Bacteria 699
282 Ga0501035_0000008 3300049822 Bacteria 313425
283 Ga0501035_0000055 3300049822 Bacteria 139471
284 Ga0501035_0000807 3300049822 Bacteria 33393
285 Ga0501035_0022239 3300049822 Bacteria 5823
286 Ga0501035_0036316 3300049822 Bacteria 4466
287 Ga0501035_0242553 3300049822 Bacteria 1532
288 Ga0501044_0000001 3300049823 Bacteria 418087
289 Ga0501044_0000071 3300049823 Bacteria 124531
290 Ga0501044_0015843 3300049823 Bacteria 8112
291 Ga0501044_0053864 3300049823 Bacteria 4137
292 Ga0501044_0070576 3300049823 Bacteria 3553
293 Ga0501044_0078169 3300049823 Bacteria 3353
294 Ga0501044_0218332 3300049823 Bacteria 1858
295 Ga0501044_0240180 3300049823 Bacteria 1756
296 Ga0501044_0278568 3300049823 Bacteria 1606
297 Ga0501044_0370638 3300049823 Bacteria 1348
298 Ga0501045_0178001 3300049824 Bacteria 1584
299 nmdc:mga03683_56101_c1 3300050489 Bacteria 1655
300 nmdc:mga03n38_38193_c1 3300050490 Bacteria 2075
301 nmdc:mga00v17_6188_c1 3300050491 Bacteria 6344
302 nmdc:mga0yw44_292100_c1 3300050492 Bacteria 1091
303 nmdc:mga0yw44_40387_c1 3300050492 Bacteria 2772
304 nmdc:mga0yw44_911_c1 3300050492 Bacteria 11182
305 nmdc:mga06z11_55847_c1 3300050494 Bacteria 2040
306 nmdc:mga06z11_8900_c1 3300050494 Bacteria 4209
307 nmdc:mga07m45_132760_c1 3300050496 Bacteria 1441
308 nmdc:mga07m45_223600_c1 3300050496 Bacteria 1095
309 nmdc:mga07m45_92969_c1 3300050496 Bacteria 1729
310 nmdc:mga05p37_61974_c1 3300050507 Bacteria 3686
311 nmdc:mga06r32_964152_c1 3300050510 Bacteria 807
312 nmdc:mga0sz30_13403_c1 3300050516 Bacteria 3210
313 Ga0500610_0019178 3300053079 Bacteria 3321
314 Ga0500650_0429252 3300053098 Bacteria 569
315 Ga0500559_0160426 3300053136 Bacteria 1057
316 Ga0500568_0221562 3300053139 Bacteria 691
317 Ga0500620_061777 3300053155 Bacteria 1276
318 Ga0500627_0024410 3300053158 Bacteria 2474
319 Ga0500627_0294294 3300053158 Bacteria 710
320 Ga0587088_020713 3300059508 Bacteria 1093
321 Ga0587088_063940 3300059508 Bacteria 752
322 Ga0587090_000175 3300059510 Bacteria 4472
323 Ga0587091_007538 3300059511 Bacteria 1574
324 Ga0587128_009353 3300059630 Bacteria 1290
325 Ga0587114_024190 3300059655 Bacteria 882
326 Ga0501082_0458188 3300060353 Bacteria 1114
327 2503202879 2503198000 Bacteria 6884444
328 2509115395 2508501123 Bacteria 6283661
329 2509143734 2508501127 Bacteria 7037543
330 2509372285 2509276018 Bacteria 6910194
331 2509397370 2509276022 Bacteria 6200534
332 2510317809 2510065059 Bacteria 6847884
333 2512930347 2512875016 Bacteria 6529530
334 2512958064 2512875024 Bacteria 7195110
335 2513610039 2513237090 Bacteria 7096802
336 2514032797 2513237164 Bacteria 7563725
337 2514422592 2513237305 Bacteria 7293571
338 2588515960 2588253730 Bacteria 6881675
339 2597814516 2597489875 Bacteria 7010078
340 2599938196 2599185301 Bacteria 6161860
341 2643793422 2643221555 Bacteria 3749717
342 2643840647 2643221564 Bacteria 4193379
343 2643989640 2643221595 Bacteria 6565519
344 2644130091 2643221623 Bacteria 5239945
345 2644157736 2643221627 Bacteria 6761570
346 2688599739 2687453392 Bacteria 6880454
347 2694630589 2693429783 Bacteria 7019804
348 2723576503 2721755686 Bacteria 7343952
349 2739308870 2738543024 Bacteria 5603683
350 2756676069 2756170246 Bacteria 7451806
351 2770199422 2767802442 Bacteria 5747986
352 2792748733 2791355123 Bacteria 8049106
353 2793279767 2791355253 Bacteria 5171699
354 2840767977 2840764183 Bacteria 6358399
355 2841740684 2841734538 Bacteria 6784580
356 2842515215 2842509118 Bacteria 6850950
357 2844007032 2844002411 Bacteria 7168230
358 2844015027 2844009547 Bacteria 6728125
359 2847676190 2847670302 Bacteria 6165597
360 2847692844 2847686936 Bacteria 6278406
361 2856315976 2856314179 Bacteria 6477897
362 2856333016 2856328259 Bacteria 6528202
363 2856339072 2856334872 Bacteria 7037011
364 2856346467 2856342000 Bacteria 7176905
365 2856359559 2856356410 Bacteria 6297484
366 2856368709 2856364286 Bacteria 6939991
367 2857350409 2857349434 Bacteria 7926032
368 2857372189 2857367948 Bacteria 6965560
369 2869167229 2869162929 Bacteria 6399702
370 2869176976 2869169390 Bacteria 6659796
371 2869237409 2869234852 Bacteria 6654993
372 2869247946 2869242130 Bacteria 6609239
373 2869251428 2869249662 Bacteria 6868783
374 2869257360 2869256925 Bacteria 6981691
375 2869266936 2869264136 Bacteria 6880765
376 2869272376 2869271264 Bacteria 6908218
377 2869291204 2869285874 Bacteria 6901219
378 2871433484 2871429161 Bacteria 6547891
379 2871440041 2871435913 Bacteria 6880295
380 2871456847 2871451962 Bacteria 7336357
381 2871464143 2871459585 Bacteria 6866887
382 2871467157 2871466892 Bacteria 6923287
383 2871476087 2871474448 Bacteria 6806570
384 2871487431 2871481445 Bacteria 6700002
385 2871495896 2871488783 Bacteria 6929816
386 2871503110 2871495908 Bacteria 6935695
387 2874105966 2874102143 Bacteria 6342645
388 2874121202 2874116593 Bacteria 6674494
389 2874126101 2874123672 Bacteria 7238285
390 2874134270 2874131515 Bacteria 6820270
391 2874153085 2874146452 Bacteria 7533118
392 2874160350 2874155637 Bacteria 6724144
393 2874165249 2874162495 Bacteria 6174670
394 2874170844 2874168670 Bacteria 8062617
395 2876368311 2876363079 Bacteria 6544991
396 2876371535 2876369609 Bacteria 6807521
397 2876382731 2876377896 Bacteria 6565995
398 2876392735 2876386047 Bacteria 6698674
399 2876394856 2876392853 Bacteria 6660880
400 2876400902 2876399893 Bacteria 6927900
401 2876410652 2876406927 Bacteria 6191900
402 2876419376 2876413966 Bacteria 6831344
403 2876425704 2876420981 Bacteria 6687741
404 2878040244 2878035449 Bacteria 6555736
405 2878751095 2878745973 Bacteria 6867388
406 2878753306 2878753008 Bacteria 6922523
407 2878766999 2878760144 Bacteria 6823465
408 2878774197 2878767105 Bacteria 6898628
409 2878776202 2878774303 Bacteria 6108671
410 2878786165 2878781027 Bacteria 6834456
411 2878794675 2878788777 Bacteria 6567085
412 2881152213 2881147464 Bacteria 7779814
413 2881156478 2881155292 Bacteria 6461656
414 2881168186 2881161766 Bacteria 7127907
415 2881847295 2881845957 Bacteria 6611900
416 2881864337 2881861095 Bacteria 7128710
417 2882633303 2882632389 Bacteria 8154593
418 2882915086 2882912400 Bacteria 6801539
419 2885310065 2885305155 Bacteria 7348390
420 2885316800 2885312484 Bacteria 6415165
421 2885326071 2885318864 Bacteria 6729568
422 2885340284 2885334103 Bacteria 7216818
423 2885346772 2885342637 Bacteria 7011821
424 2885352468 2885350715 Bacteria 6787678
425 2888340918 2888337043 Bacteria 6629336
426 2888348120 2888343758 Bacteria 6611049
427 2888356426 2888350351 Bacteria 7372807
428 2889011338 2889010040 Bacteria 6749192
429 2889016932 2889016732 Bacteria 6700763
430 2889793684 2889790730 Bacteria 5689708
431 2903452329 2903448605 Bacteria 7357801
432 2903495160 2903492973 Bacteria 13473544
433 2903503151 2903492973 Bacteria 13473544
434 2903521380 2903513507 Bacteria 6344008
435 2903527307 2903521522 Bacteria 6525694
436 2903531453 2903528002 Bacteria 6586099
437 2903548299 2903540706 Bacteria 7062119
438 2904661487 2904659560 Bacteria 6685615
439 2906313036 2906308376 Bacteria 6841989
440 2906325747 2906321335 Bacteria 6579571
441 2906328911 2906328253 Bacteria 6585166
442 2906356027 2906354277 Bacteria 6991324
443 2906374920 2906370794 Bacteria 6881062
444 2906382231 2906378014 Bacteria 6911440
445 2906397340 2906393657 Bacteria 6790866
446 2906404577 2906401398 Bacteria 6693206
447 2906410871 2906408224 Bacteria 6162342
448 2906416113 2906414383 Bacteria 6580790
449 2906429299 2906427513 Bacteria 6375796
450 2920766280 2920760137 Bacteria 7427611
451 2922138644 2922130491 Bacteria 7173936
452 2922157918 2922151315 Bacteria 6902399
453 2922165546 2922158528 Bacteria 6573167
454 2922177289 2922172374 Bacteria 6167644
455 2922182477 2922178524 Bacteria 6025201
456 2922191464 2922185730 Bacteria 7113964
457 2924715360 2924710171 Bacteria 6752351
458 2924732339 2924726620 Bacteria 6271473
459 2924734980 2924733363 Bacteria 7574837
460 2924741913 2924741084 Bacteria 6661321
461 2924754263 2924748358 Bacteria 6154725
462 2924757756 2924754689 Bacteria 6774424
463 2924765172 2924762789 Bacteria 6561353
464 2924789784 2924784321 Bacteria 7416538
465 2937820812 2937813078 Bacteria 7783518
466 2937827430 2937822353 Bacteria 7290551
467 2937836858 2937836603 Bacteria 6811263
468 2937845693 2937843397 Bacteria 5256375
469 2937854329 2937848649 Bacteria 6983481
470 2937864478 2937861824 Bacteria 6660327
471 2937875974 2937868953 Bacteria 6639878
472 2937879798 2937877337 Bacteria 7246526
473 2937893953 2937891427 Bacteria 6357007
474 2937974692 2937972304 Bacteria 7532020
475 2937986202 2937980651 Bacteria 6517427
476 2938002123 2937994558 Bacteria 7036190
477 2938020398 2938014810 Bacteria 6700592
478 2958037181 2958034702 Bacteria 6989922
479 2958046893 2958041894 Bacteria 13082850
480 2958067408 2958064165 Bacteria 7158582
481 2958076959 2958071322 Bacteria 6815895
482 2958086976 2958084443 Bacteria 7312792
483 2958093257 2958092219 Bacteria 6861151
484 2958106158 2958100919 Bacteria 6800575
485 2958110535 2958108152 Bacteria 6681128
486 2958122151 2958115193 Bacteria 6923548
487 2958126551 2958122699 Bacteria 7280457
488 2958135605 2958130278 Bacteria 6897202
489 2958142229 2958137437 Bacteria 6050276
490 2958146825 2958144490 Bacteria 6677056
491 2958161142 2958158011 Bacteria 6058449
492 2958172177 2958165035 Bacteria 6906348
493 2958174745 2958172287 Bacteria 6716688
494 2958185096 2958179912 Bacteria 6874908
495 2961083363 2961077736 Bacteria 7079850
496 2961116639 2961114664 Bacteria 6680456
497 2961131901 2961127735 Bacteria 7196641
498 2961138867 2961136820 Bacteria 6775228
499 2961170625 2961163497 Bacteria 6901077
500 2961177750 2961170736 Bacteria 7072258
501 2961184514 2961183825 Bacteria 6688536
502 2963648884 2963644680 Bacteria 6530403
503 2965025372 2965018300 Bacteria 6883036
504 2965027982 2965025482 Bacteria 6532201
505 2965037282 2965032056 Bacteria 6887443
506 2965041079 2965040258 Bacteria 6855979
507 2965050087 2965047637 Bacteria 6623551
508 2965065508 2965062239 Bacteria 7412989
509 2965090405 2965089291 Bacteria 6866420
510 2965108406 2965102966 Bacteria 6800987
511 2965111003 2965110997 Bacteria 6693150
512 2965121507 2965119406 Bacteria 6956431
513 2968003017 2967996073 Bacteria 6787468
514 2968003842 2968003550 Bacteria 6929263
515 2968020001 2968016561 Bacteria 7022047
516 2968084109 2968083720 Bacteria 7351627
517 2968095960 2968091066 Bacteria 6052692
518 2968099729 2968097103 Bacteria 6107094
519 2968112546 2968110612 Bacteria 6814636
520 2968121321 2968117919 Bacteria 6536078
521 2968130851 2968128360 Bacteria 6270294
522 2968142226 2968138860 Bacteria 6605449
523 2968179011 2968171901 Bacteria 6894245
524 2970473322 2970469710 Bacteria 6969209
525 2970495444 2970489779 Bacteria 6517260
526 2970510426 2970503327 Bacteria 7099517
527 2970514127 2970510686 Bacteria 7006402
528 2970532023 2970524798 Bacteria 6840927
529 2970538449 2970532167 Bacteria 6553173
530 2970546223 2970540015 Bacteria 6977556
531 2970552111 2970547951 Bacteria 6931819
532 2970561855 2970554993 Bacteria 6814252
533 2970595823 2970593180 Bacteria 7073582
534 2970620360 2970619444 Bacteria 6986144
535 2970629551 2970627176 Bacteria 6680862
536 2977822754 2977821940 Bacteria 6906439
537 2977833221 2977828996 Bacteria 7007971
538 2977849110 2977843712 Bacteria 6753583
539 2977851365 2977851361 Bacteria 6694324
540 2977864463 2977858184 Bacteria 6215359
541 2977872398 2977864932 Bacteria 7534097
542 2977874467 2977872689 Bacteria 7270173
543 2977900230 2977898635 Bacteria 6675551
544 2977909717 2977907340 Bacteria 6577984
545 2977920012 2977915119 Bacteria 6829656
546 2977926739 2977922695 Bacteria 6956781
547 2977936270 2977935797 Bacteria 6252826
548 2977948119 2977942078 Bacteria 7570577
549 2977956475 2977950692 Bacteria 6893264
550 2977959216 2977957713 Bacteria 6877875
551 2977979638 2977971508 Bacteria 7472917
552 2977992436 2977986579 Bacteria 6581278
553 2979712215 2979710463 Bacteria 6785254
554 2979751202 2979742915 Bacteria 7301278
555 2979777365 2979772303 Bacteria 6618277
556 2979781441 2979779861 Bacteria 6219781
557 2979815300 2979808191 Bacteria 7179355
558 2987637595 2987636660 Bacteria 8088555
559 2987650679 2987645492 Bacteria 6117018
560 2987653281 2987652177 Bacteria 6969023
561 2987666864 2987659509 Bacteria 6966464
562 2987667785 2987666974 Bacteria 6509233
563 2987675634 2987673487 Bacteria 6884027
564 2996310753 2996310559 Bacteria 6357320
565 2996340691 2996336353 Bacteria 5511628
566 2996348445 2996341866 Bacteria 6643098
567 2996351487 2996348954 Bacteria 7239054
568 2996389379 2996386984 Bacteria 6978667
569 3000138861 3000135777 Bacteria 6891109
570 3004170449 3004167301 Bacteria 8330599
571 3004195868 3004188549 Bacteria 6952365
572 3004202057 3004195979 Bacteria 6776956
573 3004206083 3004203850 Bacteria 7307914
574 3004215046 3004211236 Bacteria 7417683
575 3004222363 3004218560 Bacteria 7421728
576 3004246191 3004239961 Bacteria 6892290
577 3004274409 3004268573 Bacteria 7043476
578 3004278187 3004275668 Bacteria 7114440
579 3004289156 3004289098 Bacteria 6135450
580 3004339929 3004334049 Bacteria 8449246
581 637073342 637000159 Bacteria 7596297
582 649874244 649633066 Bacteria 6690028
583 8002285426 8002285264 Bacteria 6717907
584 8004302581 8004300914 Bacteria 6132239
585 8004315344 8004312739 Bacteria 7444653
586 8004364180 8004361976 Bacteria 6858373
587 8004374878 8004374579 Bacteria 6898112
588 8004394240 8004387939 Bacteria 7049250
589 8004399108 8004395343 Bacteria 6620908
590 8004446072 8004445564 Bacteria 6322258
591 8004638213 8004633249 Bacteria 6723080
592 8004642034 8004640170 Bacteria 6723001
593 8004700714 8004695233 Bacteria 6731676
594 8004713585 8004703790 Bacteria 8006957
595 8004719294 8004714634 Bacteria 6776161
596 8004729669 8004727605 Bacteria 6643904
597 8055622235 8055617313 Bacteria 7548464
598 Ga0307409_100190771
599 JGI24740J21852_10006526
600 JGI24739J22299_10069583
601 JGI24738J21930_10095540
602 JGI25156J39149_1005879
603 JGI25154J39366_1024227
604 JGI25157J39369_1000310
605 JGI25404J52841_10050821
606 Ga0055542_1001387
607 Ga0055524_1006400
608 Ga0058692_1017684
609 Ga0065715_10434495
610 Ga0070658_10546218
611 Ga0070666_10842087
612 Ga0070663_100552684
613 Ga0070663_100738329
614 Ga0070663_102130129
615 Ga0068867_100617183
616 Ga0068853_100129311
617 Ga0068853_100170361
618 Ga0068853_100215029
619 Ga0070696_100081640
620 Ga0070665_100118741
621 Ga0070665_101429509
622 Ga0068855_100344518
623 Ga0068855_100915217
624 Ga0068855_102249088
625 Ga0068857_100215324
626 Ga0068852_100036292
627 Ga0081455_10156809
628 Ga0081540_1049674
629 Ga0075365_10213968
630 Ga0075368_10290532
631 Ga0075364_10072214
632 Ga0075362_10013712
633 Ga0075367_10026161
634 Ga0075367_10207025
635 Ga0075369_10012474
636 Ga0075369_10059427
637 Ga0075366_10592901
638 Ga0075370_10062643
639 Ga0075370_10083187
640 Ga0075370_10558542
641 Ga0075431_100055637
642 Ga0075429_100165035
643 Ga0105240_11099680
644 Ga0105240_11730978
645 Ga0105240_11763141
646 Ga0105247_10641555
647 Ga0114129_10013679
648 Ga0105241_10270560
649 Ga0105237_10023683
650 Ga0105237_10151878
651 Ga0105237_11401559
652 Ga0105238_10027221
653 Ga0105238_10111109
654 Ga0105239_10026978
655 Ga0105239_10088951
656 Ga0105239_10113184
657 Ga0105239_10569465
658 Ga0105239_10625515
659 Ga0105239_10694237
660 Ga0105239_10859179
661 Ga0105239_11748393
662 Ga0157370_10235579
663 Ga0157369_10320892
664 Ga0157374_11042943
665 Ga0157372_11375568
666 Ga0157375_11096187
667 Ga0182008_10182313
668 Ga0182008_10501279
669 Ga0157376_10655071
670 Ga0157376_13029952
671 Ga0182007_10065798
672 Ga0214542_1037463
673 Ga0224712_10344195
674 Ga0209646_1018862
675 Ga0209026_1000002
676 Ga0209148_1000038
677 Ga0209759_1000062
678 Ga0209233_1000027
679 Ga0209233_1008255
680 Ga0209455_1000068
681 Ga0209673_1040852
682 Ga0209025_1043435
683 Ga0209564_1000570
684 Ga0209256_1007991
685 Ga0207697_10123092
686 Ga0207680_10619588
687 Ga0207647_10016613
688 Ga0207705_10075918
689 Ga0207695_10147704
690 Ga0207695_10216111
691 Ga0207695_11665881
692 Ga0207671_10042150
693 Ga0207671_10058948
694 Ga0207657_10119965
695 Ga0207657_10777605
696 Ga0207694_10015234
697 Ga0207690_10735441
698 Ga0207704_10697193
699 Ga0207691_11293458
700 Ga0207667_10689622
701 Ga0207667_11451986
702 Ga0207639_10052450
703 Ga0207639_10181359
704 Ga0207639_10342692
705 Ga0207678_10191389
706 Ga0207678_10722360
707 Ga0207641_10480923
708 Ga0207648_10160799
709 Ga0207674_10150620
710 Ga0207683_11905219
711 Ga0207698_10054146
712 Ga0209813_10173226
713 Ga0209974_10384938
714 Ga0268266_12279192
715 Ga0307515_10001876
716 Ga0307513_10517933
717 Ga0307408_100259327
718 Ga0307408_100676487
719 Ga0307405_10848993
720 Ga0307405_11080098
721 Ga0307406_11146106
722 Ga0307407_10471832
723 Ga0307414_10357832
724 Ga0307411_10606724
725 Ga0307510_10345474
726 Ga0395899_0000059
727 Ga0395900_0000017
728 Ga0395900_0176940
729 Ga0395900_0236022
730 Ga0395900_0244119
731 Ga0395900_0535606
732 Ga0395900_0780441
733 Ga0395900_1152723
734 Ga0395898_0000030
735 Ga0395898_0014421
736 Ga0395905_0000056
737 Ga0395905_0136447
738 Ga0395905_0873300
739 Ga0395905_1396146
740 Ga0395901_0000015
741 Ga0395901_0136833
742 Ga0395901_0231680
743 Ga0395901_0233173
744 Ga0395901_0383054
745 Ga0436361_1110975
746 Ga0439465_0155567
747 Ga0439465_0176502
748 Ga0451797_0025721
749 Ga0451833_0285826
750 Ga0451833_0868855
751 Ga0439445_0024021
752 Ga0439458_0051484
753 Ga0466972_0073511
754 Ga0466972_0090033
755 Ga0466965_0033671
756 Ga0466970_0263701
757 Ga0466960_0012136
758 Ga0495638_0069390
759 Ga0495606_0208117
760 Ga0495620_0416742
761 Ga0495643_0070052
762 Ga0495597_0021952
763 Ga0495668_0104185
764 Ga0495625_0200741
765 Ga0495625_0678171
766 Ga0495588_0313142
767 Ga0495687_193393
768 Ga0495686_0253091
769 Ga0496102_0322306
770 Ga0496103_0214701
771 Ga0496103_0524755
772 Ga0496109_0404480
773 Ga0496110_0665970
774 Ga0496110_1218567
775 Ga0496112_0021244
776 Ga0496112_1423715
777 Ga0496118_0142508
778 Ga0496119_0093325
779 Ga0496119_0119511
780 Ga0496120_0011646
781 Ga0496120_0030232
782 Ga0496121_0498803
783 Ga0496123_0237022
784 Ga0496125_0176233
785 Ga0496125_0434092
786 Ga0496126_0403746
787 Ga0501308_039701
788 Ga0501031_0000018
789 Ga0501032_0000201
790 Ga0501032_0006279
791 Ga0501032_0023195
792 Ga0501032_0056642
793 Ga0501032_0157677
794 Ga0501033_0000328
795 Ga0501033_0005198
796 Ga0501033_0009424
797 Ga0501033_0033905
798 Ga0501033_0439796
799 Ga0501033_0679754
800 Ga0501034_0000005
801 Ga0501034_0059763
802 Ga0501034_0113529
803 Ga0501034_0186446
804 Ga0501034_0296701
805 Ga0501034_1055807
806 Ga0501036_0000005
807 Ga0501036_0730627
808 Ga0501036_0957331
809 Ga0501036_1115738
810 Ga0501036_1718803
811 Ga0501037_0000045
812 Ga0501037_0000616
813 Ga0501037_0025364
814 Ga0501037_0166096
815 Ga0501037_0205767
816 Ga0501038_0000001
817 Ga0501038_0134651
818 Ga0501038_0265984
819 Ga0501038_0271142
820 Ga0501038_0401408
821 Ga0501038_0496864
822 Ga0501039_0000007
823 Ga0501039_0091958
824 Ga0501039_0311947
825 Ga0501039_1148370
826 Ga0501040_0156581
827 Ga0501041_0556167
828 Ga0501043_0000107
829 Ga0501043_0005098
830 Ga0501043_0308672
831 Ga0501043_0374096
832 Ga0501043_0864752
833 Ga0501046_0205851
834 Ga0501046_0253939
835 Ga0501047_0020996
836 Ga0501047_0100525
837 Ga0501047_0129470
838 Ga0501047_0131997
839 Ga0501047_0135361
840 Ga0501047_0340277
841 Ga0501048_0089579
842 Ga0501067_0130681
843 Ga0501067_0171026
844 Ga0501067_0174138
845 Ga0501068_0056136
846 Ga0501068_0163902
847 Ga0501068_1100302
848 Ga0501069_0000039
849 Ga0501069_0013970
850 Ga0501069_0019200
851 Ga0501069_0138716
852 Ga0501069_0259905
853 Ga0501069_0325425
854 Ga0501070_0000132
855 Ga0501070_0000299
856 Ga0501070_0002117
857 Ga0501070_0173199
858 Ga0501070_0385762
859 Ga0501070_0685067
860 Ga0501070_0993112
861 Ga0501071_0254652
862 Ga0501073_0048839
863 Ga0501073_0256843
864 Ga0501073_0335252
865 Ga0501074_0001123
866 Ga0501074_0010236
867 Ga0501074_0071899
868 Ga0501074_0089756
869 Ga0501079_0424566
870 Ga0501080_0001676
871 Ga0501080_0003023
872 Ga0501080_0054458
873 Ga0501080_0070941
874 Ga0501080_0240612
875 Ga0501080_0927245
876 Ga0501080_1139867
877 Ga0501083_0002416
878 Ga0501083_0627898
879 Ga0501035_0000008
880 Ga0501035_0000055
881 Ga0501035_0000807
882 Ga0501035_0022239
883 Ga0501035_0036316
884 Ga0501035_0242553
885 Ga0501044_0000001
886 Ga0501044_0000071
887 Ga0501044_0015843
888 Ga0501044_0053864
889 Ga0501044_0070576
890 Ga0501044_0078169
891 Ga0501044_0218332
892 Ga0501044_0240180
893 Ga0501044_0278568
894 Ga0501044_0370638
895 Ga0501045_0178001
896 nmdc:mga03683_56101_c1
897 nmdc:mga03n38_38193_c1
898 nmdc:mga00v17_6188_c1
899 nmdc:mga0yw44_292100_c1
900 nmdc:mga0yw44_40387_c1
901 nmdc:mga0yw44_911_c1
902 nmdc:mga06z11_55847_c1
903 nmdc:mga06z11_8900_c1
904 nmdc:mga07m45_132760_c1
905 nmdc:mga07m45_223600_c1
906 nmdc:mga07m45_92969_c1
907 nmdc:mga05p37_61974_c1
908 nmdc:mga06r32_964152_c1
909 nmdc:mga0sz30_13403_c1
910 Ga0500610_0019178
911 Ga0500650_0429252
912 Ga0500559_0160426
913 Ga0500568_0221562
914 Ga0500620_061777
915 Ga0500627_0024410
916 Ga0500627_0294294
917 Ga0587088_020713
918 Ga0587088_063940
919 Ga0587090_000175
920 Ga0587091_007538
921 Ga0587128_009353
922 Ga0587114_024190
923 Ga0501082_0458188
924 2503202879
925 2509115395
926 2509143734
927 2509372285
928 2509397370
929 2510317809
930 2512930347
931 2512958064
932 2513610039
933 2514032797
934 2514422592
935 2588515960
936 2597814516
937 2599938196
938 2643793422
939 2643840647
940 2643989640
941 2644130091
942 2644157736
943 2688599739
944 2694630589
945 2723576503
946 2739308870
947 2756676069
948 2770199422
949 2792748733
950 2793279767
951 2840767977
952 2841740684
953 2842515215
954 2844007032
955 2844015027
956 2847676190
957 2847692844
958 2856315976
959 2856333016
960 2856339072
961 2856346467
962 2856359559
963 2856368709
964 2857350409
965 2857372189
966 2869167229
967 2869176976
968 2869237409
969 2869247946
970 2869251428
971 2869257360
972 2869266936
973 2869272376
974 2869291204
975 2871433484
976 2871440041
977 2871456847
978 2871464143
979 2871467157
980 2871476087
981 2871487431
982 2871495896
983 2871503110
984 2874105966
985 2874121202
986 2874126101
987 2874134270
988 2874153085
989 2874160350
990 2874165249
991 2874170844
992 2876368311
993 2876371535
994 2876382731
995 2876392735
996 2876394856
997 2876400902
998 2876410652
999 2876419376
1000 2876425704
1001 2878040244
1002 2878751095
1003 2878753306
1004 2878766999
1005 2878774197
1006 2878776202
1007 2878786165
1008 2878794675
1009 2881152213
1010 2881156478
1011 2881168186
1012 2881847295
1013 2881864337
1014 2882633303
1015 2882915086
1016 2885310065
1017 2885316800
1018 2885326071
1019 2885340284
1020 2885346772
1021 2885352468
1022 2888340918
1023 2888348120
1024 2888356426
1025 2889011338
1026 2889016932
1027 2889793684
1028 2903452329
1029 2903495160
1030 2903503151
1031 2903521380
1032 2903527307
1033 2903531453
1034 2903548299
1035 2904661487
1036 2906313036
1037 2906325747
1038 2906328911
1039 2906356027
1040 2906374920
1041 2906382231
1042 2906397340
1043 2906404577
1044 2906410871
1045 2906416113
1046 2906429299
1047 2920766280
1048 2922138644
1049 2922157918
1050 2922165546
1051 2922177289
1052 2922182477
1053 2922191464
1054 2924715360
1055 2924732339
1056 2924734980
1057 2924741913
1058 2924754263
1059 2924757756
1060 2924765172
1061 2924789784
1062 2937820812
1063 2937827430
1064 2937836858
1065 2937845693
1066 2937854329
1067 2937864478
1068 2937875974
1069 2937879798
1070 2937893953
1071 2937974692
1072 2937986202
1073 2938002123
1074 2938020398
1075 2958037181
1076 2958046893
1077 2958067408
1078 2958076959
1079 2958086976
1080 2958093257
1081 2958106158
1082 2958110535
1083 2958122151
1084 2958126551
1085 2958135605
1086 2958142229
1087 2958146825
1088 2958161142
1089 2958172177
1090 2958174745
1091 2958185096
1092 2961083363
1093 2961116639
1094 2961131901
1095 2961138867
1096 2961170625
1097 2961177750
1098 2961184514
1099 2963648884
1100 2965025372
1101 2965027982
1102 2965037282
1103 2965041079
1104 2965050087
1105 2965065508
1106 2965090405
1107 2965108406
1108 2965111003
1109 2965121507
1110 2968003017
1111 2968003842
1112 2968020001
1113 2968084109
1114 2968095960
1115 2968099729
1116 2968112546
1117 2968121321
1118 2968130851
1119 2968142226
1120 2968179011
1121 2970473322
1122 2970495444
1123 2970510426
1124 2970514127
1125 2970532023
1126 2970538449
1127 2970546223
1128 2970552111
1129 2970561855
1130 2970595823
1131 2970620360
1132 2970629551
1133 2977822754
1134 2977833221
1135 2977849110
1136 2977851365
1137 2977864463
1138 2977872398
1139 2977874467
1140 2977900230
1141 2977909717
1142 2977920012
1143 2977926739
1144 2977936270
1145 2977948119
1146 2977956475
1147 2977959216
1148 2977979638
1149 2977992436
1150 2979712215
1151 2979751202
1152 2979777365
1153 2979781441
1154 2979815300
1155 2987637595
1156 2987650679
1157 2987653281
1158 2987666864
1159 2987667785
1160 2987675634
1161 2996310753
1162 2996340691
1163 2996348445
1164 2996351487
1165 2996389379
1166 3000138861
1167 3004170449
1168 3004195868
1169 3004202057
1170 3004206083
1171 3004215046
1172 3004222363
1173 3004246191
1174 3004274409
1175 3004278187
1176 3004289156
1177 3004339929
1178 637073342
1179 649874244
1180 8002285426
1181 8004302581
1182 8004315344
1183 8004364180
1184 8004374878
1185 8004394240
1186 8004399108
1187 8004446072
1188 8004638213
1189 8004642034
1190 8004700714
1191 8004713585
1192 8004719294
1193 8004729669
1194 8055622235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

56

129

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.7418 36 126
1wcj-assembly1.cif.gz_A conserved hypothetical protein tm0487 from thermotoga maritima 0.7296 38 131
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.7281 36 126
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.713 34 133
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.7046 36 132
ID Description Score Start End Superfamily
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8094 28 119 3.30.300.130
af_P9WJN7_3_100_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7874 31 132 3.30.300.130
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7715 28 119 3.30.300.130
af_P9WJN7_3_100_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7588 31 132 3.30.300.130
af_Q58529_1_94_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7583 38 130 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A0F8XVW0-F1-model_v4 MIP18 family-like domain-containing protein 0.8846 38 116
AF-A0A358G4J9-F1-model_v4 deleted 0.8613 32 114
AF-A0A425CZT3-F1-model_v4 Histone acetyltransferase (EC 2.3.1.48) 0.8585 28 116 GO:0000785
GO:0003682
GO:0003712
GO:0005524
GO:0005634
GO:0006281
GO:0006357
GO:0032931
GO:0036408
GO:0043992
GO:0043993
GO:0043994
GO:0043995
GO:0043996
GO:0043997
GO:0043999
GO:0044012
GO:0044014
GO:0044015
GO:0044016
GO:0044017
GO:0044018
GO:0046972
GO:0140908
AF-A0A3D5Q448-F1-model_v4 MRP family ATP-binding protein 0.8567 38 114 GO:0005524
GO:0005829
GO:0016226
GO:0051539
AF-A0A124E8I9-F1-model_v4 Iron-sulfur cluster carrier protein 0.8561 36 115 GO:0005524
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663

Map