F467685

General Info

Members Datasets Scaffolds Average Seq Length
597 337 1194 275

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0103618|Ga0395900_0103618_1304_2197
Length 297
Sequence MASNKLLLITGVSSGFGHALARQALADGHRVVGTVRNAQAAESFEALCRGRAHARLLDVTQFDAIDDVVADIEANVGPVDILVNNAGYGHEGILEESPLSDLRRQFDVNVFGPVAMMKAVLPFMRARRRGHILNITSMGGYITMPGIAYYCGSKFALEGISDTLAKEVQPFGIAVTAIAPGSFRTDWAGRSMQRTPRSIADYDALFDPVRKAREEKNGKQLGDPAKAARALLAIIQAEAPPTHLLLGSDALHLVRSKLADLTRNLDLWEEVTTSTDMSSLHSPNRKNSSVWNDPRKL

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
58 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
105 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
110 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
120 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
121 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
122 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
125 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
126 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
127 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
215 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
252 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
260 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
263 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
264 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
265 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
266 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
267 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
268 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
269 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
270 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
271 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
272 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
273 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
274 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
275 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
276 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
277 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
278 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
279 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
280 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
281 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
282 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
283 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
284 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
285 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
286 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
287 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
288 2643221556 Massilia sp. Root1485 Isolate Unclassified
289 2643221684 Massilia sp. Root133 Isolate Unclassified
290 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
291 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
292 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
293 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
294 2739367700 Dyella sp. YR388 Isolate Unclassified
295 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
296 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
297 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
298 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
299 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
300 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
301 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
302 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
303 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
304 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
305 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
306 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
307 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
308 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
309 2855730933 Achromobacter sp. HZ28 Isolate Nodule
310 2855767633 Achromobacter sp. HZ34 Isolate Nodule
311 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
312 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
313 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
314 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
315 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
316 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
317 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
318 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
319 2904564687 Burkholderia sp. 571 Isolate Unclassified
320 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
321 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
322 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
323 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
324 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
325 2928536128 Burkholderia sola 565 Isolate Unclassified
326 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
327 2937967321 Serratia sp. YC16 Isolate Unclassified
328 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
329 2941471342 Luteibacter sp. 621 Isolate Unclassified
330 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
331 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
332 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
333 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
334 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
335 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
336 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
337 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.27
Metatranscriptomes 0
Isolates 12.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.58
Nodule 3.35
Rhizoplane 4.52
Rhizosphere 62.65
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0103618 3300037418 Bacteria 2922
2 JGI24736J21556_1001724 3300001904 Bacteria 3941
3 JGI24739J22299_10006189 3300001989 Bacteria 4519
4 JGI24737J22298_10000893 3300001990 Bacteria 10621
5 JGI25162J39368_1004421 3300002737 Bacteria 3276
6 JGI25152J39213_1003813 3300002773 Bacteria 4995
7 JGI25159J45721_1000427 3300002987 Bacteria 19387
8 JGI25153J46596_10008267 3300003215 Bacteria 4995
9 rootL2_10057614 3300003322 Bacteria 2916
10 rootL2_10121717 3300003322 Bacteria 4084
11 rootH1_10141536 3300003323 Bacteria 5852
12 JGI25160J50197_1000012 3300003354 Bacteria 267582
13 JGI25161J50226_1000002 3300003374 Bacteria 420324
14 Ga0055538_1000019 3300003751 Bacteria 282365
15 Ga0055539_1000024 3300003752 Bacteria 282365
16 Ga0055533_1000032 3300003756 Bacteria 282365
17 Ga0055533_1001916 3300003756 Bacteria 5138
18 Ga0055525_1000041 3300003759 Bacteria 282365
19 Ga0055527_1003675 3300003760 Bacteria 2224
20 Ga0055526_1000618 3300003771 Bacteria 27611
21 Ga0055526_1002058 3300003771 Bacteria 13825
22 Ga0055526_1018145 3300003771 Bacteria 2643
23 Ga0055537_1000600 3300003773 Bacteria 20010
24 Ga0055537_1001733 3300003773 Bacteria 8052
25 Ga0055524_1000607 3300003775 Bacteria 25734
26 Ga0055524_1002359 3300003775 Bacteria 9823
27 Ga0055524_1002882 3300003775 Bacteria 8610
28 Ga0055534_1000409 3300003784 Bacteria 26375
29 Ga0055528_1002313 3300003790 Bacteria 10323
30 Ga0055530_10002435 3300003791 Bacteria 12016
31 Ga0055540_1000023 3300003792 Bacteria 201131
32 Ga0055540_1000240 3300003792 Bacteria 50063
33 Ga0055540_1004561 3300003792 Bacteria 6168
34 Ga0055531_10016451 3300003794 Bacteria 3189
35 Ga0055541_1000018 3300003841 Bacteria 282365
36 Ga0055541_1005666 3300003841 Bacteria 2169
37 Ga0055543_1000050 3300004625 Bacteria 107366
38 Ga0070683_100030508 3300005329 Bacteria 4895
39 Ga0070680_100116054 3300005336 Bacteria 2231
40 Ga0070661_100002593 3300005344 Bacteria 12392
41 Ga0070659_100002014 3300005366 Bacteria 14521
42 Ga0070667_100000010 3300005367 Bacteria 273500
43 Ga0070663_100000413 3300005455 Bacteria 22436
44 Ga0070663_100063668 3300005455 Bacteria 2664
45 Ga0070663_100217323 3300005455 Bacteria 1499
46 Ga0070662_100001814 3300005457 Bacteria 13128
47 Ga0070681_10032130 3300005458 Bacteria 5268
48 Ga0068853_100025864 3300005539 Bacteria 4927
49 Ga0070665_100335385 3300005548 Bacteria 1517
50 Ga0068855_100220641 3300005563 Bacteria 2126
51 Ga0070717_10004621 3300006028 Bacteria 9976
52 Ga0075364_10001122 3300006051 Bacteria 14302
53 Ga0079104_1000333 3300006946 Bacteria 57718
54 Ga0099826_10000046 3300006948 Bacteria 75105
55 Ga0105251_10034837 3300009011 Bacteria 2488
56 Ga0105240_10009708 3300009093 Bacteria 13588
57 Ga0105240_10278976 3300009093 Bacteria 1920
58 Ga0105240_10286863 3300009093 Bacteria 1889
59 Ga0105240_10444745 3300009093 Bacteria 1452
60 Ga0105242_10309569 3300009176 Bacteria 1445
61 Ga0105248_10000240 3300009177 Bacteria 63265
62 Ga0105248_10122284 3300009177 Bacteria 2936
63 Ga0105248_10145626 3300009177 Unclassified 2673
64 Ga0105237_10000652 3300009545 Bacteria 48467
65 Ga0105237_10008925 3300009545 Bacteria 10798
66 Ga0105249_10000226 3300009553 Bacteria 64018
67 Ga0105239_10006412 3300010375 Bacteria 13657
68 Ga0157370_10068101 3300013104 Bacteria 3364
69 Ga0157370_10079805 3300013104 Bacteria 3081
70 Ga0157369_10053790 3300013105 Bacteria 4349
71 Ga0163162_10006013 3300013306 Bacteria 11745
72 Ga0182008_10000421 3300014497 Bacteria 32709
73 Ga0182008_10012129 3300014497 Bacteria 4557
74 Ga0182006_1015996 3300015261 Bacteria 3205
75 Ga0182006_1041833 3300015261 Bacteria 1798
76 Ga0182006_1068655 3300015261 Bacteria 1319
77 Ga0182006_1080115 3300015261 Bacteria 1193
78 Ga0182007_10000279 3300015262 Bacteria 33868
79 Ga0182007_10004019 3300015262 Bacteria 6785
80 Ga0182007_10006638 3300015262 Bacteria 4953
81 Ga0182005_1032684 3300015265 Bacteria 1416
82 Ga0183368_1002 3300015687 Bacteria 1865598
83 Ga0183360_10001 3300015689 Bacteria 3943671
84 Ga0213872_10001611 3300021361 Bacteria 14275
85 Ga0213872_10006306 3300021361 Bacteria 5978
86 Ga0209760_103311 3300025207 Bacteria 1438
87 Ga0209784_100009 3300025224 Bacteria 688031
88 Ga0209784_100010 3300025224 Bacteria 683664
89 Ga0209566_100007 3300025225 Bacteria 688031
90 Ga0209566_100008 3300025225 Bacteria 683664
91 Ga0209566_100220 3300025225 Bacteria 56957
92 Ga0209674_100016 3300025226 Bacteria 696756
93 Ga0209674_100018 3300025226 Bacteria 688031
94 Ga0209674_100019 3300025226 Bacteria 683664
95 Ga0209674_101276 3300025226 Bacteria 7021
96 Ga0209674_102528 3300025226 Bacteria 3865
97 Ga0209672_100644 3300025228 Bacteria 17971
98 Ga0209563_100020 3300025230 Bacteria 688031
99 Ga0209563_100021 3300025230 Bacteria 683764
100 Ga0207427_100991 3300025231 Bacteria 11960
101 Ga0209437_100019 3300025233 Bacteria 683764
102 Ga0209437_112438 3300025233 Bacteria 1241
103 Ga0209677_100010 3300025253 Bacteria 688031
104 Ga0209677_100011 3300025253 Bacteria 683664
105 Ga0209148_1003324 3300025254 Bacteria 4531
106 Ga0209129_1000535 3300025258 Bacteria 26444
107 Ga0209233_1000025 3300025261 Bacteria 683764
108 Ga0209565_1000003 3300025263 Bacteria 1099648
109 Ga0209565_1000094 3300025263 Bacteria 134853
110 Ga0209455_1002471 3300025272 Bacteria 7106
111 Ga0209673_1000003 3300025273 Bacteria 980859
112 Ga0209130_1000028 3300025284 Bacteria 325668
113 Ga0209675_1000003 3300025291 Bacteria 1003982
114 Ga0209676_1000068 3300025292 Bacteria 314068
115 Ga0209676_1006666 3300025292 Bacteria 5629
116 Ga0209676_1021191 3300025292 Bacteria 2189
117 Ga0209564_1000509 3300025295 Bacteria 63951
118 Ga0209564_1000614 3300025295 Bacteria 54746
119 Ga0209758_1001399 3300025297 Bacteria 28640
120 Ga0209758_1014100 3300025297 Bacteria 4286
121 Ga0209050_1000287 3300025298 Bacteria 106507
122 Ga0209050_1001298 3300025298 Bacteria 28251
123 Ga0209050_1003335 3300025298 Bacteria 11970
124 Ga0209256_1000029 3300025299 Bacteria 415922
125 Ga0209256_1001721 3300025299 Bacteria 20987
126 Ga0209256_1010972 3300025299 Bacteria 3703
127 Ga0207426_1000012 3300025302 Bacteria 730942
128 Ga0209051_1000079 3300025303 Bacteria 201183
129 Ga0209051_1000199 3300025303 Bacteria 106517
130 Ga0209051_1055135 3300025303 Bacteria 1292
131 Ga0209257_1000183 3300025304 Bacteria 156618
132 Ga0209257_1007945 3300025304 Bacteria 6219
133 Ga0207655_1000322 3300025728 Bacteria 70535
134 Ga0207647_10000196 3300025904 Bacteria 49500
135 Ga0207647_10030710 3300025904 Bacteria 3464
136 Ga0207647_10056669 3300025904 Bacteria 2404
137 Ga0207647_10099990 3300025904 Bacteria 1722
138 Ga0207707_10018916 3300025912 Bacteria 6005
139 Ga0207695_10012652 3300025913 Bacteria 10108
140 Ga0207695_10015040 3300025913 Bacteria 9132
141 Ga0207671_10004902 3300025914 Bacteria 12573
142 Ga0207671_10006203 3300025914 Bacteria 10730
143 Ga0207657_10012791 3300025919 Bacteria 8259
144 Ga0207649_10002545 3300025920 Bacteria 10151
145 Ga0207652_10512561 3300025921 Bacteria 1079
146 Ga0207690_10003042 3300025932 Bacteria 10100
147 Ga0207706_10009190 3300025933 Bacteria 9081
148 Ga0207709_10006106 3300025935 Bacteria 6786
149 Ga0207711_10000860 3300025941 Bacteria 29387
150 Ga0207661_10031964 3300025944 Bacteria 4072
151 Ga0207667_10056417 3300025949 Bacteria 4127
152 Ga0207712_10000141 3300025961 Bacteria 75812
153 Ga0207658_10000297 3300025986 Bacteria 52019
154 Ga0207639_10028174 3300026041 Bacteria 4099
155 Ga0207678_10000223 3300026067 Bacteria 50785
156 Ga0207678_10089893 3300026067 Bacteria 2625
157 Ga0207678_10166859 3300026067 Bacteria 1880
158 Ga0207683_10251162 3300026121 Bacteria 1614
159 Ga0209281_1000322 3300027111 Bacteria 84374
160 Ga0209371_1002265 3300027312 Bacteria 11029
161 Ga0209371_1006679 3300027312 Bacteria 4208
162 Ga0209371_1011230 3300027312 Bacteria 2674
163 Ga0209282_1000011 3300027666 Bacteria 217665
164 Ga0268266_10036078 3300028379 Bacteria 4206
165 Ga0268266_10150630 3300028379 Bacteria 2096
166 Ga0268266_10212231 3300028379 Bacteria 1776
167 Ga0307517_10160444 3300028786 Bacteria 1511
168 Ga0268256_1002005 3300030500 Bacteria 11029
169 Ga0268256_1006761 3300030500 Bacteria 4208
170 Ga0268256_1012185 3300030500 Bacteria 2674
171 Ga0316183_1048625 3300030742 Bacteria 7746
172 Ga0307412_10011865 3300031911 Bacteria 5060
173 Ga0307409_100105249 3300031995 Bacteria 2352
174 Ga0307416_100086071 3300032002 Bacteria 2678
175 Ga0395899_0002835 3300037312 Bacteria 13961
176 Ga0395899_0005349 3300037312 Bacteria 9973
177 Ga0395899_0014986 3300037312 Bacteria 5913
178 Ga0395899_0071705 3300037312 Bacteria 2535
179 Ga0395899_0116867 3300037312 Bacteria 1913
180 Ga0395900_0011239 3300037418 Bacteria 9155
181 Ga0395900_0034627 3300037418 Bacteria 5201
182 Ga0395900_0063807 3300037418 Bacteria 3786
183 Ga0395898_0036832 3300037466 Bacteria 4855
184 Ga0395898_0125160 3300037466 Bacteria 2462
185 Ga0395898_0135857 3300037466 Bacteria 2354
186 Ga0395905_0000864 3300037471 Bacteria 39520
187 Ga0395905_0037101 3300037471 Bacteria 4577
188 Ga0395905_0124819 3300037471 Bacteria 2420
189 Ga0395905_0159905 3300037471 Bacteria 2117
190 Ga0395901_0000009 3300038443 Bacteria 479396
191 Ga0395901_0000122 3300038443 Bacteria 100003
192 Ga0395901_0013989 3300038443 Bacteria 8166
193 Ga0395901_0018611 3300038443 Bacteria 7094
194 Ga0436361_0204659 3300039447 Bacteria 10676
195 Ga0436361_0234917 3300039447 Bacteria 14328
196 Ga0436361_0860790 3300039447 Bacteria 5296
197 Ga0451797_1290501 3300041453 Bacteria 1451
198 Ga0451795_0693632 3300041456 Bacteria 4113
199 Ga0451800_1495546 3300041459 Bacteria 4092
200 Ga0451802_0538624 3300041460 Bacteria 2984
201 Ga0451807_0295110 3300041486 Bacteria 3508
202 Ga0451855_0476812 3300041511 Bacteria 1100
203 Ga0439451_000430 3300042009 Bacteria 8194
204 Ga0439456_001098 3300042013 Bacteria 5366
205 Ga0439456_001555 3300042013 Bacteria 4623
206 Ga0439463_006543 3300042016 Bacteria 2887
207 Ga0466972_0138656 3300044658 Bacteria 1145
208 Ga0466982_0000040 3300044672 Bacteria 41234
209 Ga0466982_0096822 3300044672 Bacteria 1828
210 Ga0466965_0014160 3300044683 Bacteria 3774
211 Ga0466965_0103556 3300044683 Bacteria 1457
212 Ga0466966_0000043 3300044684 Bacteria 93998
213 Ga0466966_0086778 3300044684 Bacteria 1945
214 Ga0466966_0229381 3300044684 Bacteria 1120
215 Ga0466961_0000276 3300044693 Bacteria 34281
216 Ga0466961_0000399 3300044693 Bacteria 27917
217 Ga0466961_0001254 3300044693 Bacteria 15642
218 Ga0466961_0002248 3300044693 Bacteria 12016
219 Ga0466961_0021631 3300044693 Bacteria 4138
220 Ga0466961_0084273 3300044693 Bacteria 2010
221 Ga0466963_0013925 3300044694 Bacteria 4953
222 Ga0466971_0006143 3300044719 Bacteria 5222
223 Ga0466971_0018270 3300044719 Bacteria 3105
224 Ga0466970_0025215 3300044765 Bacteria 3113
225 Ga0466957_0034600 3300044842 Bacteria 3030
226 Ga0466957_0034805 3300044842 Bacteria 3021
227 Ga0466957_0276053 3300044842 Bacteria 1123
228 Ga0466959_0000058 3300045049 Bacteria 77145
229 Ga0466959_0006194 3300045049 Bacteria 8265
230 Ga0466959_0014441 3300045049 Bacteria 5737
231 Ga0466959_0061661 3300045049 Bacteria 2726
232 Ga0466959_0538980 3300045049 Bacteria 787
233 Ga0466958_0003683 3300045836 Bacteria 7999
234 Ga0466958_0004961 3300045836 Bacteria 7099
235 Ga0466958_0009639 3300045836 Bacteria 5387
236 Ga0466958_0011537 3300045836 Bacteria 4977
237 Ga0495617_000004 3300046452 Bacteria 511274
238 Ga0495627_000001 3300046453 Bacteria 1104709
239 Ga0495592_0003426 3300046454 Bacteria 11380
240 Ga0495603_0024474 3300046455 Bacteria 3651
241 Ga0495603_0027886 3300046455 Bacteria 3405
242 Ga0495603_0051840 3300046455 Bacteria 2437
243 Ga0495590_0028547 3300046457 Bacteria 1956
244 Ga0495590_0059417 3300046457 Bacteria 1337
245 Ga0495591_060250 3300046458 Bacteria 1010
246 Ga0495629_0002611 3300046459 Bacteria 13809
247 Ga0495629_0003779 3300046459 Bacteria 11400
248 Ga0495638_0000011 3300046460 Bacteria 442453
249 Ga0495638_0000052 3300046460 Bacteria 203695
250 Ga0495641_0012418 3300046461 Bacteria 4766
251 Ga0495651_0027687 3300046462 Bacteria 4417
252 Ga0495651_0257932 3300046462 Bacteria 1187
253 Ga0495653_0015446 3300046463 Bacteria 6224
254 Ga0495650_0000015 3300046471 Bacteria 557595
255 Ga0495650_0000145 3300046471 Bacteria 164687
256 Ga0495650_0001196 3300046471 Bacteria 27428
257 Ga0495650_0003003 3300046471 Bacteria 12750
258 Ga0495650_0016591 3300046471 Bacteria 3725
259 Ga0495650_0026303 3300046471 Bacteria 2709
260 Ga0495650_0030988 3300046471 Bacteria 2413
261 Ga0495650_0035756 3300046471 Bacteria 2183
262 Ga0495580_0005559 3300046472 Bacteria 10392
263 Ga0495580_0006174 3300046472 Bacteria 9793
264 Ga0495580_0035146 3300046472 Bacteria 3604
265 Ga0495580_0276432 3300046472 Bacteria 1146
266 Ga0495582_0011266 3300046473 Bacteria 4927
267 Ga0495605_0000222 3300046474 Bacteria 70142
268 Ga0495605_0000286 3300046474 Bacteria 55733
269 Ga0495605_0042317 3300046474 Bacteria 2265
270 Ga0495639_0029766 3300046475 Bacteria 2424
271 Ga0495664_0025951 3300046477 Bacteria 3411
272 Ga0495664_0181293 3300046477 Bacteria 1277
273 Ga0495584_0040929 3300046491 Bacteria 2339
274 Ga0495584_0085295 3300046491 Bacteria 1591
275 Ga0495585_0010318 3300046492 Bacteria 5568
276 Ga0495585_0041098 3300046492 Bacteria 2594
277 Ga0495594_0030303 3300046499 Bacteria 2925
278 Ga0495596_0000094 3300046500 Bacteria 62938
279 Ga0495596_0003209 3300046500 Bacteria 8403
280 Ga0495607_0000025 3300046501 Bacteria 159379
281 Ga0495607_0000507 3300046501 Bacteria 38608
282 Ga0495607_0000517 3300046501 Bacteria 38004
283 Ga0495607_0005537 3300046501 Bacteria 9009
284 Ga0495607_0014088 3300046501 Bacteria 5219
285 Ga0495607_0024269 3300046501 Bacteria 3783
286 Ga0495583_0000086 3300046506 Bacteria 165176
287 Ga0495583_0005819 3300046506 Bacteria 8230
288 Ga0495583_0015018 3300046506 Bacteria 4234
289 Ga0495606_0001737 3300046507 Bacteria 27992
290 Ga0495606_0045044 3300046507 Bacteria 2928
291 Ga0495606_0053398 3300046507 Bacteria 2622
292 Ga0495606_0192140 3300046507 Bacteria 1169
293 Ga0495608_0000402 3300046511 Bacteria 30297
294 Ga0495610_0003962 3300046512 Bacteria 11204
295 Ga0495610_0044766 3300046512 Bacteria 2194
296 Ga0495616_0000615 3300046513 Bacteria 26805
297 Ga0495616_0015812 3300046513 Bacteria 4187
298 Ga0495616_0047588 3300046513 Bacteria 2159
299 Ga0495618_0003285 3300046514 Bacteria 10124
300 Ga0495620_0000021 3300046515 Bacteria 139145
301 Ga0495628_0011358 3300046516 Bacteria 7533
302 Ga0495630_0001299 3300046517 Bacteria 17218
303 Ga0495630_0010276 3300046517 Bacteria 6753
304 Ga0495630_0137201 3300046517 Bacteria 1859
305 Ga0495631_0000419 3300046518 Bacteria 29233
306 Ga0495631_0002033 3300046518 Bacteria 11776
307 Ga0495632_0000062 3300046519 Bacteria 118205
308 Ga0495632_0012426 3300046519 Bacteria 4914
309 Ga0495632_0040375 3300046519 Bacteria 2350
310 Ga0495632_0045548 3300046519 Bacteria 2184
311 Ga0495637_0006422 3300046520 Bacteria 5901
312 Ga0495637_0038547 3300046520 Bacteria 2068
313 Ga0495643_0000254 3300046522 Bacteria 78711
314 Ga0495643_0002050 3300046522 Bacteria 16731
315 Ga0495643_0052380 3300046522 Bacteria 2191
316 Ga0495643_0055049 3300046522 Bacteria 2127
317 Ga0495644_0001820 3300046523 Bacteria 8596
318 Ga0495648_0000036 3300046524 Bacteria 195997
319 Ga0495648_0005508 3300046524 Bacteria 10501
320 Ga0495648_0026034 3300046524 Bacteria 3947
321 Ga0495666_0028716 3300046526 Bacteria 2736
322 Ga0495642_0000753 3300046528 Bacteria 15922
323 Ga0495652_0001389 3300046529 Bacteria 26896
324 Ga0495652_0020680 3300046529 Bacteria 5851
325 Ga0495652_0303464 3300046529 Bacteria 1160
326 Ga0495654_0010930 3300046530 Bacteria 4932
327 Ga0495654_0011832 3300046530 Bacteria 4708
328 Ga0495665_0000013 3300046531 Bacteria 68469
329 Ga0495665_0027212 3300046531 Bacteria 3070
330 Ga0495665_0058796 3300046531 Bacteria 2029
331 Ga0495640_0005984 3300046533 Bacteria 9645
332 Ga0495586_0000740 3300046535 Bacteria 18711
333 Ga0495586_0022328 3300046535 Bacteria 3377
334 Ga0495586_0255445 3300046535 Bacteria 1000
335 Ga0495609_0000148 3300046538 Bacteria 72666
336 Ga0495609_0000162 3300046538 Bacteria 69584
337 Ga0495609_0003010 3300046538 Bacteria 9938
338 Ga0495609_0003367 3300046538 Bacteria 9197
339 Ga0495609_0007175 3300046538 Bacteria 5595
340 Ga0495597_0000011 3300046542 Bacteria 221377
341 Ga0495597_0000622 3300046542 Bacteria 28970
342 Ga0495597_0080819 3300046542 Bacteria 1390
343 Ga0495645_0003033 3300046543 Bacteria 11361
344 Ga0495645_0060302 3300046543 Bacteria 2750
345 Ga0495645_0134168 3300046543 Bacteria 1733
346 Ga0495622_0000420 3300046557 Bacteria 28044
347 Ga0495622_0014484 3300046557 Bacteria 3662
348 Ga0495622_0045531 3300046557 Bacteria 2038
349 Ga0495633_0002844 3300046558 Bacteria 11920
350 Ga0495667_0097743 3300046559 Bacteria 1901
351 Ga0495656_0010072 3300046615 Bacteria 3423
352 Ga0495656_0098584 3300046615 Bacteria 1348
353 Ga0495634_0014990 3300046642 Bacteria 5574
354 Ga0495634_0132339 3300046642 Bacteria 1589
355 Ga0495625_0000861 3300046660 Bacteria 41279
356 Ga0495625_0005899 3300046660 Bacteria 11023
357 Ga0495625_0020323 3300046660 Bacteria 5129
358 Ga0495625_0026662 3300046660 Bacteria 4363
359 Ga0495625_0126567 3300046660 Bacteria 1734
360 Ga0495661_0008155 3300046665 Bacteria 7262
361 Ga0495661_0013328 3300046665 Bacteria 5526
362 Ga0495661_0024502 3300046665 Bacteria 3905
363 Ga0495661_0040225 3300046665 Bacteria 2901
364 Ga0495588_0000094 3300046674 Bacteria 176169
365 Ga0495588_0011084 3300046674 Bacteria 4220
366 Ga0495623_0016063 3300046679 Bacteria 4836
367 Ga0495613_0002059 3300046689 Bacteria 15283
368 Ga0495613_0026646 3300046689 Bacteria 4306
369 Ga0495624_0022984 3300046690 Bacteria 4114
370 Ga0495670_0034450 3300046691 Bacteria 2522
371 Ga0495670_0123880 3300046691 Bacteria 1344
372 Ga0495671_0012193 3300046692 Bacteria 4698
373 Ga0495671_0074290 3300046692 Bacteria 1668
374 Ga0495649_0001301 3300046694 Bacteria 19082
375 Ga0495649_0003036 3300046694 Bacteria 11514
376 Ga0495649_0032015 3300046694 Bacteria 2899
377 Ga0495649_0061955 3300046694 Bacteria 2011
378 Ga0495649_0134872 3300046694 Bacteria 1302
379 Ga0495589_0000011 3300046794 Bacteria 250370
380 Ga0495589_0000025 3300046794 Bacteria 185024
381 Ga0495589_0000359 3300046794 Bacteria 35371
382 Ga0495589_0003728 3300046794 Bacteria 8215
383 Ga0495589_0009673 3300046794 Bacteria 5010
384 Ga0495589_0096031 3300046794 Bacteria 1437
385 Ga0495600_0004412 3300046809 Bacteria 8415
386 Ga0495600_0026717 3300046809 Bacteria 3727
387 Ga0495660_0000299 3300046810 Bacteria 45148
388 Ga0495660_0001104 3300046810 Bacteria 19276
389 Ga0495660_0003415 3300046810 Bacteria 9832
390 Ga0495660_0008788 3300046810 Bacteria 5898
391 Ga0495660_0015920 3300046810 Bacteria 4340
392 Ga0495660_0022997 3300046810 Bacteria 3556
393 Ga0495660_0025436 3300046810 Bacteria 3362
394 Ga0495660_0056938 3300046810 Bacteria 2110
395 Ga0495581_0002574 3300047315 Bacteria 10304
396 Ga0495581_0016672 3300047315 Bacteria 4271
397 Ga0495581_0017953 3300047315 Bacteria 4111
398 Ga0495604_0017105 3300047317 Bacteria 5800
399 Ga0495636_0265275 3300047318 Bacteria 797
400 Ga0495674_0056904 3300047319 Bacteria 3423
401 Ga0495672_0000090 3300047320 Bacteria 148367
402 Ga0495672_0000222 3300047320 Bacteria 81058
403 Ga0495672_0001124 3300047320 Bacteria 27126
404 Ga0495672_0028143 3300047320 Bacteria 3561
405 Ga0495672_0032587 3300047320 Bacteria 3239
406 Ga0495672_0050021 3300047320 Bacteria 2471
407 Ga0495676_0000004 3300047321 Bacteria 313696
408 Ga0495680_0024717 3300047322 Bacteria 4979
409 Ga0495680_0108806 3300047322 Bacteria 2056
410 Ga0495683_0001821 3300047323 Bacteria 13414
411 Ga0495687_000402 3300047443 Bacteria 53513
412 Ga0495687_001224 3300047443 Bacteria 24532
413 Ga0495687_033370 3300047443 Bacteria 2336
414 Ga0495687_046645 3300047443 Bacteria 1869
415 Ga0495675_0012921 3300047444 Bacteria 5262
416 Ga0495675_0109921 3300047444 Bacteria 1721
417 Ga0495677_0001975 3300047445 Bacteria 8183
418 Ga0495679_016467 3300047446 Bacteria 2674
419 Ga0495673_0007807 3300047469 Bacteria 6092
420 Ga0495673_0061273 3300047469 Bacteria 1611
421 Ga0495681_0003969 3300047470 Bacteria 10195
422 Ga0495681_0097439 3300047470 Bacteria 1290
423 Ga0495684_0500145 3300047471 Bacteria 836
424 Ga0495686_0000213 3300047472 Bacteria 107285
425 Ga0495602_0069178 3300048088 Bacteria 3027
426 Ga0495614_0000269 3300048089 Bacteria 20268
427 Ga0495626_0000017 3300048091 Bacteria 231648
428 Ga0495626_0000022 3300048091 Bacteria 216166
429 Ga0495626_0008220 3300048091 Bacteria 5745
430 Ga0495626_0071628 3300048091 Bacteria 1557
431 Ga0496100_0000094 3300048903 Bacteria 50690
432 Ga0496100_0016531 3300048903 Bacteria 4335
433 Ga0496101_0000181 3300048904 Bacteria 50837
434 Ga0496101_0086586 3300048904 Bacteria 2324
435 Ga0496102_0000397 3300048905 Bacteria 50794
436 Ga0496102_0005182 3300048905 Bacteria 11066
437 Ga0496102_0125415 3300048905 Bacteria 2400
438 Ga0496103_0003529 3300048906 Bacteria 9559
439 Ga0496104_0049105 3300048907 Bacteria 3979
440 Ga0496104_0117559 3300048907 Bacteria 2552
441 Ga0496106_0004030 3300048909 Bacteria 10981
442 Ga0496109_0410543 3300048912 Bacteria 1279
443 Ga0496113_0019743 3300048916 Bacteria 4723
444 Ga0496113_0024821 3300048916 Bacteria 4266
445 Ga0496115_0000072 3300048918 Bacteria 91408
446 Ga0496115_0000462 3300048918 Bacteria 32479
447 Ga0496115_0004247 3300048918 Bacteria 10360
448 Ga0496116_0021352 3300048919 Bacteria 4886
449 Ga0496116_0028808 3300048919 Bacteria 4016
450 Ga0496117_0000210 3300048920 Bacteria 112808
451 Ga0496117_0054473 3300048920 Bacteria 2802
452 Ga0496118_0000788 3300048921 Bacteria 50781
453 Ga0496118_0004274 3300048921 Bacteria 17088
454 Ga0496118_0069268 3300048921 Bacteria 2556
455 Ga0496119_0081827 3300048922 Bacteria 1858
456 Ga0496121_0000290 3300048924 Bacteria 104280
457 Ga0496121_0000457 3300048924 Bacteria 80467
458 Ga0496121_0025456 3300048924 Bacteria 5612
459 Ga0496121_0026631 3300048924 Bacteria 5439
460 Ga0496121_0032295 3300048924 Bacteria 4763
461 Ga0496121_0125786 3300048924 Bacteria 1927
462 Ga0496121_0135553 3300048924 Bacteria 1835
463 Ga0496121_0137011 3300048924 Bacteria 1822
464 Ga0496122_0000473 3300048925 Bacteria 83672
465 Ga0496122_0013578 3300048925 Bacteria 7955
466 Ga0496122_0022284 3300048925 Bacteria 5637
467 Ga0496122_0026840 3300048925 Bacteria 4947
468 Ga0496122_0133962 3300048925 Bacteria 1566
469 Ga0496123_0000029 3300048926 Bacteria 295871
470 Ga0496123_0000857 3300048926 Bacteria 48563
471 Ga0496123_0001289 3300048926 Bacteria 35761
472 Ga0496123_0011972 3300048926 Bacteria 7444
473 Ga0496123_0122015 3300048926 Bacteria 1463
474 Ga0496123_0131021 3300048926 Bacteria 1389
475 Ga0496124_0000004 3300048927 Bacteria 976131
476 Ga0496124_0000022 3300048927 Bacteria 421020
477 Ga0496124_0006294 3300048927 Bacteria 12973
478 Ga0496124_0138827 3300048927 Bacteria 1920
479 Ga0496124_0207089 3300048927 Bacteria 1487
480 Ga0496124_0262460 3300048927 Bacteria 1270
481 Ga0496124_0424440 3300048927 Bacteria 915
482 Ga0496125_0000945 3300048928 Bacteria 45641
483 Ga0496125_0007717 3300048928 Bacteria 11397
484 Ga0496125_0008590 3300048928 Bacteria 10665
485 Ga0496125_0021684 3300048928 Bacteria 5980
486 Ga0496125_0080826 3300048928 Bacteria 2486
487 Ga0496126_0000426 3300048929 Bacteria 84838
488 Ga0496126_0014182 3300048929 Bacteria 8066
489 Ga0496126_0017267 3300048929 Bacteria 7190
490 Ga0496126_0066652 3300048929 Bacteria 3219
491 Ga0496126_0149775 3300048929 Bacteria 2000
492 Ga0496126_0150287 3300048929 Bacteria 1997
493 Ga0496126_0203448 3300048929 Bacteria 1671
494 Ga0495678_000803 3300049459 Bacteria 28133
495 Ga0495678_006770 3300049459 Bacteria 6037
496 Ga0495678_031274 3300049459 Bacteria 2221
497 Ga0495682_0002612 3300049460 Bacteria 8446
498 Ga0501033_0004413 3300049570 Bacteria 11258
499 Ga0501033_0444188 3300049570 Bacteria 901
500 Ga0501034_0126776 3300049571 Bacteria 2537
501 Ga0501036_0327181 3300049572 Bacteria 1280
502 Ga0501042_0168551 3300049578 Bacteria 1580
503 Ga0501047_0006878 3300049581 Bacteria 10687
504 Ga0501047_0570809 3300049581 Bacteria 954
505 Ga0500643_000121 3300053087 Bacteria 81461
506 Ga0500646_0006759 3300053090 Bacteria 2919
507 Ga0500651_0169174 3300053093 Bacteria 1304
508 Ga0500618_001370 3300053125 Bacteria 11048
509 Ga0500618_010436 3300053125 Bacteria 2492
510 Ga0500652_000047 3300053131 Bacteria 58171
511 Ga0500559_0029513 3300053136 Bacteria 2349
512 Ga0500568_0000339 3300053139 Bacteria 36709
513 Ga0500586_000044 3300053145 Bacteria 21646
514 Ga0500604_0003627 3300053151 Bacteria 4154
515 Ga0500616_0001844 3300053153 Bacteria 19195
516 Ga0500616_0008875 3300053153 Bacteria 6178
517 Ga0500622_0000043 3300053156 Bacteria 161080
518 Ga0500634_0022277 3300053161 Bacteria 3437
519 Ga0500570_000097 3300053724 Bacteria 24774
520 Ga0466962_0003548 3300061719 Bacteria 7429
521 Ga0466962_0073090 3300061719 Bacteria 1638
522 2501075255 2501025501 Bacteria 7768574
523 2501081241 2501025502 Bacteria 9641094
524 2501411570 2501025504 Bacteria 8008976
525 2508853961 2508501071 Bacteria 5454741
526 2509131979 2508501125 Bacteria 7208311
527 2510250164 2510065045 Bacteria 7761063
528 2511094303 2510917013 Bacteria 9951648
529 2511099541 2510917014 Bacteria 8296963
530 2511106715 2510917015 Bacteria 7950052
531 2511134651 2510917022 Bacteria 6504556
532 2512350600 2512047030 Bacteria 9031815
533 2512643955 2512564014 Bacteria 4639632
534 2513865995 2513237138 Bacteria 7368160
535 2513962039 2513237151 Bacteria 6309801
536 2515689626 2515154123 Bacteria 6387382
537 2516023241 2515154189 Bacteria 9629850
538 2585231602 2582581299 Bacteria 6518058
539 2585273732 2582581307 Bacteria 6597605
540 2585559906 2585427531 Bacteria 6992870
541 2585905916 2585427609 Bacteria 6667127
542 2587978969 2585428125 Bacteria 6662905
543 2599745199 2599185240 Bacteria 7968121
544 2599970551 2599185307 Bacteria 6194719
545 2599997184 2599185311 Bacteria 6354990
546 2600206620 2599185355 Bacteria 7968906
547 2617380463 2617270742 Bacteria 6808054
548 2643799550 2643221556 Bacteria 7251154
549 2644471640 2643221684 Bacteria 7145183
550 2676743072 2675903129 Bacteria 7964495
551 2687581314 2687453130 Bacteria 4227172
552 2689994454 2687453743 Bacteria 8361025
553 2719639318 2718217991 Bacteria 7829542
554 2739730443 2739367700 Bacteria 4747630
555 2746091396 2744054900 Bacteria 8399525
556 2746097290 2744054901 Bacteria 8397047
557 2772439803 2772190666 Bacteria 5117644
558 2792833504 2791355137 Bacteria 9654227
559 2807178073 2806310673 Bacteria 4801221
560 2808973877 2808606384 Bacteria 8474373
561 2809008681 2808606390 Bacteria 8476311
562 2809015813 2808606391 Bacteria 8308166
563 2816516853 2816332141 Bacteria 4436036
564 2842326505 2842324504 Bacteria 9364110
565 2842350976 2842348783 Bacteria 9002918
566 2842455813 2842454564 Bacteria 8730687
567 2842783116 2842780639 Bacteria 4337790
568 2852388212 2852387548 Bacteria 8025568
569 2855731273 2855730933 Bacteria 7047938
570 2855767961 2855767633 Bacteria 7049357
571 2857365155 2857357740 Bacteria 9937880
572 2857545634 2857542790 Bacteria 5326616
573 2870076303 2870068957 Bacteria 8925310
574 2881413838 2881412998 Bacteria 6492157
575 2881610237 2881609920 Bacteria 4405319
576 2883093571 2883087390 Bacteria 9532701
577 2884339501 2884338543 Bacteria 4610696
578 2904484761 2904483920 Bacteria 7545285
579 2904567160 2904564687 Bacteria 7609577
580 2904573896 2904571731 Bacteria 7608790
581 2904621116 2904615490 Bacteria 10047340
582 2919047323 2919046199 Bacteria 5567169
583 2921643604 2921643360 Bacteria 11448031
584 2923591547 2923586266 Bacteria 6565975
585 2928541023 2928536128 Bacteria 7657547
586 2931371553 2931369376 Bacteria 6847892
587 2937968452 2937967321 Bacteria 5094075
588 2939629344 2939626828 Bacteria 4695272
589 2941473919 2941471342 Bacteria 5018624
590 2947238012 2947233263 Bacteria 6439278
591 3007721986 3007718800 Bacteria 5971527
592 8045865694 8045864390 Bacteria 5043873
593 8046770925 8046767195 Bacteria 7547379
594 8047675949 8047673197 Bacteria 7395230
595 8053947665 8053945823 Bacteria 8962862
596 8055273239 8055266321 Bacteria 7999742
597 8056215061 8056207758 Bacteria 8639239
598 Ga0395900_0103618
599 JGI24736J21556_1001724
600 JGI24739J22299_10006189
601 JGI24737J22298_10000893
602 JGI25162J39368_1004421
603 JGI25152J39213_1003813
604 JGI25159J45721_1000427
605 JGI25153J46596_10008267
606 rootL2_10057614
607 rootL2_10121717
608 rootH1_10141536
609 JGI25160J50197_1000012
610 JGI25161J50226_1000002
611 Ga0055538_1000019
612 Ga0055539_1000024
613 Ga0055533_1000032
614 Ga0055533_1001916
615 Ga0055525_1000041
616 Ga0055527_1003675
617 Ga0055526_1000618
618 Ga0055526_1002058
619 Ga0055526_1018145
620 Ga0055537_1000600
621 Ga0055537_1001733
622 Ga0055524_1000607
623 Ga0055524_1002359
624 Ga0055524_1002882
625 Ga0055534_1000409
626 Ga0055528_1002313
627 Ga0055530_10002435
628 Ga0055540_1000023
629 Ga0055540_1000240
630 Ga0055540_1004561
631 Ga0055531_10016451
632 Ga0055541_1000018
633 Ga0055541_1005666
634 Ga0055543_1000050
635 Ga0070683_100030508
636 Ga0070680_100116054
637 Ga0070661_100002593
638 Ga0070659_100002014
639 Ga0070667_100000010
640 Ga0070663_100000413
641 Ga0070663_100063668
642 Ga0070663_100217323
643 Ga0070662_100001814
644 Ga0070681_10032130
645 Ga0068853_100025864
646 Ga0070665_100335385
647 Ga0068855_100220641
648 Ga0070717_10004621
649 Ga0075364_10001122
650 Ga0079104_1000333
651 Ga0099826_10000046
652 Ga0105251_10034837
653 Ga0105240_10009708
654 Ga0105240_10278976
655 Ga0105240_10286863
656 Ga0105240_10444745
657 Ga0105242_10309569
658 Ga0105248_10000240
659 Ga0105248_10122284
660 Ga0105248_10145626
661 Ga0105237_10000652
662 Ga0105237_10008925
663 Ga0105249_10000226
664 Ga0105239_10006412
665 Ga0157370_10068101
666 Ga0157370_10079805
667 Ga0157369_10053790
668 Ga0163162_10006013
669 Ga0182008_10000421
670 Ga0182008_10012129
671 Ga0182006_1015996
672 Ga0182006_1041833
673 Ga0182006_1068655
674 Ga0182006_1080115
675 Ga0182007_10000279
676 Ga0182007_10004019
677 Ga0182007_10006638
678 Ga0182005_1032684
679 Ga0183368_1002
680 Ga0183360_10001
681 Ga0213872_10001611
682 Ga0213872_10006306
683 Ga0209760_103311
684 Ga0209784_100009
685 Ga0209784_100010
686 Ga0209566_100007
687 Ga0209566_100008
688 Ga0209566_100220
689 Ga0209674_100016
690 Ga0209674_100018
691 Ga0209674_100019
692 Ga0209674_101276
693 Ga0209674_102528
694 Ga0209672_100644
695 Ga0209563_100020
696 Ga0209563_100021
697 Ga0207427_100991
698 Ga0209437_100019
699 Ga0209437_112438
700 Ga0209677_100010
701 Ga0209677_100011
702 Ga0209148_1003324
703 Ga0209129_1000535
704 Ga0209233_1000025
705 Ga0209565_1000003
706 Ga0209565_1000094
707 Ga0209455_1002471
708 Ga0209673_1000003
709 Ga0209130_1000028
710 Ga0209675_1000003
711 Ga0209676_1000068
712 Ga0209676_1006666
713 Ga0209676_1021191
714 Ga0209564_1000509
715 Ga0209564_1000614
716 Ga0209758_1001399
717 Ga0209758_1014100
718 Ga0209050_1000287
719 Ga0209050_1001298
720 Ga0209050_1003335
721 Ga0209256_1000029
722 Ga0209256_1001721
723 Ga0209256_1010972
724 Ga0207426_1000012
725 Ga0209051_1000079
726 Ga0209051_1000199
727 Ga0209051_1055135
728 Ga0209257_1000183
729 Ga0209257_1007945
730 Ga0207655_1000322
731 Ga0207647_10000196
732 Ga0207647_10030710
733 Ga0207647_10056669
734 Ga0207647_10099990
735 Ga0207707_10018916
736 Ga0207695_10012652
737 Ga0207695_10015040
738 Ga0207671_10004902
739 Ga0207671_10006203
740 Ga0207657_10012791
741 Ga0207649_10002545
742 Ga0207652_10512561
743 Ga0207690_10003042
744 Ga0207706_10009190
745 Ga0207709_10006106
746 Ga0207711_10000860
747 Ga0207661_10031964
748 Ga0207667_10056417
749 Ga0207712_10000141
750 Ga0207658_10000297
751 Ga0207639_10028174
752 Ga0207678_10000223
753 Ga0207678_10089893
754 Ga0207678_10166859
755 Ga0207683_10251162
756 Ga0209281_1000322
757 Ga0209371_1002265
758 Ga0209371_1006679
759 Ga0209371_1011230
760 Ga0209282_1000011
761 Ga0268266_10036078
762 Ga0268266_10150630
763 Ga0268266_10212231
764 Ga0307517_10160444
765 Ga0268256_1002005
766 Ga0268256_1006761
767 Ga0268256_1012185
768 Ga0316183_1048625
769 Ga0307412_10011865
770 Ga0307409_100105249
771 Ga0307416_100086071
772 Ga0395899_0002835
773 Ga0395899_0005349
774 Ga0395899_0014986
775 Ga0395899_0071705
776 Ga0395899_0116867
777 Ga0395900_0011239
778 Ga0395900_0034627
779 Ga0395900_0063807
780 Ga0395898_0036832
781 Ga0395898_0125160
782 Ga0395898_0135857
783 Ga0395905_0000864
784 Ga0395905_0037101
785 Ga0395905_0124819
786 Ga0395905_0159905
787 Ga0395901_0000009
788 Ga0395901_0000122
789 Ga0395901_0013989
790 Ga0395901_0018611
791 Ga0436361_0204659
792 Ga0436361_0234917
793 Ga0436361_0860790
794 Ga0451797_1290501
795 Ga0451795_0693632
796 Ga0451800_1495546
797 Ga0451802_0538624
798 Ga0451807_0295110
799 Ga0451855_0476812
800 Ga0439451_000430
801 Ga0439456_001098
802 Ga0439456_001555
803 Ga0439463_006543
804 Ga0466972_0138656
805 Ga0466982_0000040
806 Ga0466982_0096822
807 Ga0466965_0014160
808 Ga0466965_0103556
809 Ga0466966_0000043
810 Ga0466966_0086778
811 Ga0466966_0229381
812 Ga0466961_0000276
813 Ga0466961_0000399
814 Ga0466961_0001254
815 Ga0466961_0002248
816 Ga0466961_0021631
817 Ga0466961_0084273
818 Ga0466963_0013925
819 Ga0466971_0006143
820 Ga0466971_0018270
821 Ga0466970_0025215
822 Ga0466957_0034600
823 Ga0466957_0034805
824 Ga0466957_0276053
825 Ga0466959_0000058
826 Ga0466959_0006194
827 Ga0466959_0014441
828 Ga0466959_0061661
829 Ga0466959_0538980
830 Ga0466958_0003683
831 Ga0466958_0004961
832 Ga0466958_0009639
833 Ga0466958_0011537
834 Ga0495617_000004
835 Ga0495627_000001
836 Ga0495592_0003426
837 Ga0495603_0024474
838 Ga0495603_0027886
839 Ga0495603_0051840
840 Ga0495590_0028547
841 Ga0495590_0059417
842 Ga0495591_060250
843 Ga0495629_0002611
844 Ga0495629_0003779
845 Ga0495638_0000011
846 Ga0495638_0000052
847 Ga0495641_0012418
848 Ga0495651_0027687
849 Ga0495651_0257932
850 Ga0495653_0015446
851 Ga0495650_0000015
852 Ga0495650_0000145
853 Ga0495650_0001196
854 Ga0495650_0003003
855 Ga0495650_0016591
856 Ga0495650_0026303
857 Ga0495650_0030988
858 Ga0495650_0035756
859 Ga0495580_0005559
860 Ga0495580_0006174
861 Ga0495580_0035146
862 Ga0495580_0276432
863 Ga0495582_0011266
864 Ga0495605_0000222
865 Ga0495605_0000286
866 Ga0495605_0042317
867 Ga0495639_0029766
868 Ga0495664_0025951
869 Ga0495664_0181293
870 Ga0495584_0040929
871 Ga0495584_0085295
872 Ga0495585_0010318
873 Ga0495585_0041098
874 Ga0495594_0030303
875 Ga0495596_0000094
876 Ga0495596_0003209
877 Ga0495607_0000025
878 Ga0495607_0000507
879 Ga0495607_0000517
880 Ga0495607_0005537
881 Ga0495607_0014088
882 Ga0495607_0024269
883 Ga0495583_0000086
884 Ga0495583_0005819
885 Ga0495583_0015018
886 Ga0495606_0001737
887 Ga0495606_0045044
888 Ga0495606_0053398
889 Ga0495606_0192140
890 Ga0495608_0000402
891 Ga0495610_0003962
892 Ga0495610_0044766
893 Ga0495616_0000615
894 Ga0495616_0015812
895 Ga0495616_0047588
896 Ga0495618_0003285
897 Ga0495620_0000021
898 Ga0495628_0011358
899 Ga0495630_0001299
900 Ga0495630_0010276
901 Ga0495630_0137201
902 Ga0495631_0000419
903 Ga0495631_0002033
904 Ga0495632_0000062
905 Ga0495632_0012426
906 Ga0495632_0040375
907 Ga0495632_0045548
908 Ga0495637_0006422
909 Ga0495637_0038547
910 Ga0495643_0000254
911 Ga0495643_0002050
912 Ga0495643_0052380
913 Ga0495643_0055049
914 Ga0495644_0001820
915 Ga0495648_0000036
916 Ga0495648_0005508
917 Ga0495648_0026034
918 Ga0495666_0028716
919 Ga0495642_0000753
920 Ga0495652_0001389
921 Ga0495652_0020680
922 Ga0495652_0303464
923 Ga0495654_0010930
924 Ga0495654_0011832
925 Ga0495665_0000013
926 Ga0495665_0027212
927 Ga0495665_0058796
928 Ga0495640_0005984
929 Ga0495586_0000740
930 Ga0495586_0022328
931 Ga0495586_0255445
932 Ga0495609_0000148
933 Ga0495609_0000162
934 Ga0495609_0003010
935 Ga0495609_0003367
936 Ga0495609_0007175
937 Ga0495597_0000011
938 Ga0495597_0000622
939 Ga0495597_0080819
940 Ga0495645_0003033
941 Ga0495645_0060302
942 Ga0495645_0134168
943 Ga0495622_0000420
944 Ga0495622_0014484
945 Ga0495622_0045531
946 Ga0495633_0002844
947 Ga0495667_0097743
948 Ga0495656_0010072
949 Ga0495656_0098584
950 Ga0495634_0014990
951 Ga0495634_0132339
952 Ga0495625_0000861
953 Ga0495625_0005899
954 Ga0495625_0020323
955 Ga0495625_0026662
956 Ga0495625_0126567
957 Ga0495661_0008155
958 Ga0495661_0013328
959 Ga0495661_0024502
960 Ga0495661_0040225
961 Ga0495588_0000094
962 Ga0495588_0011084
963 Ga0495623_0016063
964 Ga0495613_0002059
965 Ga0495613_0026646
966 Ga0495624_0022984
967 Ga0495670_0034450
968 Ga0495670_0123880
969 Ga0495671_0012193
970 Ga0495671_0074290
971 Ga0495649_0001301
972 Ga0495649_0003036
973 Ga0495649_0032015
974 Ga0495649_0061955
975 Ga0495649_0134872
976 Ga0495589_0000011
977 Ga0495589_0000025
978 Ga0495589_0000359
979 Ga0495589_0003728
980 Ga0495589_0009673
981 Ga0495589_0096031
982 Ga0495600_0004412
983 Ga0495600_0026717
984 Ga0495660_0000299
985 Ga0495660_0001104
986 Ga0495660_0003415
987 Ga0495660_0008788
988 Ga0495660_0015920
989 Ga0495660_0022997
990 Ga0495660_0025436
991 Ga0495660_0056938
992 Ga0495581_0002574
993 Ga0495581_0016672
994 Ga0495581_0017953
995 Ga0495604_0017105
996 Ga0495636_0265275
997 Ga0495674_0056904
998 Ga0495672_0000090
999 Ga0495672_0000222
1000 Ga0495672_0001124
1001 Ga0495672_0028143
1002 Ga0495672_0032587
1003 Ga0495672_0050021
1004 Ga0495676_0000004
1005 Ga0495680_0024717
1006 Ga0495680_0108806
1007 Ga0495683_0001821
1008 Ga0495687_000402
1009 Ga0495687_001224
1010 Ga0495687_033370
1011 Ga0495687_046645
1012 Ga0495675_0012921
1013 Ga0495675_0109921
1014 Ga0495677_0001975
1015 Ga0495679_016467
1016 Ga0495673_0007807
1017 Ga0495673_0061273
1018 Ga0495681_0003969
1019 Ga0495681_0097439
1020 Ga0495684_0500145
1021 Ga0495686_0000213
1022 Ga0495602_0069178
1023 Ga0495614_0000269
1024 Ga0495626_0000017
1025 Ga0495626_0000022
1026 Ga0495626_0008220
1027 Ga0495626_0071628
1028 Ga0496100_0000094
1029 Ga0496100_0016531
1030 Ga0496101_0000181
1031 Ga0496101_0086586
1032 Ga0496102_0000397
1033 Ga0496102_0005182
1034 Ga0496102_0125415
1035 Ga0496103_0003529
1036 Ga0496104_0049105
1037 Ga0496104_0117559
1038 Ga0496106_0004030
1039 Ga0496109_0410543
1040 Ga0496113_0019743
1041 Ga0496113_0024821
1042 Ga0496115_0000072
1043 Ga0496115_0000462
1044 Ga0496115_0004247
1045 Ga0496116_0021352
1046 Ga0496116_0028808
1047 Ga0496117_0000210
1048 Ga0496117_0054473
1049 Ga0496118_0000788
1050 Ga0496118_0004274
1051 Ga0496118_0069268
1052 Ga0496119_0081827
1053 Ga0496121_0000290
1054 Ga0496121_0000457
1055 Ga0496121_0025456
1056 Ga0496121_0026631
1057 Ga0496121_0032295
1058 Ga0496121_0125786
1059 Ga0496121_0135553
1060 Ga0496121_0137011
1061 Ga0496122_0000473
1062 Ga0496122_0013578
1063 Ga0496122_0022284
1064 Ga0496122_0026840
1065 Ga0496122_0133962
1066 Ga0496123_0000029
1067 Ga0496123_0000857
1068 Ga0496123_0001289
1069 Ga0496123_0011972
1070 Ga0496123_0122015
1071 Ga0496123_0131021
1072 Ga0496124_0000004
1073 Ga0496124_0000022
1074 Ga0496124_0006294
1075 Ga0496124_0138827
1076 Ga0496124_0207089
1077 Ga0496124_0262460
1078 Ga0496124_0424440
1079 Ga0496125_0000945
1080 Ga0496125_0007717
1081 Ga0496125_0008590
1082 Ga0496125_0021684
1083 Ga0496125_0080826
1084 Ga0496126_0000426
1085 Ga0496126_0014182
1086 Ga0496126_0017267
1087 Ga0496126_0066652
1088 Ga0496126_0149775
1089 Ga0496126_0150287
1090 Ga0496126_0203448
1091 Ga0495678_000803
1092 Ga0495678_006770
1093 Ga0495678_031274
1094 Ga0495682_0002612
1095 Ga0501033_0004413
1096 Ga0501033_0444188
1097 Ga0501034_0126776
1098 Ga0501036_0327181
1099 Ga0501042_0168551
1100 Ga0501047_0006878
1101 Ga0501047_0570809
1102 Ga0500643_000121
1103 Ga0500646_0006759
1104 Ga0500651_0169174
1105 Ga0500618_001370
1106 Ga0500618_010436
1107 Ga0500652_000047
1108 Ga0500559_0029513
1109 Ga0500568_0000339
1110 Ga0500586_000044
1111 Ga0500604_0003627
1112 Ga0500616_0001844
1113 Ga0500616_0008875
1114 Ga0500622_0000043
1115 Ga0500634_0022277
1116 Ga0500570_000097
1117 Ga0466962_0003548
1118 Ga0466962_0073090
1119 2501075255
1120 2501081241
1121 2501411570
1122 2508853961
1123 2509131979
1124 2510250164
1125 2511094303
1126 2511099541
1127 2511106715
1128 2511134651
1129 2512350600
1130 2512643955
1131 2513865995
1132 2513962039
1133 2515689626
1134 2516023241
1135 2585231602
1136 2585273732
1137 2585559906
1138 2585905916
1139 2587978969
1140 2599745199
1141 2599970551
1142 2599997184
1143 2600206620
1144 2617380463
1145 2643799550
1146 2644471640
1147 2676743072
1148 2687581314
1149 2689994454
1150 2719639318
1151 2739730443
1152 2746091396
1153 2746097290
1154 2772439803
1155 2792833504
1156 2807178073
1157 2808973877
1158 2809008681
1159 2809015813
1160 2816516853
1161 2842326505
1162 2842350976
1163 2842455813
1164 2842783116
1165 2852388212
1166 2855731273
1167 2855767961
1168 2857365155
1169 2857545634
1170 2870076303
1171 2881413838
1172 2881610237
1173 2883093571
1174 2884339501
1175 2904484761
1176 2904567160
1177 2904573896
1178 2904621116
1179 2919047323
1180 2921643604
1181 2923591547
1182 2928541023
1183 2931371553
1184 2937968452
1185 2939629344
1186 2941473919
1187 2947238012
1188 3007721986
1189 8045865694
1190 8046770925
1191 8047675949
1192 8053947665
1193 8055273239
1194 8056215061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

5

195

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

11

239

0.92

PF08659

KR

KR domain

6

185

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1a-assembly6.cif.gz_J the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9483 5 275
3m1a-assembly4.cif.gz_E the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9438 3 276
3m1a-assembly2.cif.gz_B the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9423 3 276
3m1a-assembly6.cif.gz_J the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9414 5 275
3m1a-assembly4.cif.gz_E the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9404 3 276
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 5 180 3.40.50.720
3m1aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9415 3 276 3.40.50.720
af_Q54WM6_4_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9401 1 276 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9396 5 163 3.40.50.720
3m1aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9381 3 276 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3E0ADX9-F1-model_v4 deleted 0.987 3 276
AF-A0A3L7API4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9869 4 276 GO:0016491
AF-A0A1I5UCJ1-F1-model_v4 Short-chain dehydrogenase 0.9857 1 276 GO:0016491
AF-A0A1H2PR25-F1-model_v4 Short-chain dehydrogenase 0.9855 1 276 GO:0016491
AF-A0A7K2RBF0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9854 3 276 GO:0016491

Map