F467698

General Info

Members Datasets Scaffolds Average Seq Length
597 344 1194 110

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0000542|Ga0495597_0000542_14601_14936
Length 111
Sequence MNDLEFLDCAEKLLLAVEQGCDRINDESDADIDAQRAGGMVTLSFPNRSQIVINLQRPLHEVWLAAKAGGFHFRYDADQACWLDTKGEGEFFACLSRYASQQSNLPLTFSA

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
144 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
145 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
146 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
147 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
148 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
149 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
180 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
192 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
193 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
194 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
195 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
196 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
197 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
198 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
199 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
200 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
201 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
202 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
203 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
206 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
210 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
269 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
270 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
282 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
283 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
286 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
287 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
288 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
289 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
290 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
291 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
292 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
293 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
294 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
295 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
296 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
297 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
298 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
299 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
302 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
304 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
309 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
310 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
311 2547132374 Acidovorax radicis N35 Isolate Unclassified
312 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
313 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
314 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
315 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
316 2643221658 Variovorax sp. Root411 Isolate Unclassified
317 2643221672 Variovorax sp. Root434 Isolate Unclassified
318 2643221717 Acidovorax sp. Root267 Isolate Unclassified
319 2738541307 Variovorax sp. GV008 Isolate Unclassified
320 2738543013 Variovorax sp. BT01 Isolate Unclassified
321 2818991446 Variovorax sp. 1180 Isolate Unclassified
322 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
323 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
324 2842677519 Variovorax sp. R-72495 Isolate Unclassified
325 2885198086 Variovorax sp. 679 Isolate Unclassified
326 2885211737 Variovorax sp. 553 Isolate Unclassified
327 2899924645 Variovorax sp. 369 Isolate Unclassified
328 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
329 2904456579 Variovorax sp. 2002 Isolate Unclassified
330 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
331 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
332 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
333 2928037797 Variovorax sp. 1126 Isolate Unclassified
334 2928044640 Variovorax sp. 1128 Isolate Unclassified
335 2928051484 Variovorax sp. 1133 Isolate Unclassified
336 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
337 2928070936 Variovorax gossypii 1167 Isolate Unclassified
338 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
339 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
340 2929520902 Variovorax beijingensis 502 Isolate Unclassified
341 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
342 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
343 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
344 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.47
Metatranscriptomes 0.5
Isolates 6.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.69
Nodule 0.67
Rhizoplane 1.68
Rhizosphere 46.06
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0000542 3300046542 Bacteria 31279
2 SwRhRL2b_contig_3617209 2162886007 Bacteria 1326
3 JGI24740J21852_10012318 3300001979 Bacteria 3226
4 JGI24739J22299_10041070 3300001989 Bacteria 1541
5 JGI25155J39150_1000024 3300002704 Bacteria 133561
6 JGI25156J39149_1000005 3300002705 Bacteria 263980
7 JGI25154J39366_1000017 3300002738 Bacteria 252448
8 JGI25158J39367_1023513 3300002739 Bacteria 735
9 JGI25157J39369_1000003 3300002741 Bacteria 274935
10 JGI25152J39213_1004719 3300002773 Bacteria 4214
11 JGI25150J39212_1000865 3300002774 Bacteria 10073
12 JGI25150J39212_1002588 3300002774 Bacteria 4448
13 JGI25150J39212_1016153 3300002774 Bacteria 1229
14 JGI25159J45721_1002204 3300002987 Bacteria 7558
15 JGI25159J45721_1002668 3300002987 Bacteria 6646
16 JGI25159J45721_1009041 3300002987 Bacteria 2668
17 JGI25151J46595_10001765 3300003187 Bacteria 13998
18 JGI25151J46595_10012038 3300003187 Bacteria 3947
19 JGI25151J46595_10088010 3300003187 Bacteria 874
20 JGI25151J46595_10133836 3300003187 Bacteria 613
21 JGI25153J46596_10010387 3300003215 Bacteria 4214
22 rootH2_10115692 3300003320 Bacteria 1188
23 rootH1_10005797 3300003323 Bacteria 2405
24 JGI25160J50197_1003722 3300003354 Bacteria 6726
25 JGI25160J50197_1003801 3300003354 Bacteria 6646
26 JGI25160J50197_1009248 3300003354 Bacteria 3674
27 JGI25161J50226_1000341 3300003374 Bacteria 25069
28 JGI25161J50226_1001875 3300003374 Bacteria 5861
29 JGI25161J50226_1005376 3300003374 Bacteria 2492
30 Ga0006562J51391_1065191 3300003578 Bacteria 4200
31 Ga0006562J51391_1096091 3300003578 Bacteria 2130
32 Ga0006562J51391_1129683 3300003578 Bacteria 1128
33 Ga0055527_1015920 3300003760 Bacteria 816
34 Ga0055535_1000940 3300003761 Bacteria 19336
35 Ga0055542_1000080 3300003762 Bacteria 129634
36 Ga0055526_1007374 3300003771 Bacteria 5732
37 Ga0055526_1013095 3300003771 Bacteria 3542
38 Ga0055537_1000250 3300003773 Bacteria 39199
39 Ga0055537_1002217 3300003773 Bacteria 6726
40 Ga0055537_1005671 3300003773 Bacteria 3302
41 Ga0055537_1008534 3300003773 Bacteria 2354
42 Ga0055524_1005337 3300003775 Bacteria 5761
43 Ga0055524_1005368 3300003775 Bacteria 5732
44 Ga0055536_1001526 3300003781 Bacteria 13897
45 Ga0055536_1009991 3300003781 Bacteria 3836
46 Ga0055536_1034602 3300003781 Bacteria 1273
47 Ga0055534_1000016 3300003784 Bacteria 144444
48 Ga0055534_1001903 3300003784 Bacteria 7704
49 Ga0055534_1026152 3300003784 Bacteria 931
50 Ga0055528_1000429 3300003790 Bacteria 33812
51 Ga0055528_1004483 3300003790 Bacteria 6726
52 Ga0055528_1012435 3300003790 Bacteria 3302
53 Ga0055530_10004100 3300003791 Bacteria 7750
54 Ga0055530_10009682 3300003791 Bacteria 3666
55 Ga0055530_10049165 3300003791 Bacteria 988
56 Ga0055540_1002758 3300003792 Bacteria 9014
57 Ga0055540_1002884 3300003792 Bacteria 8723
58 Ga0055540_1007427 3300003792 Bacteria 4136
59 Ga0055540_1008103 3300003792 Bacteria 3836
60 Ga0055531_10005547 3300003794 Bacteria 7363
61 Ga0055531_10007803 3300003794 Bacteria 5764
62 Ga0055531_10008033 3300003794 Bacteria 5638
63 Ga0055531_10118383 3300003794 Bacteria 520
64 Ga0055543_1000441 3300004625 Bacteria 25571
65 Ga0055543_1002163 3300004625 Bacteria 6764
66 Ga0055543_1008000 3300004625 Bacteria 2378
67 Ga0065165_1005333 3300005262 Bacteria 7306
68 Ga0065165_1005780 3300005262 Bacteria 6764
69 Ga0065165_1008811 3300005262 Bacteria 4644
70 Ga0065165_1052870 3300005262 Bacteria 1145
71 Ga0065714_10006515 3300005288 Bacteria 4670
72 Ga0065714_10379460 3300005288 Bacteria 608
73 Ga0065714_10519008 3300005288 Bacteria 514
74 Ga0065704_10551769 3300005289 Bacteria 634
75 Ga0068869_100449423 3300005334 Bacteria 1068
76 Ga0070666_10513710 3300005335 Bacteria 869
77 Ga0070660_101243323 3300005339 Bacteria 632
78 Ga0070661_100163084 3300005344 Bacteria 1689
79 Ga0070663_100316888 3300005455 Bacteria 1253
80 Ga0070662_100234503 3300005457 Bacteria 1469
81 Ga0068867_100605640 3300005459 Bacteria 956
82 Ga0068853_100007664 3300005539 Bacteria 8655
83 Ga0068853_100535014 3300005539 Bacteria 1109
84 Ga0070665_101345005 3300005548 Bacteria 724
85 Ga0068855_100689430 3300005563 Bacteria 1094
86 Ga0070664_100354226 3300005564 Bacteria 1336
87 Ga0068857_100771599 3300005577 Bacteria 917
88 Ga0068857_101762758 3300005577 Bacteria 606
89 Ga0068856_101795073 3300005614 Bacteria 625
90 Ga0068852_100155716 3300005616 Bacteria 2129
91 Ga0068851_10258427 3300005834 Bacteria 990
92 Ga0068870_10401487 3300005840 Bacteria 892
93 Ga0068862_100050420 3300005844 Bacteria 3557
94 Ga0075365_10016245 3300006038 Bacteria 4522
95 Ga0075365_10466248 3300006038 Bacteria 892
96 Ga0075365_10799002 3300006038 Bacteria 666
97 Ga0075368_10133578 3300006042 Bacteria 1032
98 Ga0075368_10362573 3300006042 Bacteria 632
99 Ga0075368_10508654 3300006042 Bacteria 538
100 Ga0075363_100046995 3300006048 Bacteria 2291
101 Ga0075363_100092522 3300006048 Bacteria 1666
102 Ga0075363_100370246 3300006048 Bacteria 839
103 Ga0075363_100998384 3300006048 Bacteria 516
104 Ga0075364_10007957 3300006051 Bacteria 6316
105 Ga0075364_10921340 3300006051 Bacteria 595
106 Ga0075364_11264421 3300006051 Bacteria 500
107 Ga0075432_10004765 3300006058 Bacteria 4617
108 Ga0075362_10004194 3300006177 Bacteria 5145
109 Ga0075367_10282439 3300006178 Bacteria 1044
110 Ga0075367_10365195 3300006178 Bacteria 911
111 Ga0075367_10722176 3300006178 Bacteria 634
112 Ga0075366_10000393 3300006195 Bacteria 20298
113 Ga0075366_10037548 3300006195 Bacteria 2861
114 Ga0075366_10930332 3300006195 Bacteria 542
115 Ga0097621_100008697 3300006237 Bacteria 7331
116 Ga0075370_10001214 3300006353 Bacteria 10894
117 Ga0075370_10002830 3300006353 Bacteria 8141
118 Ga0075370_10092758 3300006353 Bacteria 1743
119 Ga0075370_10101502 3300006353 Bacteria 1665
120 Ga0075370_10187015 3300006353 Bacteria 1220
121 Ga0075370_10463778 3300006353 Bacteria 763
122 Ga0075370_10476532 3300006353 Bacteria 752
123 Ga0075370_10534543 3300006353 Bacteria 708
124 Ga0075370_10841195 3300006353 Bacteria 560
125 Ga0068871_100176380 3300006358 Bacteria 1835
126 Ga0099826_10079719 3300006948 Bacteria 2045
127 Ga0105244_10005986 3300009036 Bacteria 7965
128 Ga0105240_10306129 3300009093 Bacteria 1816
129 Ga0105245_10840307 3300009098 Bacteria 958
130 Ga0105243_10002006 3300009148 Bacteria 17320
131 Ga0105243_10007393 3300009148 Bacteria 8444
132 Ga0105243_10591378 3300009148 Bacteria 1067
133 Ga0105241_10456272 3300009174 Bacteria 1131
134 Ga0105242_10156282 3300009176 Bacteria 1992
135 Ga0105237_10511156 3300009545 Bacteria 1208
136 Ga0105238_10157872 3300009551 Bacteria 2243
137 Ga0105246_10046652 3300011119 Bacteria 2956
138 Ga0105246_10079654 3300011119 Bacteria 2330
139 Ga0157339_1020698 3300012505 Bacteria 696
140 Ga0157373_10038871 3300013100 Bacteria 3409
141 Ga0157373_10130993 3300013100 Bacteria 1764
142 Ga0157371_10037205 3300013102 Bacteria 3484
143 Ga0157370_10004158 3300013104 Bacteria 16754
144 Ga0157370_10282805 3300013104 Bacteria 1532
145 Ga0157370_10702706 3300013104 Bacteria 923
146 Ga0157369_10585654 3300013105 Bacteria 1152
147 Ga0157378_13269572 3300013297 Unclassified 503
148 Ga0157372_10171857 3300013307 Bacteria 2507
149 Ga0182008_10001493 3300014497 Bacteria 15633
150 Ga0182008_10004911 3300014497 Bacteria 7710
151 Ga0182006_1002058 3300015261 Bacteria 11278
152 Ga0182006_1025056 3300015261 Bacteria 2454
153 Ga0182007_10001989 3300015262 Bacteria 10547
154 Ga0182007_10111931 3300015262 Bacteria 909
155 Ga0182005_1255544 3300015265 Bacteria 543
156 Ga0163161_10001121 3300017792 Bacteria 20208
157 Ga0163161_10016492 3300017792 Bacteria 5158
158 Ga0163161_10039341 3300017792 Bacteria 3394
159 Ga0163161_10946852 3300017792 Bacteria 732
160 Ga0213872_10011154 3300021361 Bacteria 4259
161 Ga0209435_100002 3300025206 Bacteria 794178
162 Ga0209436_105393 3300025208 Bacteria 2954
163 Ga0209436_108114 3300025208 Bacteria 2124
164 Ga0209436_128623 3300025208 Bacteria 622
165 Ga0209672_101082 3300025228 Bacteria 11581
166 Ga0209147_100605 3300025229 Bacteria 19613
167 Ga0209258_100093 3300025242 Bacteria 223559
168 Ga0207425_1001364 3300025245 Bacteria 10364
169 Ga0207425_1001673 3300025245 Bacteria 8860
170 Ga0207425_1004864 3300025245 Bacteria 3938
171 Ga0209646_1000001 3300025246 Bacteria 3092932
172 Ga0209026_1000001 3300025250 Bacteria 1228671
173 Ga0209148_1000007 3300025254 Bacteria 1592273
174 Ga0209759_1000001 3300025256 Bacteria 2799452
175 Ga0209129_1000024 3300025258 Bacteria 417268
176 Ga0209129_1002014 3300025258 Bacteria 10537
177 Ga0209129_1006413 3300025258 Bacteria 3805
178 Ga0209129_1017756 3300025258 Bacteria 1387
179 Ga0209129_1026223 3300025258 Bacteria 1009
180 Ga0209565_1000098 3300025263 Bacteria 132021
181 Ga0209565_1000603 3300025263 Bacteria 24045
182 Ga0209565_1001652 3300025263 Bacteria 9346
183 Ga0209565_1005626 3300025263 Bacteria 3622
184 Ga0209673_1000058 3300025273 Bacteria 269028
185 Ga0209673_1001034 3300025273 Bacteria 32757
186 Ga0209673_1004273 3300025273 Bacteria 7756
187 Ga0209130_1000072 3300025284 Bacteria 175726
188 Ga0209130_1001764 3300025284 Bacteria 12808
189 Ga0209130_1002931 3300025284 Bacteria 7797
190 Ga0209130_1023462 3300025284 Bacteria 1360
191 Ga0209675_1000010 3300025291 Bacteria 541927
192 Ga0209675_1000818 3300025291 Bacteria 20501
193 Ga0209675_1001571 3300025291 Bacteria 12948
194 Ga0209675_1003274 3300025291 Bacteria 7797
195 Ga0209676_1000028 3300025292 Bacteria 559745
196 Ga0209676_1000317 3300025292 Bacteria 94105
197 Ga0209676_1001046 3300025292 Bacteria 31878
198 Ga0209676_1001791 3300025292 Bacteria 18033
199 Ga0209676_1005709 3300025292 Bacteria 6399
200 Ga0209676_1029412 3300025292 Bacteria 1696
201 Ga0209025_1000194 3300025294 Bacteria 148593
202 Ga0209025_1001623 3300025294 Bacteria 28072
203 Ga0209025_1002101 3300025294 Bacteria 22488
204 Ga0209025_1002116 3300025294 Bacteria 22361
205 Ga0209025_1030038 3300025294 Bacteria 2611
206 Ga0209025_1046239 3300025294 Bacteria 1793
207 Ga0209025_1060206 3300025294 Bacteria 1427
208 Ga0209564_1000209 3300025295 Bacteria 133651
209 Ga0209564_1001301 3300025295 Bacteria 26916
210 Ga0209758_1001224 3300025297 Bacteria 32124
211 Ga0209758_1011355 3300025297 Bacteria 5173
212 Ga0209758_1021396 3300025297 Bacteria 3016
213 Ga0209050_1000072 3300025298 Bacteria 293619
214 Ga0209050_1000786 3300025298 Bacteria 45131
215 Ga0209050_1001905 3300025298 Bacteria 19963
216 Ga0209050_1002495 3300025298 Bacteria 15560
217 Ga0209050_1003587 3300025298 Bacteria 11286
218 Ga0209050_1041463 3300025298 Bacteria 1269
219 Ga0209256_1001798 3300025299 Bacteria 20214
220 Ga0209256_1002515 3300025299 Bacteria 14737
221 Ga0209256_1062826 3300025299 Bacteria 859
222 Ga0207426_1000038 3300025302 Bacteria 441522
223 Ga0207426_1000053 3300025302 Bacteria 384818
224 Ga0207426_1002575 3300025302 Bacteria 11305
225 Ga0209051_1000015 3300025303 Bacteria 546798
226 Ga0209051_1000056 3300025303 Bacteria 271616
227 Ga0209051_1000392 3300025303 Bacteria 61223
228 Ga0209051_1000984 3300025303 Bacteria 27620
229 Ga0209051_1001474 3300025303 Bacteria 19907
230 Ga0209051_1008649 3300025303 Bacteria 5360
231 Ga0209257_1000037 3300025304 Bacteria 612915
232 Ga0209257_1002615 3300025304 Bacteria 17418
233 Ga0209257_1004456 3300025304 Bacteria 10840
234 Ga0209257_1007299 3300025304 Bacteria 6729
235 Ga0209257_1007819 3300025304 Bacteria 6331
236 Ga0207656_10034809 3300025321 Bacteria 2105
237 Ga0207655_1002097 3300025728 Bacteria 16711
238 Ga0207647_10752995 3300025904 Bacteria 527
239 Ga0207705_10152451 3300025909 Bacteria 1732
240 Ga0207654_10345887 3300025911 Bacteria 1023
241 Ga0207695_10219977 3300025913 Bacteria 1807
242 Ga0207671_10560032 3300025914 Bacteria 911
243 Ga0207657_11294958 3300025919 Bacteria 551
244 Ga0207649_10158904 3300025920 Bacteria 1564
245 Ga0207694_10041385 3300025924 Bacteria 3550
246 Ga0207687_10981204 3300025927 Bacteria 724
247 Ga0207644_11619302 3300025931 Bacteria 543
248 Ga0207706_10127837 3300025933 Bacteria 2234
249 Ga0207686_10468549 3300025934 Bacteria 972
250 Ga0207709_10000955 3300025935 Bacteria 21620
251 Ga0207709_10044243 3300025935 Bacteria 2689
252 Ga0207709_10070219 3300025935 Bacteria 2220
253 Ga0207709_10414985 3300025935 Bacteria 1033
254 Ga0207689_10756435 3300025942 Bacteria 820
255 Ga0207689_10999169 3300025942 Bacteria 706
256 Ga0207679_10327869 3300025945 Bacteria 1328
257 Ga0207667_10831904 3300025949 Bacteria 918
258 Ga0207640_10572470 3300025981 Bacteria 952
259 Ga0207658_11138150 3300025986 Bacteria 713
260 Ga0207639_10012527 3300026041 Bacteria 5909
261 Ga0207639_10434054 3300026041 Bacteria 1190
262 Ga0207639_11204403 3300026041 Bacteria 711
263 Ga0207678_10292707 3300026067 Bacteria 1398
264 Ga0207702_11031960 3300026078 Bacteria 816
265 Ga0207648_10175811 3300026089 Bacteria 1893
266 Ga0207648_10429769 3300026089 Bacteria 1200
267 Ga0207674_10210364 3300026116 Bacteria 1894
268 Ga0207674_12227059 3300026116 Bacteria 511
269 Ga0209973_1009453 3300027252 Bacteria 1135
270 Ga0209282_1000281 3300027666 Bacteria 25204
271 Ga0209282_1044667 3300027666 Bacteria 2597
272 Ga0209813_10127256 3300027866 Bacteria 893
273 Ga0209974_10002109 3300027876 Bacteria 7277
274 Ga0268266_11779711 3300028379 Bacteria 591
275 Ga0268265_10005703 3300028380 Bacteria 8502
276 Ga0307515_10090827 3300028794 Bacteria 3825
277 Ga0316177_1061492 3300030731 Bacteria 1849
278 Ga0316176_1214593 3300030732 Bacteria 1307
279 Ga0314311_1078400 3300030733 Bacteria 9421
280 Ga0316178_1170181 3300030735 Bacteria 8541
281 Ga0316180_1144523 3300030736 Bacteria 1420
282 Ga0316183_1075594 3300030742 Bacteria 6022
283 Ga0316181_1048677 3300030744 Bacteria 2776
284 Ga0316182_1164202 3300030745 Bacteria 5577
285 Ga0265332_10000027 3300031238 Bacteria 190796
286 Ga0307513_10006829 3300031456 Bacteria 14871
287 Ga0307513_10405861 3300031456 Bacteria 1096
288 Ga0307408_100017598 3300031548 Bacteria 4784
289 Ga0307408_100055499 3300031548 Bacteria 2868
290 Ga0307408_100328252 3300031548 Bacteria 1291
291 Ga0307408_101451304 3300031548 Bacteria 647
292 Ga0307408_101775855 3300031548 Bacteria 589
293 Ga0307514_10000954 3300031649 Bacteria 43472
294 Ga0307514_10028627 3300031649 Bacteria 4492
295 Ga0307405_10052937 3300031731 Bacteria 2526
296 Ga0307405_10312706 3300031731 Bacteria 1196
297 Ga0307405_10439412 3300031731 Bacteria 1031
298 Ga0307405_10844275 3300031731 Bacteria 771
299 Ga0307405_12118449 3300031731 Bacteria 505
300 Ga0307413_10142553 3300031824 Bacteria 1658
301 Ga0307413_11026423 3300031824 Bacteria 708
302 Ga0307413_11089494 3300031824 Bacteria 689
303 Ga0307413_11226396 3300031824 Bacteria 653
304 Ga0307406_10001760 3300031901 Bacteria 11860
305 Ga0307406_10003765 3300031901 Bacteria 8250
306 Ga0307406_10332123 3300031901 Bacteria 1180
307 Ga0307406_10686657 3300031901 Bacteria 853
308 Ga0307407_10144528 3300031903 Bacteria 1538
309 Ga0307412_10001452 3300031911 Bacteria 13174
310 Ga0307412_10011786 3300031911 Bacteria 5073
311 Ga0307412_10151735 3300031911 Bacteria 1710
312 Ga0307412_10463572 3300031911 Bacteria 1047
313 Ga0307412_10722806 3300031911 Bacteria 857
314 Ga0307412_10931610 3300031911 Bacteria 763
315 Ga0307416_100047237 3300032002 Bacteria 3406
316 Ga0307416_101004076 3300032002 Bacteria 937
317 Ga0307416_101685065 3300032002 Bacteria 739
318 Ga0307416_102398865 3300032002 Bacteria 627
319 Ga0307416_102526635 3300032002 Bacteria 612
320 Ga0307416_102624011 3300032002 Bacteria 601
321 Ga0307414_10104840 3300032004 Bacteria 2136
322 Ga0307414_10215839 3300032004 Bacteria 1571
323 Ga0307414_10502920 3300032004 Bacteria 1073
324 Ga0307411_10089013 3300032005 Bacteria 2149
325 Ga0307411_10189327 3300032005 Bacteria 1569
326 Ga0307411_10799061 3300032005 Bacteria 830
327 Ga0395900_0068749 3300037418 Bacteria 3640
328 Ga0395898_1018774 3300037466 Bacteria 763
329 Ga0395905_0062901 3300037471 Bacteria 3471
330 Ga0395905_0269810 3300037471 Bacteria 1587
331 Ga0395905_0292851 3300037471 Bacteria 1514
332 Ga0395901_0157878 3300038443 Bacteria 2382
333 Ga0395901_0585996 3300038443 Bacteria 1126
334 Ga0436361_1149592 3300039447 Bacteria 17234
335 Ga0439436_0000759 3300041404 Bacteria 8721
336 Ga0439436_0029076 3300041404 Bacteria 1611
337 Ga0439436_0178289 3300041404 Bacteria 604
338 Ga0439439_0009023 3300041406 Bacteria 2365
339 Ga0439439_0013341 3300041406 Bacteria 1993
340 Ga0439439_0175479 3300041406 Bacteria 616
341 Ga0439447_021795 3300041407 Bacteria 1684
342 Ga0439447_107024 3300041407 Bacteria 642
343 Ga0439461_0008421 3300041410 Bacteria 1848
344 Ga0439466_0023245 3300041411 Bacteria 2182
345 Ga0439466_0094062 3300041411 Bacteria 938
346 Ga0439466_0119167 3300041411 Bacteria 816
347 Ga0439465_0006602 3300041413 Bacteria 3686
348 Ga0451791_0575918 3300041451 Bacteria 851
349 Ga0451793_0216263 3300041452 Bacteria 579
350 Ga0451798_0057015 3300041458 Bacteria 1570
351 Ga0451800_0155883 3300041459 Bacteria 520
352 Ga0451807_1770674 3300041486 Bacteria 1378
353 Ga0451807_2535857 3300041486 Bacteria 753
354 Ga0451841_0348319 3300041498 Bacteria 713
355 Ga0451841_0367370 3300041498 Bacteria 924
356 Ga0451843_0419631 3300041509 Bacteria 555
357 Ga0451853_1055093 3300041512 Bacteria 666
358 Ga0451853_1578211 3300041512 Bacteria 1096
359 Ga0451853_1683357 3300041512 Bacteria 668
360 Ga0451853_1809353 3300041512 Bacteria 911
361 Ga0451853_1842314 3300041512 Bacteria 906
362 Ga0439433_0002884 3300041999 Bacteria 3677
363 Ga0439437_017480 3300042000 Bacteria 852
364 Ga0439441_049348 3300042001 Bacteria 863
365 Ga0439442_013241 3300042002 Bacteria 1692
366 Ga0439448_0175549 3300042005 Bacteria 748
367 Ga0439432_012887 3300042006 Bacteria 2847
368 Ga0439449_0002287 3300042007 Bacteria 7509
369 Ga0439449_0183493 3300042007 Bacteria 782
370 Ga0439452_003271 3300042010 Bacteria 5709
371 Ga0439462_0000171 3300042015 Bacteria 10896
372 Ga0439462_0003379 3300042015 Bacteria 3826
373 Ga0439462_0127186 3300042015 Bacteria 710
374 Ga0450921_005192 3300042123 Bacteria 978
375 Ga0450922_028525 3300042124 Bacteria 601
376 Ga0450923_002362 3300042125 Bacteria 2699
377 Ga0450890_049932 3300042127 Bacteria 636
378 Ga0450897_026899 3300042128 Bacteria 638
379 Ga0450894_003947 3300042131 Bacteria 1937
380 Ga0450895_007223 3300042132 Bacteria 917
381 Ga0450896_009741 3300042133 Bacteria 1342
382 Ga0450898_000716 3300042134 Bacteria 4022
383 Ga0450899_011051 3300042135 Bacteria 1004
384 Ga0450900_062221 3300042136 Bacteria 584
385 Ga0450906_008323 3300042145 Bacteria 2011
386 Ga0450906_012603 3300042145 Bacteria 1566
387 Ga0450906_042203 3300042145 Bacteria 805
388 Ga0450910_011022 3300042147 Bacteria 1293
389 Ga0439446_0016254 3300042156 Bacteria 2072
390 Ga0439446_0066483 3300042156 Bacteria 1097
391 Ga0439446_0078425 3300042156 Bacteria 1020
392 Ga0450908_032695 3300042184 Bacteria 902
393 Ga0450909_009072 3300042185 Bacteria 1451
394 Ga0450909_052496 3300042185 Bacteria 637
395 Ga0439434_0029937 3300042435 Bacteria 1651
396 Ga0439459_0023393 3300042438 Bacteria 1204
397 Ga0450918_001764 3300042531 Bacteria 4209
398 Ga0450893_0007041 3300042532 Bacteria 1823
399 Ga0466969_0009574 3300044656 Bacteria 5136
400 Ga0466966_0001948 3300044684 Bacteria 13354
401 Ga0453684_0072167 3300044712 Bacteria 4360
402 Ga0466970_0039237 3300044765 Bacteria 2513
403 Ga0466957_0560622 3300044842 Bacteria 797
404 Ga0466959_0035675 3300045049 Bacteria 3676
405 Ga0451576_0064873 3300045051 Bacteria 3803
406 Ga0466967_1407230 3300045976 Bacteria 695
407 Ga0495627_003833 3300046453 Bacteria 6463
408 Ga0495627_072886 3300046453 Bacteria 1001
409 Ga0495592_0610049 3300046454 Bacteria 665
410 Ga0495638_0008881 3300046460 Bacteria 7089
411 Ga0495651_0334443 3300046462 Bacteria 1006
412 Ga0495610_0036441 3300046512 Bacteria 2514
413 Ga0495610_0248082 3300046512 Bacteria 706
414 Ga0495616_0002386 3300046513 Bacteria 12503
415 Ga0495620_0005288 3300046515 Bacteria 7221
416 Ga0495620_0055943 3300046515 Bacteria 1661
417 Ga0495631_0005799 3300046518 Bacteria 6440
418 Ga0495637_0004613 3300046520 Bacteria 7113
419 Ga0495637_0009539 3300046520 Bacteria 4731
420 Ga0495663_0318334 3300046525 Bacteria 562
421 Ga0495654_0001107 3300046530 Bacteria 19460
422 Ga0495654_0116879 3300046530 Bacteria 1211
423 Ga0495654_0122537 3300046530 Bacteria 1175
424 Ga0495621_0020677 3300046539 Bacteria 2163
425 Ga0495622_0113804 3300046557 Bacteria 1238
426 Ga0495656_0020768 3300046615 Bacteria 2550
427 Ga0495668_0278015 3300046616 Bacteria 917
428 Ga0495668_0278576 3300046616 Bacteria 916
429 Ga0495625_0001007 3300046660 Bacteria 37199
430 Ga0495625_0296139 3300046660 Bacteria 1036
431 Ga0495625_0350434 3300046660 Bacteria 933
432 Ga0495659_0249709 3300046664 Bacteria 739
433 Ga0495661_0156843 3300046665 Bacteria 1225
434 Ga0495588_0021112 3300046674 Bacteria 3205
435 Ga0495657_0427740 3300046675 Bacteria 777
436 Ga0495599_0225255 3300046678 Bacteria 1146
437 Ga0495658_0026739 3300046683 Bacteria 3096
438 Ga0495671_0010024 3300046692 Bacteria 5270
439 Ga0495600_0414107 3300046809 Bacteria 837
440 Ga0495660_0143249 3300046810 Bacteria 1187
441 Ga0495676_0077155 3300047321 Bacteria 2541
442 Ga0495593_0116757 3300047673 Bacteria 1359
443 Ga0495602_0756581 3300048088 Bacteria 655
444 Ga0495602_0984350 3300048088 Bacteria 557
445 Ga0495614_0018848 3300048089 Bacteria 2988
446 Ga0495615_0027989 3300048090 Bacteria 1327
447 Ga0496114_0214353 3300048917 Bacteria 1689
448 Ga0496116_0027503 3300048919 Bacteria 4140
449 Ga0496116_0032847 3300048919 Bacteria 3692
450 Ga0496116_0125415 3300048919 Bacteria 1476
451 Ga0496117_0015517 3300048920 Bacteria 6489
452 Ga0496117_0050130 3300048920 Bacteria 2962
453 Ga0496117_0053333 3300048920 Bacteria 2842
454 Ga0496118_0012217 3300048921 Bacteria 8272
455 Ga0496118_0284819 3300048921 Bacteria 917
456 Ga0496119_0080202 3300048922 Bacteria 1883
457 Ga0496121_0032054 3300048924 Bacteria 4785
458 Ga0496121_0235177 3300048924 Bacteria 1280
459 Ga0496122_0104777 3300048925 Bacteria 1878
460 Ga0496122_0107983 3300048925 Bacteria 1837
461 Ga0496122_0164624 3300048925 Bacteria 1347
462 Ga0496122_0415899 3300048925 Bacteria 678
463 Ga0496123_0024883 3300048926 Bacteria 4532
464 Ga0496123_0059187 3300048926 Bacteria 2479
465 Ga0496123_0149935 3300048926 Bacteria 1260
466 Ga0496123_0202686 3300048926 Bacteria 1015
467 Ga0496123_0396299 3300048926 Bacteria 629
468 Ga0496124_0080349 3300048927 Bacteria 2683
469 Ga0496124_0162995 3300048927 Bacteria 1736
470 Ga0496124_0456809 3300048927 Bacteria 869
471 Ga0496125_0002451 3300048928 Bacteria 24101
472 Ga0496125_0016580 3300048928 Bacteria 7066
473 Ga0496125_0049464 3300048928 Bacteria 3493
474 Ga0496125_0256391 3300048928 Bacteria 1099
475 Ga0496125_0356113 3300048928 Bacteria 872
476 Ga0496125_0577132 3300048928 Bacteria 618
477 Ga0496126_0637282 3300048929 Bacteria 835
478 Ga0496126_0706349 3300048929 Bacteria 783
479 Ga0501032_0538604 3300049569 Bacteria 745
480 Ga0501033_0222792 3300049570 Bacteria 1342
481 Ga0501034_0685940 3300049571 Bacteria 924
482 Ga0501037_0169683 3300049573 Bacteria 1552
483 Ga0501042_1221216 3300049578 Bacteria 548
484 Ga0501043_0606188 3300049579 Bacteria 808
485 Ga0501047_0621772 3300049581 Bacteria 901
486 Ga0501072_1549245 3300049588 Bacteria 511
487 Ga0501211_027547 3300049658 Bacteria 626
488 Ga0501257_036688 3300049686 Bacteria 1195
489 Ga0501262_000071 3300049759 Bacteria 12483
490 nmdc:mga03683_12262_c1 3300050489 Bacteria 3127
491 nmdc:mga03683_275542_c1 3300050489 Bacteria 785
492 nmdc:mga03683_89269_c1 3300050489 Bacteria 1342
493 nmdc:mga03683_9284_c1 3300050489 Bacteria 3490
494 nmdc:mga03n38_362348_c1 3300050490 Bacteria 791
495 nmdc:mga03n38_40207_c1 3300050490 Bacteria 2031
496 nmdc:mga03n38_886860_c1 3300050490 Bacteria 523
497 nmdc:mga00v17_532566_c1 3300050491 Bacteria 760
498 nmdc:mga00v17_79928_c1 3300050491 Bacteria 2040
499 nmdc:mga0yw44_2309_c1 3300050492 Bacteria 8072
500 nmdc:mga0yw44_396437_c1 3300050492 Bacteria 933
501 nmdc:mga0yw44_4861_c1 3300050492 Bacteria 4138
502 nmdc:mga0yw44_54106_c1 3300050492 Bacteria 2438
503 nmdc:mga0k408_16331_c1 3300050493 Bacteria 4118
504 nmdc:mga0k408_200221_c1 3300050493 Bacteria 1192
505 nmdc:mga0k408_423861_c1 3300050493 Bacteria 791
506 nmdc:mga0k408_518005_c1 3300050493 Bacteria 706
507 nmdc:mga0k408_52549_c1 3300050493 Bacteria 2362
508 nmdc:mga0k408_575_c1 3300050493 Bacteria 20303
509 nmdc:mga06z11_202183_c1 3300050494 Bacteria 1154
510 nmdc:mga06z11_805680_c1 3300050494 Bacteria 572
511 nmdc:mga04h51_212479_c1 3300050495 Bacteria 764
512 nmdc:mga04h51_302629_c1 3300050495 Bacteria 652
513 nmdc:mga07m45_15395_c1 3300050496 Bacteria 4084
514 nmdc:mga07m45_170694_c1 3300050496 Bacteria 1264
515 nmdc:mga07m45_19080_c1 3300050496 Bacteria 3712
516 nmdc:mga07m45_2030_c1 3300050496 Bacteria 9388
517 nmdc:mga07m45_228406_c1 3300050496 Bacteria 1083
518 nmdc:mga07m45_770134_c1 3300050496 Bacteria 552
519 nmdc:mga07m45_779_c1 3300050496 Bacteria 13700
520 Ga0500610_0000979 3300053079 Bacteria 9275
521 Ga0500643_007939 3300053087 Bacteria 4222
522 Ga0500644_0015064 3300053088 Bacteria 2195
523 Ga0500644_0026443 3300053088 Bacteria 1796
524 Ga0500651_0000057 3300053093 Bacteria 72615
525 Ga0500566_0070888 3300053094 Bacteria 1956
526 Ga0500641_0051187 3300053096 Bacteria 1699
527 Ga0500560_133649 3300053107 Bacteria 830
528 Ga0500562_006336 3300053108 Bacteria 2985
529 Ga0500562_022247 3300053108 Bacteria 1652
530 Ga0500571_000050 3300053110 Bacteria 36128
531 Ga0500593_000150 3300053117 Bacteria 27835
532 Ga0500593_005889 3300053117 Bacteria 4869
533 Ga0500594_0005097 3300053118 Bacteria 2904
534 Ga0500597_085270 3300053120 Bacteria 1371
535 Ga0500607_018791 3300053121 Bacteria 3921
536 Ga0500607_043889 3300053121 Bacteria 2407
537 Ga0500608_001150 3300053122 Bacteria 9400
538 Ga0500608_200673 3300053122 Bacteria 824
539 Ga0500608_216202 3300053122 Bacteria 778
540 Ga0500618_034347 3300053125 Bacteria 1180
541 Ga0500626_033668 3300053128 Bacteria 2315
542 Ga0500628_132225 3300053129 Bacteria 686
543 Ga0500658_0002470 3300053134 Bacteria 7146
544 Ga0500658_0003083 3300053134 Bacteria 6372
545 Ga0500659_0229536 3300053135 Bacteria 874
546 Ga0500559_0007562 3300053136 Bacteria 4804
547 Ga0500559_0209233 3300053136 Bacteria 920
548 Ga0500564_355407 3300053138 Bacteria 543
549 Ga0500568_0002388 3300053139 Bacteria 11096
550 Ga0500574_002048 3300053141 Bacteria 3210
551 Ga0500604_0187910 3300053151 Bacteria 709
552 Ga0500627_0000469 3300053158 Bacteria 10938
553 Ga0500634_0003231 3300053161 Bacteria 7187
554 Ga0500634_0008449 3300053161 Bacteria 5148
555 Ga0500636_0004530 3300053177 Bacteria 7874
556 Ga0500625_142385 3300053729 Bacteria 919
557 Ga0500645_002097 3300053730 Bacteria 9217
558 Ga0500645_008432 3300053730 Bacteria 3520
559 Ga0500645_078635 3300053730 Bacteria 942
560 Ga0500596_010801 3300053735 Bacteria 1405
561 Ga0500596_074045 3300053735 Bacteria 585
562 2511244689 2511231002 Bacteria 5042903
563 2513230050 2513020051 Bacteria 6053213
564 2548499104 2547132374 Bacteria 5530232
565 2599620601 2599185214 Bacteria 8209958
566 2599673900 2599185226 Bacteria 8233575
567 2599678783 2599185227 Bacteria 8246414
568 2599690112 2599185229 Bacteria 8216126
569 2644324259 2643221658 Bacteria 6064537
570 2644396100 2643221672 Bacteria 6322190
571 2644648560 2643221717 Bacteria 5676132
572 2738884067 2738541307 Bacteria 8606193
573 2739250156 2738543013 Bacteria 5618633
574 2819601179 2818991446 Bacteria 7757362
575 2831271507 2831265667 Bacteria 7184833
576 2838055407 2838054893 Bacteria 7451788
577 2842680558 2842677519 Bacteria 5615038
578 2885201058 2885198086 Bacteria 7212419
579 2885214158 2885211737 Bacteria 7212420
580 2899927475 2899924645 Bacteria 7487985
581 2904450796 2904449895 Bacteria 6927402
582 2904459704 2904456579 Bacteria 6819253
583 2904548021 2904541872 Bacteria 8915136
584 2919462673 2919462493 Bacteria 5817112
585 2919707063 2919704043 Bacteria 5560311
586 2928042613 2928037797 Bacteria 7273642
587 2928048960 2928044640 Bacteria 7271509
588 2928051510 2928051484 Bacteria 7773759
589 2928068722 2928064002 Bacteria 7419480
590 2928073280 2928070936 Bacteria 8062541
591 2928087041 2928084124 Bacteria 7159212
592 2929161584 2929160207 Bacteria 9075316
593 2929521514 2929520902 Bacteria 6765052
594 2945913973 2945909444 Bacteria 7065066
595 2945949528 2945945610 Bacteria 5951079
596 2945973572 2945972063 Bacteria 6086495
597 2945990628 2945984333 Bacteria 7358892
598 Ga0495597_0000542
599 SwRhRL2b_contig_3617209
600 JGI24740J21852_10012318
601 JGI24739J22299_10041070
602 JGI25155J39150_1000024
603 JGI25156J39149_1000005
604 JGI25154J39366_1000017
605 JGI25158J39367_1023513
606 JGI25157J39369_1000003
607 JGI25152J39213_1004719
608 JGI25150J39212_1000865
609 JGI25150J39212_1002588
610 JGI25150J39212_1016153
611 JGI25159J45721_1002204
612 JGI25159J45721_1002668
613 JGI25159J45721_1009041
614 JGI25151J46595_10001765
615 JGI25151J46595_10012038
616 JGI25151J46595_10088010
617 JGI25151J46595_10133836
618 JGI25153J46596_10010387
619 rootH2_10115692
620 rootH1_10005797
621 JGI25160J50197_1003722
622 JGI25160J50197_1003801
623 JGI25160J50197_1009248
624 JGI25161J50226_1000341
625 JGI25161J50226_1001875
626 JGI25161J50226_1005376
627 Ga0006562J51391_1065191
628 Ga0006562J51391_1096091
629 Ga0006562J51391_1129683
630 Ga0055527_1015920
631 Ga0055535_1000940
632 Ga0055542_1000080
633 Ga0055526_1007374
634 Ga0055526_1013095
635 Ga0055537_1000250
636 Ga0055537_1002217
637 Ga0055537_1005671
638 Ga0055537_1008534
639 Ga0055524_1005337
640 Ga0055524_1005368
641 Ga0055536_1001526
642 Ga0055536_1009991
643 Ga0055536_1034602
644 Ga0055534_1000016
645 Ga0055534_1001903
646 Ga0055534_1026152
647 Ga0055528_1000429
648 Ga0055528_1004483
649 Ga0055528_1012435
650 Ga0055530_10004100
651 Ga0055530_10009682
652 Ga0055530_10049165
653 Ga0055540_1002758
654 Ga0055540_1002884
655 Ga0055540_1007427
656 Ga0055540_1008103
657 Ga0055531_10005547
658 Ga0055531_10007803
659 Ga0055531_10008033
660 Ga0055531_10118383
661 Ga0055543_1000441
662 Ga0055543_1002163
663 Ga0055543_1008000
664 Ga0065165_1005333
665 Ga0065165_1005780
666 Ga0065165_1008811
667 Ga0065165_1052870
668 Ga0065714_10006515
669 Ga0065714_10379460
670 Ga0065714_10519008
671 Ga0065704_10551769
672 Ga0068869_100449423
673 Ga0070666_10513710
674 Ga0070660_101243323
675 Ga0070661_100163084
676 Ga0070663_100316888
677 Ga0070662_100234503
678 Ga0068867_100605640
679 Ga0068853_100007664
680 Ga0068853_100535014
681 Ga0070665_101345005
682 Ga0068855_100689430
683 Ga0070664_100354226
684 Ga0068857_100771599
685 Ga0068857_101762758
686 Ga0068856_101795073
687 Ga0068852_100155716
688 Ga0068851_10258427
689 Ga0068870_10401487
690 Ga0068862_100050420
691 Ga0075365_10016245
692 Ga0075365_10466248
693 Ga0075365_10799002
694 Ga0075368_10133578
695 Ga0075368_10362573
696 Ga0075368_10508654
697 Ga0075363_100046995
698 Ga0075363_100092522
699 Ga0075363_100370246
700 Ga0075363_100998384
701 Ga0075364_10007957
702 Ga0075364_10921340
703 Ga0075364_11264421
704 Ga0075432_10004765
705 Ga0075362_10004194
706 Ga0075367_10282439
707 Ga0075367_10365195
708 Ga0075367_10722176
709 Ga0075366_10000393
710 Ga0075366_10037548
711 Ga0075366_10930332
712 Ga0097621_100008697
713 Ga0075370_10001214
714 Ga0075370_10002830
715 Ga0075370_10092758
716 Ga0075370_10101502
717 Ga0075370_10187015
718 Ga0075370_10463778
719 Ga0075370_10476532
720 Ga0075370_10534543
721 Ga0075370_10841195
722 Ga0068871_100176380
723 Ga0099826_10079719
724 Ga0105244_10005986
725 Ga0105240_10306129
726 Ga0105245_10840307
727 Ga0105243_10002006
728 Ga0105243_10007393
729 Ga0105243_10591378
730 Ga0105241_10456272
731 Ga0105242_10156282
732 Ga0105237_10511156
733 Ga0105238_10157872
734 Ga0105246_10046652
735 Ga0105246_10079654
736 Ga0157339_1020698
737 Ga0157373_10038871
738 Ga0157373_10130993
739 Ga0157371_10037205
740 Ga0157370_10004158
741 Ga0157370_10282805
742 Ga0157370_10702706
743 Ga0157369_10585654
744 Ga0157378_13269572
745 Ga0157372_10171857
746 Ga0182008_10001493
747 Ga0182008_10004911
748 Ga0182006_1002058
749 Ga0182006_1025056
750 Ga0182007_10001989
751 Ga0182007_10111931
752 Ga0182005_1255544
753 Ga0163161_10001121
754 Ga0163161_10016492
755 Ga0163161_10039341
756 Ga0163161_10946852
757 Ga0213872_10011154
758 Ga0209435_100002
759 Ga0209436_105393
760 Ga0209436_108114
761 Ga0209436_128623
762 Ga0209672_101082
763 Ga0209147_100605
764 Ga0209258_100093
765 Ga0207425_1001364
766 Ga0207425_1001673
767 Ga0207425_1004864
768 Ga0209646_1000001
769 Ga0209026_1000001
770 Ga0209148_1000007
771 Ga0209759_1000001
772 Ga0209129_1000024
773 Ga0209129_1002014
774 Ga0209129_1006413
775 Ga0209129_1017756
776 Ga0209129_1026223
777 Ga0209565_1000098
778 Ga0209565_1000603
779 Ga0209565_1001652
780 Ga0209565_1005626
781 Ga0209673_1000058
782 Ga0209673_1001034
783 Ga0209673_1004273
784 Ga0209130_1000072
785 Ga0209130_1001764
786 Ga0209130_1002931
787 Ga0209130_1023462
788 Ga0209675_1000010
789 Ga0209675_1000818
790 Ga0209675_1001571
791 Ga0209675_1003274
792 Ga0209676_1000028
793 Ga0209676_1000317
794 Ga0209676_1001046
795 Ga0209676_1001791
796 Ga0209676_1005709
797 Ga0209676_1029412
798 Ga0209025_1000194
799 Ga0209025_1001623
800 Ga0209025_1002101
801 Ga0209025_1002116
802 Ga0209025_1030038
803 Ga0209025_1046239
804 Ga0209025_1060206
805 Ga0209564_1000209
806 Ga0209564_1001301
807 Ga0209758_1001224
808 Ga0209758_1011355
809 Ga0209758_1021396
810 Ga0209050_1000072
811 Ga0209050_1000786
812 Ga0209050_1001905
813 Ga0209050_1002495
814 Ga0209050_1003587
815 Ga0209050_1041463
816 Ga0209256_1001798
817 Ga0209256_1002515
818 Ga0209256_1062826
819 Ga0207426_1000038
820 Ga0207426_1000053
821 Ga0207426_1002575
822 Ga0209051_1000015
823 Ga0209051_1000056
824 Ga0209051_1000392
825 Ga0209051_1000984
826 Ga0209051_1001474
827 Ga0209051_1008649
828 Ga0209257_1000037
829 Ga0209257_1002615
830 Ga0209257_1004456
831 Ga0209257_1007299
832 Ga0209257_1007819
833 Ga0207656_10034809
834 Ga0207655_1002097
835 Ga0207647_10752995
836 Ga0207705_10152451
837 Ga0207654_10345887
838 Ga0207695_10219977
839 Ga0207671_10560032
840 Ga0207657_11294958
841 Ga0207649_10158904
842 Ga0207694_10041385
843 Ga0207687_10981204
844 Ga0207644_11619302
845 Ga0207706_10127837
846 Ga0207686_10468549
847 Ga0207709_10000955
848 Ga0207709_10044243
849 Ga0207709_10070219
850 Ga0207709_10414985
851 Ga0207689_10756435
852 Ga0207689_10999169
853 Ga0207679_10327869
854 Ga0207667_10831904
855 Ga0207640_10572470
856 Ga0207658_11138150
857 Ga0207639_10012527
858 Ga0207639_10434054
859 Ga0207639_11204403
860 Ga0207678_10292707
861 Ga0207702_11031960
862 Ga0207648_10175811
863 Ga0207648_10429769
864 Ga0207674_10210364
865 Ga0207674_12227059
866 Ga0209973_1009453
867 Ga0209282_1000281
868 Ga0209282_1044667
869 Ga0209813_10127256
870 Ga0209974_10002109
871 Ga0268266_11779711
872 Ga0268265_10005703
873 Ga0307515_10090827
874 Ga0316177_1061492
875 Ga0316176_1214593
876 Ga0314311_1078400
877 Ga0316178_1170181
878 Ga0316180_1144523
879 Ga0316183_1075594
880 Ga0316181_1048677
881 Ga0316182_1164202
882 Ga0265332_10000027
883 Ga0307513_10006829
884 Ga0307513_10405861
885 Ga0307408_100017598
886 Ga0307408_100055499
887 Ga0307408_100328252
888 Ga0307408_101451304
889 Ga0307408_101775855
890 Ga0307514_10000954
891 Ga0307514_10028627
892 Ga0307405_10052937
893 Ga0307405_10312706
894 Ga0307405_10439412
895 Ga0307405_10844275
896 Ga0307405_12118449
897 Ga0307413_10142553
898 Ga0307413_11026423
899 Ga0307413_11089494
900 Ga0307413_11226396
901 Ga0307406_10001760
902 Ga0307406_10003765
903 Ga0307406_10332123
904 Ga0307406_10686657
905 Ga0307407_10144528
906 Ga0307412_10001452
907 Ga0307412_10011786
908 Ga0307412_10151735
909 Ga0307412_10463572
910 Ga0307412_10722806
911 Ga0307412_10931610
912 Ga0307416_100047237
913 Ga0307416_101004076
914 Ga0307416_101685065
915 Ga0307416_102398865
916 Ga0307416_102526635
917 Ga0307416_102624011
918 Ga0307414_10104840
919 Ga0307414_10215839
920 Ga0307414_10502920
921 Ga0307411_10089013
922 Ga0307411_10189327
923 Ga0307411_10799061
924 Ga0395900_0068749
925 Ga0395898_1018774
926 Ga0395905_0062901
927 Ga0395905_0269810
928 Ga0395905_0292851
929 Ga0395901_0157878
930 Ga0395901_0585996
931 Ga0436361_1149592
932 Ga0439436_0000759
933 Ga0439436_0029076
934 Ga0439436_0178289
935 Ga0439439_0009023
936 Ga0439439_0013341
937 Ga0439439_0175479
938 Ga0439447_021795
939 Ga0439447_107024
940 Ga0439461_0008421
941 Ga0439466_0023245
942 Ga0439466_0094062
943 Ga0439466_0119167
944 Ga0439465_0006602
945 Ga0451791_0575918
946 Ga0451793_0216263
947 Ga0451798_0057015
948 Ga0451800_0155883
949 Ga0451807_1770674
950 Ga0451807_2535857
951 Ga0451841_0348319
952 Ga0451841_0367370
953 Ga0451843_0419631
954 Ga0451853_1055093
955 Ga0451853_1578211
956 Ga0451853_1683357
957 Ga0451853_1809353
958 Ga0451853_1842314
959 Ga0439433_0002884
960 Ga0439437_017480
961 Ga0439441_049348
962 Ga0439442_013241
963 Ga0439448_0175549
964 Ga0439432_012887
965 Ga0439449_0002287
966 Ga0439449_0183493
967 Ga0439452_003271
968 Ga0439462_0000171
969 Ga0439462_0003379
970 Ga0439462_0127186
971 Ga0450921_005192
972 Ga0450922_028525
973 Ga0450923_002362
974 Ga0450890_049932
975 Ga0450897_026899
976 Ga0450894_003947
977 Ga0450895_007223
978 Ga0450896_009741
979 Ga0450898_000716
980 Ga0450899_011051
981 Ga0450900_062221
982 Ga0450906_008323
983 Ga0450906_012603
984 Ga0450906_042203
985 Ga0450910_011022
986 Ga0439446_0016254
987 Ga0439446_0066483
988 Ga0439446_0078425
989 Ga0450908_032695
990 Ga0450909_009072
991 Ga0450909_052496
992 Ga0439434_0029937
993 Ga0439459_0023393
994 Ga0450918_001764
995 Ga0450893_0007041
996 Ga0466969_0009574
997 Ga0466966_0001948
998 Ga0453684_0072167
999 Ga0466970_0039237
1000 Ga0466957_0560622
1001 Ga0466959_0035675
1002 Ga0451576_0064873
1003 Ga0466967_1407230
1004 Ga0495627_003833
1005 Ga0495627_072886
1006 Ga0495592_0610049
1007 Ga0495638_0008881
1008 Ga0495651_0334443
1009 Ga0495610_0036441
1010 Ga0495610_0248082
1011 Ga0495616_0002386
1012 Ga0495620_0005288
1013 Ga0495620_0055943
1014 Ga0495631_0005799
1015 Ga0495637_0004613
1016 Ga0495637_0009539
1017 Ga0495663_0318334
1018 Ga0495654_0001107
1019 Ga0495654_0116879
1020 Ga0495654_0122537
1021 Ga0495621_0020677
1022 Ga0495622_0113804
1023 Ga0495656_0020768
1024 Ga0495668_0278015
1025 Ga0495668_0278576
1026 Ga0495625_0001007
1027 Ga0495625_0296139
1028 Ga0495625_0350434
1029 Ga0495659_0249709
1030 Ga0495661_0156843
1031 Ga0495588_0021112
1032 Ga0495657_0427740
1033 Ga0495599_0225255
1034 Ga0495658_0026739
1035 Ga0495671_0010024
1036 Ga0495600_0414107
1037 Ga0495660_0143249
1038 Ga0495676_0077155
1039 Ga0495593_0116757
1040 Ga0495602_0756581
1041 Ga0495602_0984350
1042 Ga0495614_0018848
1043 Ga0495615_0027989
1044 Ga0496114_0214353
1045 Ga0496116_0027503
1046 Ga0496116_0032847
1047 Ga0496116_0125415
1048 Ga0496117_0015517
1049 Ga0496117_0050130
1050 Ga0496117_0053333
1051 Ga0496118_0012217
1052 Ga0496118_0284819
1053 Ga0496119_0080202
1054 Ga0496121_0032054
1055 Ga0496121_0235177
1056 Ga0496122_0104777
1057 Ga0496122_0107983
1058 Ga0496122_0164624
1059 Ga0496122_0415899
1060 Ga0496123_0024883
1061 Ga0496123_0059187
1062 Ga0496123_0149935
1063 Ga0496123_0202686
1064 Ga0496123_0396299
1065 Ga0496124_0080349
1066 Ga0496124_0162995
1067 Ga0496124_0456809
1068 Ga0496125_0002451
1069 Ga0496125_0016580
1070 Ga0496125_0049464
1071 Ga0496125_0256391
1072 Ga0496125_0356113
1073 Ga0496125_0577132
1074 Ga0496126_0637282
1075 Ga0496126_0706349
1076 Ga0501032_0538604
1077 Ga0501033_0222792
1078 Ga0501034_0685940
1079 Ga0501037_0169683
1080 Ga0501042_1221216
1081 Ga0501043_0606188
1082 Ga0501047_0621772
1083 Ga0501072_1549245
1084 Ga0501211_027547
1085 Ga0501257_036688
1086 Ga0501262_000071
1087 nmdc:mga03683_12262_c1
1088 nmdc:mga03683_275542_c1
1089 nmdc:mga03683_89269_c1
1090 nmdc:mga03683_9284_c1
1091 nmdc:mga03n38_362348_c1
1092 nmdc:mga03n38_40207_c1
1093 nmdc:mga03n38_886860_c1
1094 nmdc:mga00v17_532566_c1
1095 nmdc:mga00v17_79928_c1
1096 nmdc:mga0yw44_2309_c1
1097 nmdc:mga0yw44_396437_c1
1098 nmdc:mga0yw44_4861_c1
1099 nmdc:mga0yw44_54106_c1
1100 nmdc:mga0k408_16331_c1
1101 nmdc:mga0k408_200221_c1
1102 nmdc:mga0k408_423861_c1
1103 nmdc:mga0k408_518005_c1
1104 nmdc:mga0k408_52549_c1
1105 nmdc:mga0k408_575_c1
1106 nmdc:mga06z11_202183_c1
1107 nmdc:mga06z11_805680_c1
1108 nmdc:mga04h51_212479_c1
1109 nmdc:mga04h51_302629_c1
1110 nmdc:mga07m45_15395_c1
1111 nmdc:mga07m45_170694_c1
1112 nmdc:mga07m45_19080_c1
1113 nmdc:mga07m45_2030_c1
1114 nmdc:mga07m45_228406_c1
1115 nmdc:mga07m45_770134_c1
1116 nmdc:mga07m45_779_c1
1117 Ga0500610_0000979
1118 Ga0500643_007939
1119 Ga0500644_0015064
1120 Ga0500644_0026443
1121 Ga0500651_0000057
1122 Ga0500566_0070888
1123 Ga0500641_0051187
1124 Ga0500560_133649
1125 Ga0500562_006336
1126 Ga0500562_022247
1127 Ga0500571_000050
1128 Ga0500593_000150
1129 Ga0500593_005889
1130 Ga0500594_0005097
1131 Ga0500597_085270
1132 Ga0500607_018791
1133 Ga0500607_043889
1134 Ga0500608_001150
1135 Ga0500608_200673
1136 Ga0500608_216202
1137 Ga0500618_034347
1138 Ga0500626_033668
1139 Ga0500628_132225
1140 Ga0500658_0002470
1141 Ga0500658_0003083
1142 Ga0500659_0229536
1143 Ga0500559_0007562
1144 Ga0500559_0209233
1145 Ga0500564_355407
1146 Ga0500568_0002388
1147 Ga0500574_002048
1148 Ga0500604_0187910
1149 Ga0500627_0000469
1150 Ga0500634_0003231
1151 Ga0500634_0008449
1152 Ga0500636_0004530
1153 Ga0500625_142385
1154 Ga0500645_002097
1155 Ga0500645_008432
1156 Ga0500645_078635
1157 Ga0500596_010801
1158 Ga0500596_074045
1159 2511244689
1160 2513230050
1161 2548499104
1162 2599620601
1163 2599673900
1164 2599678783
1165 2599690112
1166 2644324259
1167 2644396100
1168 2644648560
1169 2738884067
1170 2739250156
1171 2819601179
1172 2831271507
1173 2838055407
1174 2842680558
1175 2885201058
1176 2885214158
1177 2899927475
1178 2904450796
1179 2904459704
1180 2904548021
1181 2919462673
1182 2919707063
1183 2928042613
1184 2928048960
1185 2928051510
1186 2928068722
1187 2928073280
1188 2928087041
1189 2929161584
1190 2929521514
1191 2945913973
1192 2945949528
1193 2945973572
1194 2945990628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01491

Frataxin_Cyay

Frataxin-like domain

1

107

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ew4-assembly1.cif.gz_A crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family 0.9519 1 108
1ew4-assembly1.cif.gz_A crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family 0.9433 1 108
4jpd-assembly1.cif.gz_A the structure of cyay from burkholderia cenocepacia 0.936 1 108
4jpd-assembly1.cif.gz_A the structure of cyay from burkholderia cenocepacia 0.9113 1 108
1soy-assembly1.cif.gz_A solution structure of the bacterial frataxin orthologue, cyay 0.9023 1 108
ID Description Score Start End Superfamily
4jpdA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.936 1 108 3.30.920.10
2p1xA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9251 1 108 3.30.920.10
2p1xA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9168 1 108 3.30.920.10
4jpdA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9113 1 108 3.30.920.10
af_I1JK59_72_191_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8864 1 108 3.30.920.10
ID Description Score Start End GO Terms
AF-A1W3Z7-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9995 1 108 GO:0005737
GO:0008199
GO:0016226
AF-A0A1L1P8B6-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.997 1 108 GO:0005737
GO:0008199
GO:0016226
AF-A0A349WB63-F1-model_v4 Iron donor protein CyaY 0.9962 1 92 GO:0005737
GO:0008199
GO:0016226
AF-A0A4Q5VSX0-F1-model_v4 deleted 0.9924 1 61
AF-V5ACD0-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9915 1 108 GO:0005737
GO:0008199
GO:0016226

Map