F467707

General Info

Members Datasets Scaffolds Average Seq Length
597 338 1194 357

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0048600|Ga0496121_0048600_1737_2930
Length 397
Sequence MEDGIHNVLPMTRRLQGLPVHQPRQFACDNQPTSGFSVKTYRIAAIPGDGIGSEVISAGVEALNACAKRDGGFTFAFDHFDWGSERYKTTGAFMPDNGRDLIRKHDAILFGSAGVPDVPDHITLWGLRLAICQPFDQYANVRPTRILPGIVSPLRNVSGPELDWVIVRENSEGEYAGVGGRVHRGLPEEAATDVSMFTRAGVARIMRFAFALARSRPRKFLTVVTKSNAQRHAMVMWDEIAAEIACEFPDVTWDKMLVDAMTMRMTLKPETLDTIVATNLHADILSDLAAALAGSLGIAPTANLNPERTFPSMFEPIHGSAFDIIGKGIANPIGTFWSSVMMLEHLGEPSAAARLMRAIEKVTADKALHTPDLGGKARTADVTKAVCDALAGDNQAN

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
303 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
312 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
313 2643221736 Bosea sp. Root483D1 Isolate Unclassified
314 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
315 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
316 2831864461 Roseateles noduli HZ7 Isolate Nodule
317 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
318 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
319 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
320 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
321 2851182111 Bosea sp. Tri-44 Isolate Nodule
322 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
323 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
324 2902330777 Methylobacterium sp. 2A Isolate Unclassified
325 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
326 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
327 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
328 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
329 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
330 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
331 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
332 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
333 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
334 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
335 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
336 641522639 Methylobacterium sp. 4-46 Isolate Nodule
337 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
338 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0.17
Isolates 4.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.73
Nodule 1.51
Rhizoplane 7.71
Rhizosphere 73.03
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0048600 3300048924 Bacteria 3608
2 JGI25159J45721_1005941 3300002987 Bacteria 3745
3 JGI25406J46586_10008417 3300003203 Bacteria 4676
4 JGI25153J46596_10004136 3300003215 Bacteria 7888
5 Ga0055526_1009177 3300003771 Bacteria 4806
6 Ga0055524_1000116 3300003775 Bacteria 94296
7 Ga0065165_1000070 3300005262 Bacteria 168230
8 Ga0065165_1000234 3300005262 Bacteria 96709
9 Ga0065715_10203078 3300005293 Bacteria 1351
10 Ga0070676_10153086 3300005328 Bacteria 1478
11 Ga0070683_100079815 3300005329 Bacteria 3062
12 Ga0070670_100124447 3300005331 Bacteria 2225
13 Ga0068869_100060155 3300005334 Bacteria 2783
14 Ga0068869_100096279 3300005334 Bacteria 2234
15 Ga0070680_100002201 3300005336 Bacteria 14368
16 Ga0070680_100177952 3300005336 Bacteria 1791
17 Ga0070682_100005041 3300005337 Bacteria 7337
18 Ga0070660_100002575 3300005339 Bacteria 12436
19 Ga0070689_100021942 3300005340 Bacteria 4761
20 Ga0070689_100087596 3300005340 Bacteria 2450
21 Ga0070691_10015849 3300005341 Bacteria 3465
22 Ga0070691_10047899 3300005341 Bacteria 2033
23 Ga0070687_100032606 3300005343 Bacteria 2564
24 Ga0070668_100058386 3300005347 Bacteria 2984
25 Ga0070669_100113857 3300005353 Bacteria 2056
26 Ga0070669_100224401 3300005353 Bacteria 1486
27 Ga0070675_100097452 3300005354 Bacteria 2472
28 Ga0070674_100038161 3300005356 Bacteria 3235
29 Ga0070674_100064885 3300005356 Bacteria 2561
30 Ga0070673_100071230 3300005364 Bacteria 2793
31 Ga0070688_100011735 3300005365 Bacteria 4883
32 Ga0070659_100088277 3300005366 Bacteria 2483
33 Ga0070709_10039935 3300005434 Bacteria 2882
34 Ga0070714_100032781 3300005435 Bacteria 4338
35 Ga0070714_100338793 3300005435 Bacteria 1410
36 Ga0070710_10040820 3300005437 Bacteria 2559
37 Ga0070711_100337845 3300005439 Bacteria 1208
38 Ga0070705_100000415 3300005440 Bacteria 24569
39 Ga0070700_100026852 3300005441 Bacteria 3406
40 Ga0070694_100000944 3300005444 Bacteria 16430
41 Ga0070708_100211795 3300005445 Bacteria 1816
42 Ga0070678_100172932 3300005456 Bacteria 1761
43 Ga0070678_100408135 3300005456 Bacteria 1182
44 Ga0070681_10011866 3300005458 Bacteria 8640
45 Ga0070681_10041276 3300005458 Bacteria 4624
46 Ga0070681_10083856 3300005458 Bacteria 3140
47 Ga0070685_10127162 3300005466 Bacteria 1589
48 Ga0070707_100015628 3300005468 Bacteria 7123
49 Ga0070707_100393412 3300005468 Bacteria 1346
50 Ga0070698_100007295 3300005471 Bacteria 11969
51 Ga0070698_100114754 3300005471 Bacteria 2658
52 Ga0070699_100001621 3300005518 Bacteria 20514
53 Ga0070699_100001673 3300005518 Bacteria 20205
54 Ga0070699_100020221 3300005518 Bacteria 5740
55 Ga0070679_100007044 3300005530 Bacteria 10485
56 Ga0070697_100002273 3300005536 Bacteria 14750
57 Ga0070697_100050959 3300005536 Bacteria 3363
58 Ga0068853_100019915 3300005539 Bacteria 5572
59 Ga0070672_100057304 3300005543 Bacteria 3058
60 Ga0070672_100094783 3300005543 Bacteria 2413
61 Ga0070672_100226424 3300005543 Bacteria 1570
62 Ga0070695_100001385 3300005545 Bacteria 13462
63 Ga0070695_100091880 3300005545 Bacteria 2028
64 Ga0070696_100000318 3300005546 Bacteria 29310
65 Ga0070693_100045950 3300005547 Bacteria 2478
66 Ga0070665_100160106 3300005548 Bacteria 2253
67 Ga0070665_100422580 3300005548 Bacteria 1341
68 Ga0070704_100000250 3300005549 Bacteria 23270
69 Ga0068855_100007113 3300005563 Bacteria 13576
70 Ga0068857_100059443 3300005577 Bacteria 3396
71 Ga0068856_100158083 3300005614 Bacteria 2276
72 Ga0068856_100232428 3300005614 Bacteria 1859
73 Ga0070702_100141662 3300005615 Bacteria 1532
74 Ga0070702_100286201 3300005615 Bacteria 1134
75 Ga0068852_100096518 3300005616 Bacteria 2657
76 Ga0068859_100072457 3300005617 Bacteria 3482
77 Ga0068859_100093996 3300005617 Bacteria 3050
78 Ga0068864_100016345 3300005618 Bacteria 6176
79 Ga0068864_100034144 3300005618 Bacteria 4325
80 Ga0068861_100001902 3300005719 Bacteria 13445
81 Ga0068861_100027157 3300005719 Bacteria 4167
82 Ga0068861_100035273 3300005719 Bacteria 3703
83 Ga0068851_10071947 3300005834 Bacteria 1790
84 Ga0068863_100028883 3300005841 Bacteria 5296
85 Ga0068860_100010461 3300005843 Bacteria 9173
86 Ga0068860_100250505 3300005843 Bacteria 1725
87 Ga0068862_100024652 3300005844 Bacteria 5048
88 Ga0081540_1000245 3300005983 Bacteria 56994
89 Ga0081540_1000500 3300005983 Bacteria 38559
90 Ga0081540_1001057 3300005983 Bacteria 24537
91 Ga0081540_1010805 3300005983 Bacteria 6138
92 Ga0081540_1021303 3300005983 Bacteria 3867
93 Ga0081540_1021435 3300005983 Bacteria 3847
94 Ga0081539_10000412 3300005985 Bacteria 91177
95 Ga0081539_10000958 3300005985 Bacteria 54105
96 Ga0081539_10001452 3300005985 Bacteria 40486
97 Ga0081539_10004158 3300005985 Bacteria 16432
98 Ga0081539_10014510 3300005985 Bacteria 5819
99 Ga0081539_10022688 3300005985 Bacteria 4140
100 Ga0081539_10038870 3300005985 Bacteria 2815
101 Ga0070717_10088612 3300006028 Bacteria 2609
102 Ga0070717_10137129 3300006028 Bacteria 2108
103 Ga0075365_10000419 3300006038 Bacteria 15674
104 Ga0075365_10000815 3300006038 Bacteria 12843
105 Ga0075365_10085287 3300006038 Bacteria 2145
106 Ga0075365_10107619 3300006038 Bacteria 1914
107 Ga0075365_10142633 3300006038 Bacteria 1663
108 Ga0075365_10257432 3300006038 Bacteria 1227
109 Ga0075368_10001494 3300006042 Bacteria 7488
110 Ga0075368_10010770 3300006042 Bacteria 3314
111 Ga0075363_100014800 3300006048 Bacteria 3822
112 Ga0075363_100017946 3300006048 Bacteria 3517
113 Ga0075363_100064495 3300006048 Bacteria 1979
114 Ga0075364_10087773 3300006051 Bacteria 2062
115 Ga0070716_100124339 3300006173 Bacteria 1620
116 Ga0070712_100020191 3300006175 Bacteria 4357
117 Ga0070712_100062312 3300006175 Bacteria 2637
118 Ga0070712_100086835 3300006175 Bacteria 2281
119 Ga0075362_10072158 3300006177 Bacteria 1579
120 Ga0075367_10001505 3300006178 Bacteria 10071
121 Ga0075367_10016732 3300006178 Bacteria 4009
122 Ga0075367_10021383 3300006178 Bacteria 3614
123 Ga0075367_10022044 3300006178 Bacteria 3567
124 Ga0075367_10032851 3300006178 Bacteria 2988
125 Ga0075367_10046261 3300006178 Bacteria 2556
126 Ga0075367_10058804 3300006178 Bacteria 2287
127 Ga0075367_10156851 3300006178 Bacteria 1414
128 Ga0075369_10018251 3300006186 Bacteria 2855
129 Ga0075366_10003688 3300006195 Bacteria 8127
130 Ga0075366_10220471 3300006195 Bacteria 1155
131 Ga0075370_10065508 3300006353 Bacteria 2072
132 Ga0075428_100009256 3300006844 Bacteria 10922
133 Ga0075428_100011376 3300006844 Bacteria 9896
134 Ga0075428_100060879 3300006844 Bacteria 4134
135 Ga0075428_100108793 3300006844 Bacteria 3021
136 Ga0075430_100000403 3300006846 Bacteria 32016
137 Ga0075430_100009608 3300006846 Bacteria 8175
138 Ga0075430_100025194 3300006846 Bacteria 5059
139 Ga0075431_100000432 3300006847 Bacteria 34232
140 Ga0075431_100000844 3300006847 Bacteria 26847
141 Ga0075431_100008226 3300006847 Bacteria 10426
142 Ga0075431_100010447 3300006847 Bacteria 9334
143 Ga0075431_100078962 3300006847 Bacteria 3398
144 Ga0075431_100178516 3300006847 Bacteria 2180
145 Ga0075433_10147725 3300006852 Bacteria 2090
146 Ga0075429_100007882 3300006880 Bacteria 9250
147 Ga0075429_100084873 3300006880 Bacteria 2760
148 Ga0068865_100120848 3300006881 Bacteria 1947
149 Ga0097620_100072457 3300006931 Bacteria 3482
150 Ga0097620_100093997 3300006931 Bacteria 3050
151 Ga0105240_10006662 3300009093 Bacteria 16935
152 Ga0105240_10007055 3300009093 Bacteria 16382
153 Ga0105240_10192205 3300009093 Bacteria 2399
154 Ga0105240_10283722 3300009093 Bacteria 1901
155 Ga0111539_10008683 3300009094 Bacteria 12897
156 Ga0111539_10014540 3300009094 Bacteria 9829
157 Ga0111539_10450877 3300009094 Bacteria 1498
158 Ga0105245_10030292 3300009098 Bacteria 4784
159 Ga0105245_10223955 3300009098 Bacteria 1816
160 Ga0114129_10009943 3300009147 Bacteria 13559
161 Ga0114129_10023073 3300009147 Bacteria 8827
162 Ga0114129_10033414 3300009147 Bacteria 7269
163 Ga0114129_10074287 3300009147 Bacteria 4735
164 Ga0114129_10231699 3300009147 Bacteria 2487
165 Ga0105243_10023914 3300009148 Bacteria 4656
166 Ga0105248_10005160 3300009177 Bacteria 14401
167 Ga0105237_10001018 3300009545 Bacteria 37737
168 Ga0105237_10005451 3300009545 Bacteria 14347
169 Ga0105238_10015381 3300009551 Bacteria 7746
170 Ga0105249_10067692 3300009553 Bacteria 3291
171 Ga0105249_10307346 3300009553 Bacteria 1593
172 Ga0105249_10327426 3300009553 Bacteria 1545
173 Ga0099796_10003509 3300010159 Bacteria 3652
174 Ga0099796_10010620 3300010159 Bacteria 2538
175 Ga0099796_10024293 3300010159 Bacteria 1901
176 Ga0105239_10005912 3300010375 Bacteria 14250
177 Ga0105239_10091596 3300010375 Bacteria 3355
178 Ga0105239_10124134 3300010375 Bacteria 2869
179 Ga0105239_10266881 3300010375 Bacteria 1924
180 Ga0105246_10040779 3300011119 Bacteria 3135
181 Ga0105246_10191479 3300011119 Bacteria 1583
182 Ga0157319_1000034 3300012497 Bacteria 45114
183 Ga0157373_10002989 3300013100 Bacteria 12788
184 Ga0157373_10004105 3300013100 Bacteria 10976
185 Ga0157370_10004026 3300013104 Bacteria 17072
186 Ga0157370_10006183 3300013104 Bacteria 13274
187 Ga0157369_10009404 3300013105 Bacteria 11174
188 Ga0157369_10013175 3300013105 Bacteria 9356
189 Ga0157369_10197338 3300013105 Bacteria 2113
190 Ga0157369_10576232 3300013105 Bacteria 1162
191 Ga0157374_10000032 3300013296 Bacteria 202485
192 Ga0157374_10104976 3300013296 Bacteria 2713
193 Ga0157378_10001975 3300013297 Bacteria 18336
194 Ga0157372_10030111 3300013307 Bacteria 5934
195 Ga0157372_10051544 3300013307 Bacteria 4581
196 Ga0157372_10081028 3300013307 Bacteria 3674
197 Ga0157375_10028050 3300013308 Bacteria 5271
198 Ga0157375_10067818 3300013308 Bacteria 3566
199 Ga0163163_10020276 3300014325 Bacteria 6257
200 Ga0157380_10054891 3300014326 Bacteria 3163
201 Ga0157380_10096616 3300014326 Bacteria 2450
202 Ga0157380_10140975 3300014326 Bacteria 2071
203 Ga0157379_10133913 3300014968 Bacteria 2232
204 Ga0157379_10305349 3300014968 Bacteria 1451
205 Ga0157376_10050347 3300014969 Bacteria 3456
206 Ga0206353_10788321 3300020082 Bacteria 1441
207 Ga0213872_10032693 3300021361 Bacteria 2384
208 Ga0213872_10042080 3300021361 Bacteria 2084
209 Ga0213876_10002353 3300021384 Bacteria 11130
210 Ga0213876_10005070 3300021384 Bacteria 7260
211 Ga0213876_10048849 3300021384 Bacteria 2235
212 Ga0213876_10070117 3300021384 Bacteria 1852
213 Ga0213875_10069519 3300021388 Bacteria 1644
214 Ga0213871_10002071 3300021441 Bacteria 3602
215 Ga0209759_1007875 3300025256 Bacteria 3373
216 Ga0209673_1022280 3300025273 Bacteria 2190
217 Ga0209130_1000279 3300025284 Bacteria 63145
218 Ga0209025_1000073 3300025294 Bacteria 282133
219 Ga0209025_1004844 3300025294 Bacteria 11360
220 Ga0209025_1046999 3300025294 Bacteria 1768
221 Ga0209564_1000005 3300025295 Bacteria 1147192
222 Ga0209564_1000054 3300025295 Bacteria 350653
223 Ga0209758_1000217 3300025297 Bacteria 124619
224 Ga0209758_1017833 3300025297 Bacteria 3510
225 Ga0209256_1000053 3300025299 Bacteria 298731
226 Ga0209256_1000084 3300025299 Bacteria 219257
227 Ga0209257_1000166 3300025304 Bacteria 172721
228 Ga0207697_10020158 3300025315 Bacteria 2731
229 Ga0207653_10002125 3300025885 Bacteria 6313
230 Ga0207692_10013851 3300025898 Bacteria 3509
231 Ga0207642_10016843 3300025899 Bacteria 2765
232 Ga0207647_10000570 3300025904 Bacteria 28805
233 Ga0207645_10062530 3300025907 Bacteria 2379
234 Ga0207705_10132582 3300025909 Bacteria 1855
235 Ga0207684_10004066 3300025910 Bacteria 13960
236 Ga0207707_10046897 3300025912 Bacteria 3764
237 Ga0207707_10087970 3300025912 Bacteria 2714
238 Ga0207707_10121963 3300025912 Bacteria 2279
239 Ga0207695_10007957 3300025913 Bacteria 13371
240 Ga0207695_10015131 3300025913 Bacteria 9101
241 Ga0207695_10090000 3300025913 Bacteria 3085
242 Ga0207671_10009664 3300025914 Bacteria 8034
243 Ga0207671_10028480 3300025914 Bacteria 4173
244 Ga0207693_10007885 3300025915 Bacteria 8745
245 Ga0207693_10080633 3300025915 Bacteria 2548
246 Ga0207693_10086536 3300025915 Bacteria 2455
247 Ga0207660_10002632 3300025917 Bacteria 11779
248 Ga0207660_10087522 3300025917 Bacteria 2302
249 Ga0207662_10008585 3300025918 Bacteria 5601
250 Ga0207662_10061444 3300025918 Bacteria 2256
251 Ga0207657_10004802 3300025919 Bacteria 14252
252 Ga0207657_10217678 3300025919 Bacteria 1531
253 Ga0207652_10020084 3300025921 Bacteria 5500
254 Ga0207646_10018806 3300025922 Bacteria 6435
255 Ga0207694_10139955 3300025924 Bacteria 1946
256 Ga0207664_10026991 3300025929 Bacteria 4348
257 Ga0207664_10113330 3300025929 Bacteria 2258
258 Ga0207690_10077326 3300025932 Bacteria 2313
259 Ga0207706_10080875 3300025933 Bacteria 2856
260 Ga0207686_10056770 3300025934 Bacteria 2462
261 Ga0207709_10005288 3300025935 Bacteria 7346
262 Ga0207709_10042737 3300025935 Bacteria 2728
263 Ga0207670_10001056 3300025936 Bacteria 14528
264 Ga0207670_10117349 3300025936 Bacteria 1928
265 Ga0207665_10122040 3300025939 Bacteria 1842
266 Ga0207691_10116127 3300025940 Bacteria 2376
267 Ga0207691_10142076 3300025940 Bacteria 2115
268 Ga0207711_10006770 3300025941 Bacteria 9633
269 Ga0207711_10284207 3300025941 Bacteria 1524
270 Ga0207689_10136519 3300025942 Bacteria 2020
271 Ga0207667_10004339 3300025949 Bacteria 17365
272 Ga0207651_10192517 3300025960 Bacteria 1628
273 Ga0207712_10136524 3300025961 Bacteria 1876
274 Ga0207712_10206112 3300025961 Bacteria 1563
275 Ga0207712_10216119 3300025961 Bacteria 1530
276 Ga0207668_10207237 3300025972 Bacteria 1566
277 Ga0207668_10437819 3300025972 Bacteria 1113
278 Ga0207640_10114098 3300025981 Bacteria 1922
279 Ga0207658_10116321 3300025986 Bacteria 2124
280 Ga0207639_10043832 3300026041 Bacteria 3361
281 Ga0207639_10057768 3300026041 Bacteria 2981
282 Ga0207639_10300441 3300026041 Bacteria 1419
283 Ga0207678_10004622 3300026067 Bacteria 12368
284 Ga0207678_10252196 3300026067 Bacteria 1511
285 Ga0207708_10016925 3300026075 Bacteria 5489
286 Ga0207708_10050606 3300026075 Bacteria 3162
287 Ga0207708_10152722 3300026075 Bacteria 1819
288 Ga0207702_10190171 3300026078 Bacteria 1896
289 Ga0207648_10019660 3300026089 Bacteria 6095
290 Ga0207676_10076266 3300026095 Bacteria 2708
291 Ga0207674_10002489 3300026116 Bacteria 23224
292 Ga0207675_100004466 3300026118 Bacteria 13519
293 Ga0207675_100069301 3300026118 Bacteria 3296
294 Ga0207675_100249596 3300026118 Bacteria 1717
295 Ga0207683_10176076 3300026121 Bacteria 1939
296 Ga0207683_10205668 3300026121 Bacteria 1790
297 Ga0207698_10152190 3300026142 Bacteria 2010
298 Ga0207428_10013443 3300027907 Bacteria 7150
299 Ga0268266_10105219 3300028379 Bacteria 2493
300 Ga0268266_10237404 3300028379 Bacteria 1681
301 Ga0268265_10005250 3300028380 Bacteria 8865
302 Ga0268265_10092418 3300028380 Bacteria 2422
303 Ga0268264_10007898 3300028381 Bacteria 8852
304 Ga0268264_10146212 3300028381 Bacteria 2114
305 Ga0307517_10000542 3300028786 Bacteria 64617
306 Ga0307515_10031025 3300028794 Bacteria 8938
307 Ga0265316_10077148 3300031344 Bacteria 2559
308 Ga0307513_10065242 3300031456 Bacteria 3831
309 Ga0316576_10004038 3300031727 Bacteria 8734
310 Ga0316578_10044763 3300031728 Bacteria 2575
311 Ga0307412_10317442 3300031911 Bacteria 1238
312 Ga0307409_100152627 3300031995 Bacteria 2008
313 Ga0307416_100015087 3300032002 Bacteria 5322
314 Ga0373934_0049500 3300035086 Bacteria 1664
315 Ga0373923_0000038 3300035111 Bacteria 20095
316 Ga0373941_0010050 3300035115 Bacteria 2403
317 Ga0373945_0004849 3300035116 Bacteria 4284
318 Ga0373945_0062531 3300035116 Bacteria 1392
319 Ga0373953_0002748 3300035117 Bacteria 5345
320 Ga0373957_0024592 3300035120 Bacteria 2164
321 Ga0373960_0035457 3300035121 Bacteria 1416
322 Ga0373946_0001654 3300035171 Bacteria 7759
323 Ga0373955_0000211 3300035172 Bacteria 24370
324 Ga0373962_0031440 3300035242 Bacteria 1456
325 Ga0373924_0001012 3300035410 Bacteria 8917
326 Ga0373935_0000189 3300035692 Bacteria 29172
327 Ga0373927_0004247 3300035695 Bacteria 10063
328 Ga0373927_0050273 3300035695 Bacteria 2695
329 Ga0373927_0077958 3300035695 Bacteria 2146
330 Ga0373933_0004367 3300035724 Bacteria 7763
331 Ga0373933_0019646 3300035724 Bacteria 3820
332 Ga0373947_0001868 3300035725 Bacteria 12844
333 Ga0373947_0010978 3300035725 Bacteria 5197
334 Ga0373947_0103359 3300035725 Bacteria 1793
335 Ga0373947_0199286 3300035725 Bacteria 1309
336 Ga0373937_0000009 3300036401 Bacteria 169521
337 Ga0373937_0001560 3300036401 Bacteria 19246
338 Ga0373937_0220614 3300036401 Bacteria 1785
339 Ga0373937_0269874 3300036401 Bacteria 1606
340 Ga0373925_0000194 3300037068 Bacteria 66124
341 Ga0373925_0046664 3300037068 Bacteria 3222
342 Ga0395899_0032803 3300037312 Bacteria 3902
343 Ga0395899_0136851 3300037312 Bacteria 1746
344 Ga0395900_0000601 3300037418 Bacteria 49219
345 Ga0395900_0003215 3300037418 Bacteria 17688
346 Ga0395900_0009089 3300037418 Bacteria 10182
347 Ga0395900_0024435 3300037418 Bacteria 6188
348 Ga0395900_0070127 3300037418 Bacteria 3603
349 Ga0395898_0003095 3300037466 Bacteria 18827
350 Ga0395898_0017681 3300037466 Bacteria 7276
351 Ga0395898_0063337 3300037466 Bacteria 3589
352 Ga0395898_0198341 3300037466 Bacteria 1917
353 Ga0436364_0564326 3300037853 Bacteria 7201
354 Ga0436364_0599244 3300037853 Unclassified 3074
355 Ga0436364_0694889 3300037853 Bacteria 1492
356 Ga0436364_0924195 3300037853 Bacteria 1685
357 Ga0395901_0002460 3300038443 Bacteria 18784
358 Ga0395901_0009772 3300038443 Bacteria 9728
359 Ga0395901_0090977 3300038443 Bacteria 3194
360 Ga0395901_0100288 3300038443 Bacteria 3037
361 Ga0400483_267904 3300039062 Bacteria 1720
362 Ga0436365_0533921 3300039437 Bacteria 2714
363 Ga0436365_1067165 3300039437 Bacteria 20470
364 Ga0436365_1357149 3300039437 Bacteria 4146
365 Ga0436360_0251738 3300039438 Bacteria 5054
366 Ga0436360_0513704 3300039438 Bacteria 16885
367 Ga0436360_1152915 3300039438 Bacteria 2383
368 Ga0436361_0080260 3300039447 Bacteria 3201
369 Ga0436361_0320271 3300039447 Bacteria 7469
370 Ga0436361_0420026 3300039447 Bacteria 3097
371 Ga0436361_0780738 3300039447 Bacteria 3319
372 Ga0436363_1335727 3300039450 Bacteria 2998
373 Ga0436362_0516227 3300039453 Bacteria 1639
374 Ga0439448_0000376 3300042005 Bacteria 10126
375 Ga0439459_0004519 3300042438 Bacteria 2241
376 Ga0466963_0006044 3300044694 Bacteria 7132
377 Ga0466963_0129769 3300044694 Bacteria 1740
378 Ga0466964_0105569 3300044706 Bacteria 1249
379 Ga0466957_0182539 3300044842 Bacteria 1371
380 Ga0466959_0043440 3300045049 Bacteria 3313
381 Ga0466959_0283397 3300045049 Bacteria 1137
382 Ga0466967_0053296 3300045976 Bacteria 3554
383 Ga0466967_0246773 3300045976 Bacteria 1704
384 Ga0495592_0000422 3300046454 Bacteria 32126
385 Ga0495629_0004190 3300046459 Bacteria 10826
386 Ga0495638_0113972 3300046460 Bacteria 1603
387 Ga0495651_0000300 3300046462 Bacteria 38562
388 Ga0495653_0000032 3300046463 Bacteria 132763
389 Ga0495639_0023478 3300046475 Bacteria 2711
390 Ga0495662_0016152 3300046476 Bacteria 3619
391 Ga0495662_0069290 3300046476 Bacteria 1708
392 Ga0495664_0000010 3300046477 Bacteria 268381
393 Ga0495606_0087317 3300046507 Bacteria 1926
394 Ga0495608_0000008 3300046511 Bacteria 268629
395 Ga0495618_0000002 3300046514 Bacteria 271353
396 Ga0495628_0000009 3300046516 Bacteria 237611
397 Ga0495630_0001655 3300046517 Bacteria 15506
398 Ga0495652_0000011 3300046529 Bacteria 255329
399 Ga0495640_0000009 3300046533 Bacteria 217086
400 Ga0495640_0119046 3300046533 Bacteria 1718
401 Ga0495586_0045851 3300046535 Bacteria 2357
402 Ga0495587_0000086 3300046536 Bacteria 72022
403 Ga0495645_0000010 3300046543 Bacteria 238337
404 Ga0495667_0000005 3300046559 Bacteria 268252
405 Ga0495656_0009134 3300046615 Bacteria 3560
406 Ga0495634_0000223 3300046642 Bacteria 53103
407 Ga0495634_0094385 3300046642 Bacteria 1939
408 Ga0495635_0000008 3300046663 Bacteria 268349
409 Ga0495659_0096620 3300046664 Bacteria 1140
410 Ga0495657_0000058 3300046675 Bacteria 97827
411 Ga0495599_0000007 3300046678 Bacteria 236638
412 Ga0495623_0000085 3300046679 Bacteria 55527
413 Ga0495646_0000021 3300046680 Bacteria 115358
414 Ga0495624_0024381 3300046690 Bacteria 3980
415 Ga0495600_0000001 3300046809 Bacteria 214870
416 Ga0495581_0037646 3300047315 Bacteria 2800
417 Ga0495581_0068897 3300047315 Bacteria 2046
418 Ga0495604_0000012 3300047317 Bacteria 268341
419 Ga0495674_0000011 3300047319 Bacteria 270911
420 Ga0495674_0112372 3300047319 Bacteria 2308
421 Ga0495680_0000245 3300047322 Bacteria 59987
422 Ga0495675_0000096 3300047444 Bacteria 62617
423 Ga0495684_0000084 3300047471 Bacteria 65600
424 Ga0495593_0000733 3300047673 Bacteria 19034
425 Ga0495602_0000073 3300048088 Bacteria 98745
426 Ga0496100_0040477 3300048903 Bacteria 2965
427 Ga0496100_0103606 3300048903 Bacteria 1965
428 Ga0496101_0014715 3300048904 Bacteria 5264
429 Ga0496101_0122003 3300048904 Bacteria 1971
430 Ga0496101_0261180 3300048904 Bacteria 1351
431 Ga0496102_0049368 3300048905 Bacteria 3828
432 Ga0496102_0320425 3300048905 Bacteria 1460
433 Ga0496103_0020033 3300048906 Bacteria 4016
434 Ga0496104_0000331 3300048907 Bacteria 42278
435 Ga0496104_0006182 3300048907 Bacteria 10515
436 Ga0496104_0021151 3300048907 Bacteria 5970
437 Ga0496104_0093972 3300048907 Bacteria 2868
438 Ga0496105_0003480 3300048908 Bacteria 11651
439 Ga0496105_0014480 3300048908 Bacteria 6279
440 Ga0496105_0064796 3300048908 Bacteria 3015
441 Ga0496106_0002189 3300048909 Bacteria 14603
442 Ga0496106_0015332 3300048909 Bacteria 5671
443 Ga0496106_0078178 3300048909 Bacteria 2538
444 Ga0496107_0009629 3300048910 Bacteria 6703
445 Ga0496107_0061870 3300048910 Bacteria 2711
446 Ga0496108_0001636 3300048911 Bacteria 17752
447 Ga0496108_0005160 3300048911 Bacteria 10558
448 Ga0496108_0051804 3300048911 Bacteria 3438
449 Ga0496108_0072335 3300048911 Bacteria 2910
450 Ga0496108_0436128 3300048911 Bacteria 1144
451 Ga0496109_0003182 3300048912 Bacteria 13673
452 Ga0496109_0003935 3300048912 Bacteria 12413
453 Ga0496109_0043674 3300048912 Bacteria 4063
454 Ga0496109_0067842 3300048912 Bacteria 3268
455 Ga0496110_0000113 3300048913 Bacteria 44443
456 Ga0496110_0011160 3300048913 Bacteria 7342
457 Ga0496110_0057919 3300048913 Bacteria 3412
458 Ga0496110_0318124 3300048913 Bacteria 1417
459 Ga0496110_0399292 3300048913 Bacteria 1253
460 Ga0496111_0000458 3300048914 Bacteria 20697
461 Ga0496111_0111680 3300048914 Bacteria 2013
462 Ga0496111_0138139 3300048914 Bacteria 1806
463 Ga0496112_0018608 3300048915 Bacteria 6545
464 Ga0496112_0019676 3300048915 Bacteria 6378
465 Ga0496112_0102652 3300048915 Bacteria 2830
466 Ga0496113_0002796 3300048916 Bacteria 10267
467 Ga0496113_0079612 3300048916 Bacteria 2509
468 Ga0496113_0143323 3300048916 Bacteria 1881
469 Ga0496114_0002808 3300048917 Bacteria 13342
470 Ga0496114_0042505 3300048917 Bacteria 3768
471 Ga0496114_0370092 3300048917 Bacteria 1268
472 Ga0496121_0101925 3300048924 Bacteria 2213
473 Ga0496122_0000830 3300048925 Bacteria 58620
474 Ga0496123_0002311 3300048926 Bacteria 23931
475 Ga0496126_0023023 3300048929 Bacteria 6042
476 Ga0496126_0189276 3300048929 Bacteria 1744
477 Ga0501031_0144579 3300049568 Bacteria 1554
478 Ga0501034_0063114 3300049571 Bacteria 3718
479 Ga0501034_0067183 3300049571 Bacteria 3599
480 Ga0501036_0378609 3300049572 Bacteria 1181
481 Ga0501038_0103749 3300049574 Bacteria 2364
482 Ga0501039_0227266 3300049575 Bacteria 1467
483 Ga0501040_0128513 3300049576 Bacteria 1781
484 Ga0501041_0054796 3300049577 Bacteria 2433
485 Ga0501041_0112687 3300049577 Bacteria 1688
486 Ga0501046_0062154 3300049580 Bacteria 2919
487 Ga0501046_0074586 3300049580 Bacteria 2632
488 Ga0501047_0148081 3300049581 Bacteria 2224
489 Ga0501071_0170571 3300049587 Bacteria 1629
490 Ga0501072_0026570 3300049588 Bacteria 4514
491 Ga0501072_0033116 3300049588 Bacteria 4049
492 Ga0501072_0098834 3300049588 Bacteria 2320
493 Ga0501073_0014682 3300049589 Bacteria 5690
494 Ga0501073_0058672 3300049589 Bacteria 2689
495 Ga0501074_0078846 3300049590 Bacteria 2363
496 Ga0501074_0094260 3300049590 Bacteria 2144
497 Ga0501075_0044595 3300049591 Bacteria 3327
498 Ga0501075_0191325 3300049591 Bacteria 1561
499 Ga0501076_0005380 3300049592 Bacteria 9198
500 Ga0501076_0255826 3300049592 Bacteria 1433
501 Ga0501076_0257592 3300049592 Bacteria 1428
502 Ga0501077_0087328 3300049593 Bacteria 1977
503 Ga0501079_0005691 3300049741 Bacteria 9309
504 Ga0501079_0009720 3300049741 Bacteria 7293
505 Ga0501079_0093712 3300049741 Bacteria 2327
506 Ga0501079_0131765 3300049741 Bacteria 1945
507 Ga0501080_0091492 3300049742 Bacteria 2826
508 Ga0501080_0131199 3300049742 Bacteria 2320
509 Ga0501081_0012497 3300049743 Bacteria 5582
510 Ga0501081_0018361 3300049743 Bacteria 4644
511 Ga0501081_0065404 3300049743 Bacteria 2527
512 Ga0501083_0021221 3300049744 Bacteria 4514
513 Ga0501045_0059773 3300049824 Bacteria 2793
514 Ga0501045_0068306 3300049824 Bacteria 2611
515 Ga0501045_0082897 3300049824 Bacteria 2365
516 Ga0501045_0183452 3300049824 Bacteria 1559
517 nmdc:mga00v17_52212_c1 3300050491 Bacteria 2487
518 nmdc:mga0yw44_159673_c1 3300050492 Bacteria 1475
519 nmdc:mga0yw44_224073_c1 3300050492 Bacteria 1247
520 nmdc:mga0yw44_64992_c1 3300050492 Bacteria 2247
521 nmdc:mga0yw44_84057_c1 3300050492 Bacteria 2000
522 nmdc:mga0k408_164514_c1 3300050493 Bacteria 1322
523 nmdc:mga0k408_2954_c1 3300050493 Bacteria 9010
524 nmdc:mga0k408_43252_c1 3300050493 Bacteria 2595
525 nmdc:mga06z11_109011_c1 3300050494 Bacteria 1531
526 nmdc:mga06z11_1148_c1 3300050494 Bacteria 9678
527 nmdc:mga06z11_136212_c1 3300050494 Bacteria 1384
528 nmdc:mga06z11_143337_c1 3300050494 Bacteria 1352
529 nmdc:mga06z11_628_c1 3300050494 Bacteria 12838
530 nmdc:mga07m45_24187_c1 3300050496 Bacteria 3326
531 nmdc:mga05p37_1744_c1 3300050507 Bacteria 25379
532 nmdc:mga05p37_322985_c1 3300050507 Bacteria 1826
533 nmdc:mga05p37_6447_c1 3300050507 Bacteria 13837
534 nmdc:mga09592_59490_c1 3300050508 Bacteria 3230
535 nmdc:mga0qj67_10569_c1 3300050509 Bacteria 6895
536 nmdc:mga0qj67_48717_c1 3300050509 Bacteria 3348
537 nmdc:mga0qj67_50_c1 3300050509 Bacteria 50243
538 nmdc:mga06r32_1075_c1 3300050510 Bacteria 24529
539 nmdc:mga06r32_25938_c1 3300050510 Bacteria 5458
540 nmdc:mga06r32_5030_c1 3300050510 Bacteria 11903
541 nmdc:mga06r32_98904_c1 3300050510 Bacteria 2861
542 nmdc:mga08y16_11069_c1 3300050511 Bacteria 9471
543 nmdc:mga08y16_132709_c1 3300050511 Bacteria 2589
544 nmdc:mga08y16_244315_c1 3300050511 Bacteria 1855
545 nmdc:mga0sz30_52569_c1 3300050516 Bacteria 1729
546 nmdc:mga0sz30_7775_c1 3300050516 Bacteria 4029
547 Ga0495601_0000009 3300053077 Bacteria 270622
548 Ga0495601_0041414 3300053077 Bacteria 2887
549 Ga0495612_0000019 3300053078 Bacteria 137844
550 Ga0495595_0000015 3300053084 Bacteria 144946
551 Ga0495619_0000012 3300053085 Bacteria 268349
552 Ga0495619_0016139 3300053085 Bacteria 4727
553 Ga0500641_0000267 3300053096 Bacteria 19425
554 Ga0500641_0089343 3300053096 Bacteria 1314
555 Ga0500593_009884 3300053117 Bacteria 3979
556 Ga0500595_006114 3300053119 Bacteria 5160
557 Ga0500595_015611 3300053119 Bacteria 2847
558 Ga0500652_000260 3300053131 Bacteria 19773
559 Ga0500616_0005438 3300053153 Bacteria 8643
560 Ga0500616_0032859 3300053153 Bacteria 2835
561 Ga0500636_0001633 3300053177 Bacteria 12244
562 Ga0500636_0020536 3300053177 Bacteria 3912
563 Ga0500645_025872 3300053730 Bacteria 1788
564 Ga0501084_0016653 3300054114 Bacteria 6105
565 Ga0501084_0047112 3300054114 Bacteria 3610
566 Ga0501082_0055432 3300060353 Bacteria 3415
567 Ga0501082_0341043 3300060353 Bacteria 1306
568 Ga0501082_0429664 3300060353 Bacteria 1153
569 Ga0530510_0013983 3300061734 Bacteria 5656
570 Ga0530510_0060615 3300061734 Bacteria 2738
571 2545677725 2545555834 Bacteria 8130841
572 2644743311 2643221736 Bacteria 6608466
573 2776269245 2775506902 Bacteria 6208009
574 2776283616 2775506904 Bacteria 5954060
575 2831866949 2831864461 Bacteria 6502356
576 2839997688 2839993093 Bacteria 5512535
577 2840765979 2840764183 Bacteria 6358399
578 2842339209 2842333319 Bacteria 8899485
579 2844322683 2844315083 Bacteria 8138177
580 2851184156 2851182111 Bacteria 6047226
581 2886854287 2886848708 Bacteria 5632523
582 2894657123 2894652903 Bacteria 4587256
583 2902336331 2902330777 Bacteria 6395352
584 2902411761 2902405164 Bacteria 6784948
585 2903734802 2903727486 Bacteria 8281579
586 2904548103 2904541872 Bacteria 8915136
587 2906604887 2906602504 Bacteria 8295279
588 2917705658 2917699015 Bacteria 7043791
589 2919123496 2919119836 Bacteria 5208557
590 2929163034 2929160207 Bacteria 9075316
591 3005413876 3005409236 Bacteria 7188837
592 3005602723 3005594810 Bacteria 8716512
593 3005712659 3005710791 Bacteria 7622528
594 3005725195 3005718088 Bacteria 8283608
595 641646864 641522639 Bacteria 7737025
596 643599183 643348564 Bacteria 8839022
597 8056976658 8056967851 Bacteria 9038162
598 Ga0496121_0048600
599 JGI25159J45721_1005941
600 JGI25406J46586_10008417
601 JGI25153J46596_10004136
602 Ga0055526_1009177
603 Ga0055524_1000116
604 Ga0065165_1000070
605 Ga0065165_1000234
606 Ga0065715_10203078
607 Ga0070676_10153086
608 Ga0070683_100079815
609 Ga0070670_100124447
610 Ga0068869_100060155
611 Ga0068869_100096279
612 Ga0070680_100002201
613 Ga0070680_100177952
614 Ga0070682_100005041
615 Ga0070660_100002575
616 Ga0070689_100021942
617 Ga0070689_100087596
618 Ga0070691_10015849
619 Ga0070691_10047899
620 Ga0070687_100032606
621 Ga0070668_100058386
622 Ga0070669_100113857
623 Ga0070669_100224401
624 Ga0070675_100097452
625 Ga0070674_100038161
626 Ga0070674_100064885
627 Ga0070673_100071230
628 Ga0070688_100011735
629 Ga0070659_100088277
630 Ga0070709_10039935
631 Ga0070714_100032781
632 Ga0070714_100338793
633 Ga0070710_10040820
634 Ga0070711_100337845
635 Ga0070705_100000415
636 Ga0070700_100026852
637 Ga0070694_100000944
638 Ga0070708_100211795
639 Ga0070678_100172932
640 Ga0070678_100408135
641 Ga0070681_10011866
642 Ga0070681_10041276
643 Ga0070681_10083856
644 Ga0070685_10127162
645 Ga0070707_100015628
646 Ga0070707_100393412
647 Ga0070698_100007295
648 Ga0070698_100114754
649 Ga0070699_100001621
650 Ga0070699_100001673
651 Ga0070699_100020221
652 Ga0070679_100007044
653 Ga0070697_100002273
654 Ga0070697_100050959
655 Ga0068853_100019915
656 Ga0070672_100057304
657 Ga0070672_100094783
658 Ga0070672_100226424
659 Ga0070695_100001385
660 Ga0070695_100091880
661 Ga0070696_100000318
662 Ga0070693_100045950
663 Ga0070665_100160106
664 Ga0070665_100422580
665 Ga0070704_100000250
666 Ga0068855_100007113
667 Ga0068857_100059443
668 Ga0068856_100158083
669 Ga0068856_100232428
670 Ga0070702_100141662
671 Ga0070702_100286201
672 Ga0068852_100096518
673 Ga0068859_100072457
674 Ga0068859_100093996
675 Ga0068864_100016345
676 Ga0068864_100034144
677 Ga0068861_100001902
678 Ga0068861_100027157
679 Ga0068861_100035273
680 Ga0068851_10071947
681 Ga0068863_100028883
682 Ga0068860_100010461
683 Ga0068860_100250505
684 Ga0068862_100024652
685 Ga0081540_1000245
686 Ga0081540_1000500
687 Ga0081540_1001057
688 Ga0081540_1010805
689 Ga0081540_1021303
690 Ga0081540_1021435
691 Ga0081539_10000412
692 Ga0081539_10000958
693 Ga0081539_10001452
694 Ga0081539_10004158
695 Ga0081539_10014510
696 Ga0081539_10022688
697 Ga0081539_10038870
698 Ga0070717_10088612
699 Ga0070717_10137129
700 Ga0075365_10000419
701 Ga0075365_10000815
702 Ga0075365_10085287
703 Ga0075365_10107619
704 Ga0075365_10142633
705 Ga0075365_10257432
706 Ga0075368_10001494
707 Ga0075368_10010770
708 Ga0075363_100014800
709 Ga0075363_100017946
710 Ga0075363_100064495
711 Ga0075364_10087773
712 Ga0070716_100124339
713 Ga0070712_100020191
714 Ga0070712_100062312
715 Ga0070712_100086835
716 Ga0075362_10072158
717 Ga0075367_10001505
718 Ga0075367_10016732
719 Ga0075367_10021383
720 Ga0075367_10022044
721 Ga0075367_10032851
722 Ga0075367_10046261
723 Ga0075367_10058804
724 Ga0075367_10156851
725 Ga0075369_10018251
726 Ga0075366_10003688
727 Ga0075366_10220471
728 Ga0075370_10065508
729 Ga0075428_100009256
730 Ga0075428_100011376
731 Ga0075428_100060879
732 Ga0075428_100108793
733 Ga0075430_100000403
734 Ga0075430_100009608
735 Ga0075430_100025194
736 Ga0075431_100000432
737 Ga0075431_100000844
738 Ga0075431_100008226
739 Ga0075431_100010447
740 Ga0075431_100078962
741 Ga0075431_100178516
742 Ga0075433_10147725
743 Ga0075429_100007882
744 Ga0075429_100084873
745 Ga0068865_100120848
746 Ga0097620_100072457
747 Ga0097620_100093997
748 Ga0105240_10006662
749 Ga0105240_10007055
750 Ga0105240_10192205
751 Ga0105240_10283722
752 Ga0111539_10008683
753 Ga0111539_10014540
754 Ga0111539_10450877
755 Ga0105245_10030292
756 Ga0105245_10223955
757 Ga0114129_10009943
758 Ga0114129_10023073
759 Ga0114129_10033414
760 Ga0114129_10074287
761 Ga0114129_10231699
762 Ga0105243_10023914
763 Ga0105248_10005160
764 Ga0105237_10001018
765 Ga0105237_10005451
766 Ga0105238_10015381
767 Ga0105249_10067692
768 Ga0105249_10307346
769 Ga0105249_10327426
770 Ga0099796_10003509
771 Ga0099796_10010620
772 Ga0099796_10024293
773 Ga0105239_10005912
774 Ga0105239_10091596
775 Ga0105239_10124134
776 Ga0105239_10266881
777 Ga0105246_10040779
778 Ga0105246_10191479
779 Ga0157319_1000034
780 Ga0157373_10002989
781 Ga0157373_10004105
782 Ga0157370_10004026
783 Ga0157370_10006183
784 Ga0157369_10009404
785 Ga0157369_10013175
786 Ga0157369_10197338
787 Ga0157369_10576232
788 Ga0157374_10000032
789 Ga0157374_10104976
790 Ga0157378_10001975
791 Ga0157372_10030111
792 Ga0157372_10051544
793 Ga0157372_10081028
794 Ga0157375_10028050
795 Ga0157375_10067818
796 Ga0163163_10020276
797 Ga0157380_10054891
798 Ga0157380_10096616
799 Ga0157380_10140975
800 Ga0157379_10133913
801 Ga0157379_10305349
802 Ga0157376_10050347
803 Ga0206353_10788321
804 Ga0213872_10032693
805 Ga0213872_10042080
806 Ga0213876_10002353
807 Ga0213876_10005070
808 Ga0213876_10048849
809 Ga0213876_10070117
810 Ga0213875_10069519
811 Ga0213871_10002071
812 Ga0209759_1007875
813 Ga0209673_1022280
814 Ga0209130_1000279
815 Ga0209025_1000073
816 Ga0209025_1004844
817 Ga0209025_1046999
818 Ga0209564_1000005
819 Ga0209564_1000054
820 Ga0209758_1000217
821 Ga0209758_1017833
822 Ga0209256_1000053
823 Ga0209256_1000084
824 Ga0209257_1000166
825 Ga0207697_10020158
826 Ga0207653_10002125
827 Ga0207692_10013851
828 Ga0207642_10016843
829 Ga0207647_10000570
830 Ga0207645_10062530
831 Ga0207705_10132582
832 Ga0207684_10004066
833 Ga0207707_10046897
834 Ga0207707_10087970
835 Ga0207707_10121963
836 Ga0207695_10007957
837 Ga0207695_10015131
838 Ga0207695_10090000
839 Ga0207671_10009664
840 Ga0207671_10028480
841 Ga0207693_10007885
842 Ga0207693_10080633
843 Ga0207693_10086536
844 Ga0207660_10002632
845 Ga0207660_10087522
846 Ga0207662_10008585
847 Ga0207662_10061444
848 Ga0207657_10004802
849 Ga0207657_10217678
850 Ga0207652_10020084
851 Ga0207646_10018806
852 Ga0207694_10139955
853 Ga0207664_10026991
854 Ga0207664_10113330
855 Ga0207690_10077326
856 Ga0207706_10080875
857 Ga0207686_10056770
858 Ga0207709_10005288
859 Ga0207709_10042737
860 Ga0207670_10001056
861 Ga0207670_10117349
862 Ga0207665_10122040
863 Ga0207691_10116127
864 Ga0207691_10142076
865 Ga0207711_10006770
866 Ga0207711_10284207
867 Ga0207689_10136519
868 Ga0207667_10004339
869 Ga0207651_10192517
870 Ga0207712_10136524
871 Ga0207712_10206112
872 Ga0207712_10216119
873 Ga0207668_10207237
874 Ga0207668_10437819
875 Ga0207640_10114098
876 Ga0207658_10116321
877 Ga0207639_10043832
878 Ga0207639_10057768
879 Ga0207639_10300441
880 Ga0207678_10004622
881 Ga0207678_10252196
882 Ga0207708_10016925
883 Ga0207708_10050606
884 Ga0207708_10152722
885 Ga0207702_10190171
886 Ga0207648_10019660
887 Ga0207676_10076266
888 Ga0207674_10002489
889 Ga0207675_100004466
890 Ga0207675_100069301
891 Ga0207675_100249596
892 Ga0207683_10176076
893 Ga0207683_10205668
894 Ga0207698_10152190
895 Ga0207428_10013443
896 Ga0268266_10105219
897 Ga0268266_10237404
898 Ga0268265_10005250
899 Ga0268265_10092418
900 Ga0268264_10007898
901 Ga0268264_10146212
902 Ga0307517_10000542
903 Ga0307515_10031025
904 Ga0265316_10077148
905 Ga0307513_10065242
906 Ga0316576_10004038
907 Ga0316578_10044763
908 Ga0307412_10317442
909 Ga0307409_100152627
910 Ga0307416_100015087
911 Ga0373934_0049500
912 Ga0373923_0000038
913 Ga0373941_0010050
914 Ga0373945_0004849
915 Ga0373945_0062531
916 Ga0373953_0002748
917 Ga0373957_0024592
918 Ga0373960_0035457
919 Ga0373946_0001654
920 Ga0373955_0000211
921 Ga0373962_0031440
922 Ga0373924_0001012
923 Ga0373935_0000189
924 Ga0373927_0004247
925 Ga0373927_0050273
926 Ga0373927_0077958
927 Ga0373933_0004367
928 Ga0373933_0019646
929 Ga0373947_0001868
930 Ga0373947_0010978
931 Ga0373947_0103359
932 Ga0373947_0199286
933 Ga0373937_0000009
934 Ga0373937_0001560
935 Ga0373937_0220614
936 Ga0373937_0269874
937 Ga0373925_0000194
938 Ga0373925_0046664
939 Ga0395899_0032803
940 Ga0395899_0136851
941 Ga0395900_0000601
942 Ga0395900_0003215
943 Ga0395900_0009089
944 Ga0395900_0024435
945 Ga0395900_0070127
946 Ga0395898_0003095
947 Ga0395898_0017681
948 Ga0395898_0063337
949 Ga0395898_0198341
950 Ga0436364_0564326
951 Ga0436364_0599244
952 Ga0436364_0694889
953 Ga0436364_0924195
954 Ga0395901_0002460
955 Ga0395901_0009772
956 Ga0395901_0090977
957 Ga0395901_0100288
958 Ga0400483_267904
959 Ga0436365_0533921
960 Ga0436365_1067165
961 Ga0436365_1357149
962 Ga0436360_0251738
963 Ga0436360_0513704
964 Ga0436360_1152915
965 Ga0436361_0080260
966 Ga0436361_0320271
967 Ga0436361_0420026
968 Ga0436361_0780738
969 Ga0436363_1335727
970 Ga0436362_0516227
971 Ga0439448_0000376
972 Ga0439459_0004519
973 Ga0466963_0006044
974 Ga0466963_0129769
975 Ga0466964_0105569
976 Ga0466957_0182539
977 Ga0466959_0043440
978 Ga0466959_0283397
979 Ga0466967_0053296
980 Ga0466967_0246773
981 Ga0495592_0000422
982 Ga0495629_0004190
983 Ga0495638_0113972
984 Ga0495651_0000300
985 Ga0495653_0000032
986 Ga0495639_0023478
987 Ga0495662_0016152
988 Ga0495662_0069290
989 Ga0495664_0000010
990 Ga0495606_0087317
991 Ga0495608_0000008
992 Ga0495618_0000002
993 Ga0495628_0000009
994 Ga0495630_0001655
995 Ga0495652_0000011
996 Ga0495640_0000009
997 Ga0495640_0119046
998 Ga0495586_0045851
999 Ga0495587_0000086
1000 Ga0495645_0000010
1001 Ga0495667_0000005
1002 Ga0495656_0009134
1003 Ga0495634_0000223
1004 Ga0495634_0094385
1005 Ga0495635_0000008
1006 Ga0495659_0096620
1007 Ga0495657_0000058
1008 Ga0495599_0000007
1009 Ga0495623_0000085
1010 Ga0495646_0000021
1011 Ga0495624_0024381
1012 Ga0495600_0000001
1013 Ga0495581_0037646
1014 Ga0495581_0068897
1015 Ga0495604_0000012
1016 Ga0495674_0000011
1017 Ga0495674_0112372
1018 Ga0495680_0000245
1019 Ga0495675_0000096
1020 Ga0495684_0000084
1021 Ga0495593_0000733
1022 Ga0495602_0000073
1023 Ga0496100_0040477
1024 Ga0496100_0103606
1025 Ga0496101_0014715
1026 Ga0496101_0122003
1027 Ga0496101_0261180
1028 Ga0496102_0049368
1029 Ga0496102_0320425
1030 Ga0496103_0020033
1031 Ga0496104_0000331
1032 Ga0496104_0006182
1033 Ga0496104_0021151
1034 Ga0496104_0093972
1035 Ga0496105_0003480
1036 Ga0496105_0014480
1037 Ga0496105_0064796
1038 Ga0496106_0002189
1039 Ga0496106_0015332
1040 Ga0496106_0078178
1041 Ga0496107_0009629
1042 Ga0496107_0061870
1043 Ga0496108_0001636
1044 Ga0496108_0005160
1045 Ga0496108_0051804
1046 Ga0496108_0072335
1047 Ga0496108_0436128
1048 Ga0496109_0003182
1049 Ga0496109_0003935
1050 Ga0496109_0043674
1051 Ga0496109_0067842
1052 Ga0496110_0000113
1053 Ga0496110_0011160
1054 Ga0496110_0057919
1055 Ga0496110_0318124
1056 Ga0496110_0399292
1057 Ga0496111_0000458
1058 Ga0496111_0111680
1059 Ga0496111_0138139
1060 Ga0496112_0018608
1061 Ga0496112_0019676
1062 Ga0496112_0102652
1063 Ga0496113_0002796
1064 Ga0496113_0079612
1065 Ga0496113_0143323
1066 Ga0496114_0002808
1067 Ga0496114_0042505
1068 Ga0496114_0370092
1069 Ga0496121_0101925
1070 Ga0496122_0000830
1071 Ga0496123_0002311
1072 Ga0496126_0023023
1073 Ga0496126_0189276
1074 Ga0501031_0144579
1075 Ga0501034_0063114
1076 Ga0501034_0067183
1077 Ga0501036_0378609
1078 Ga0501038_0103749
1079 Ga0501039_0227266
1080 Ga0501040_0128513
1081 Ga0501041_0054796
1082 Ga0501041_0112687
1083 Ga0501046_0062154
1084 Ga0501046_0074586
1085 Ga0501047_0148081
1086 Ga0501071_0170571
1087 Ga0501072_0026570
1088 Ga0501072_0033116
1089 Ga0501072_0098834
1090 Ga0501073_0014682
1091 Ga0501073_0058672
1092 Ga0501074_0078846
1093 Ga0501074_0094260
1094 Ga0501075_0044595
1095 Ga0501075_0191325
1096 Ga0501076_0005380
1097 Ga0501076_0255826
1098 Ga0501076_0257592
1099 Ga0501077_0087328
1100 Ga0501079_0005691
1101 Ga0501079_0009720
1102 Ga0501079_0093712
1103 Ga0501079_0131765
1104 Ga0501080_0091492
1105 Ga0501080_0131199
1106 Ga0501081_0012497
1107 Ga0501081_0018361
1108 Ga0501081_0065404
1109 Ga0501083_0021221
1110 Ga0501045_0059773
1111 Ga0501045_0068306
1112 Ga0501045_0082897
1113 Ga0501045_0183452
1114 nmdc:mga00v17_52212_c1
1115 nmdc:mga0yw44_159673_c1
1116 nmdc:mga0yw44_224073_c1
1117 nmdc:mga0yw44_64992_c1
1118 nmdc:mga0yw44_84057_c1
1119 nmdc:mga0k408_164514_c1
1120 nmdc:mga0k408_2954_c1
1121 nmdc:mga0k408_43252_c1
1122 nmdc:mga06z11_109011_c1
1123 nmdc:mga06z11_1148_c1
1124 nmdc:mga06z11_136212_c1
1125 nmdc:mga06z11_143337_c1
1126 nmdc:mga06z11_628_c1
1127 nmdc:mga07m45_24187_c1
1128 nmdc:mga05p37_1744_c1
1129 nmdc:mga05p37_322985_c1
1130 nmdc:mga05p37_6447_c1
1131 nmdc:mga09592_59490_c1
1132 nmdc:mga0qj67_10569_c1
1133 nmdc:mga0qj67_48717_c1
1134 nmdc:mga0qj67_50_c1
1135 nmdc:mga06r32_1075_c1
1136 nmdc:mga06r32_25938_c1
1137 nmdc:mga06r32_5030_c1
1138 nmdc:mga06r32_98904_c1
1139 nmdc:mga08y16_11069_c1
1140 nmdc:mga08y16_132709_c1
1141 nmdc:mga08y16_244315_c1
1142 nmdc:mga0sz30_52569_c1
1143 nmdc:mga0sz30_7775_c1
1144 Ga0495601_0000009
1145 Ga0495601_0041414
1146 Ga0495612_0000019
1147 Ga0495595_0000015
1148 Ga0495619_0000012
1149 Ga0495619_0016139
1150 Ga0500641_0000267
1151 Ga0500641_0089343
1152 Ga0500593_009884
1153 Ga0500595_006114
1154 Ga0500595_015611
1155 Ga0500652_000260
1156 Ga0500616_0005438
1157 Ga0500616_0032859
1158 Ga0500636_0001633
1159 Ga0500636_0020536
1160 Ga0500645_025872
1161 Ga0501084_0016653
1162 Ga0501084_0047112
1163 Ga0501082_0055432
1164 Ga0501082_0341043
1165 Ga0501082_0429664
1166 Ga0530510_0013983
1167 Ga0530510_0060615
1168 2545677725
1169 2644743311
1170 2776269245
1171 2776283616
1172 2831866949
1173 2839997688
1174 2840765979
1175 2842339209
1176 2844322683
1177 2851184156
1178 2886854287
1179 2894657123
1180 2902336331
1181 2902411761
1182 2903734802
1183 2904548103
1184 2906604887
1185 2917705658
1186 2919123496
1187 2929163034
1188 3005413876
1189 3005602723
1190 3005712659
1191 3005725195
1192 641646864
1193 643599183
1194 8056976658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

42

389

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fmx-assembly1.cif.gz_X crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh 0.9264 4 353
2g4o-assembly1.cif.gz_A anomalous substructure of 3-isopropylmalate dehydrogenase 0.9091 4 352
3fmx-assembly1.cif.gz_X crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh 0.9039 4 353
2g4o-assembly1.cif.gz_A anomalous substructure of 3-isopropylmalate dehydrogenase 0.9014 4 352
3blx-assembly1.cif.gz_C yeast isocitrate dehydrogenase (apo form) 0.8965 5 353
ID Description Score Start End Superfamily
af_P76251_1_360_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9317 1 353 3.40.718.10
af_A0A1D6Q461_5_211_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9174 152 353 3.40.718.10
af_P76251_1_360_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9165 1 353 3.40.718.10
1w0dB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9049 4 352 3.40.718.10
1w0dB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8972 4 352 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A841PEV9-F1-model_v4 Isocitrate/isopropylmalate dehydrogenase 0.9692 155 355 GO:0000287
GO:0016616
GO:0051287
AF-A0A3M6F7L2-F1-model_v4 deleted 0.9652 169 353
AF-A0A4R8RF84-F1-model_v4 D-malate dehydrogenase 0.9647 160 353 GO:0000287
GO:0016616
GO:0051287
AF-A0A381H382-F1-model_v4 deleted 0.9627 166 274
AF-A0A2T5G3I3-F1-model_v4 3-isopropylmalate dehydrogenase 0.9588 184 354 GO:0000287
GO:0016616
GO:0051287

Map