F467714

General Info

Members Datasets Scaffolds Average Seq Length
597 253 1194 135

Family's Representative Sequence

Representative Sequence 3300049778|Ga0501282_004369|Ga0501282_004369_413_811
Length 120
Sequence MHTAENLRLHAIAPTTEVSTAQRLPYFVGISGQTVGATGLSMHLVVIPPGARSAPHLHLGYETGIYVLEGEVLTRWGESLFVPPGVPHEAVNLSATQPARAVVARNDPAEQDKVQPWPPA

Samples

Sample ID Description Type Environment
1 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
184 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
185 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
189 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
242 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
251 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0.17
Rhizoplane 4.52
Rhizosphere 92.29
Stem 0
Stem Tuber 0
Unclassified 10.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501282_004369 3300049778 Bacteria 1516
2 MBSR1b_contig_5816244 2162886012 Bacteria 1420
3 rootL2_10044705 3300003322 Bacteria 3459
4 Ga0065715_10084327 3300005293 Bacteria 523
5 Ga0070658_10096885 3300005327 Bacteria 2436
6 Ga0070658_10150737 3300005327 Bacteria 1947
7 Ga0070658_10159991 3300005327 Bacteria 1889
8 Ga0070676_10003182 3300005328 Bacteria 8508
9 Ga0070676_10039058 3300005328 Bacteria 2743
10 Ga0070676_10075206 3300005328 Bacteria 2036
11 Ga0070676_10889810 3300005328 Bacteria 662
12 Ga0070683_100864872 3300005329 Unclassified 867
13 Ga0070683_102167060 3300005329 Bacteria 534
14 Ga0070690_100001778 3300005330 Bacteria 11400
15 Ga0070690_100371727 3300005330 Bacteria 1043
16 Ga0070670_100065541 3300005331 Bacteria 3116
17 Ga0070670_100147044 3300005331 Bacteria 2039
18 Ga0070670_100250651 3300005331 Bacteria 1542
19 Ga0070670_100795879 3300005331 Bacteria 854
20 Ga0070677_10030699 3300005333 Bacteria 2048
21 Ga0070677_10069013 3300005333 Bacteria 1481
22 Ga0070677_10453890 3300005333 Unclassified 686
23 Ga0070677_10668484 3300005333 Bacteria 582
24 Ga0068869_100000718 3300005334 Bacteria 18832
25 Ga0068869_100007560 3300005334 Bacteria 6954
26 Ga0068869_100257694 3300005334 Bacteria 1395
27 Ga0068869_100872280 3300005334 Unclassified 777
28 Ga0070666_10049572 3300005335 Bacteria 2822
29 Ga0070666_10255360 3300005335 Bacteria 1242
30 Ga0070666_10929426 3300005335 Unclassified 644
31 Ga0070680_100011800 3300005336 Bacteria 6777
32 Ga0068868_100099259 3300005338 Bacteria 2355
33 Ga0068868_100538589 3300005338 Bacteria 1027
34 Ga0068868_100702629 3300005338 Bacteria 905
35 Ga0068868_101291258 3300005338 Unclassified 678
36 Ga0070660_100162290 3300005339 Bacteria 1801
37 Ga0070660_100421153 3300005339 Bacteria 1106
38 Ga0070660_101429958 3300005339 Bacteria 587
39 Ga0070689_101613965 3300005340 Unclassified 589
40 Ga0070687_100127316 3300005343 Bacteria 1466
41 Ga0070687_100580536 3300005343 Bacteria 767
42 Ga0070661_100293791 3300005344 Bacteria 1263
43 Ga0070661_100510123 3300005344 Bacteria 963
44 Ga0070668_100008010 3300005347 Bacteria 7849
45 Ga0070668_100015262 3300005347 Bacteria 5739
46 Ga0070669_100001820 3300005353 Bacteria 15349
47 Ga0070669_100046828 3300005353 Bacteria 3153
48 Ga0070669_100517504 3300005353 Bacteria 991
49 Ga0070669_100597020 3300005353 Bacteria 925
50 Ga0070675_100004647 3300005354 Bacteria 10488
51 Ga0070675_100042054 3300005354 Bacteria 3733
52 Ga0070675_100144168 3300005354 Bacteria 2038
53 Ga0070675_100682799 3300005354 Bacteria 934
54 Ga0070675_101012871 3300005354 Bacteria 763
55 Ga0070671_100012493 3300005355 Bacteria 6838
56 Ga0070671_100108381 3300005355 Bacteria 2332
57 Ga0070671_101460893 3300005355 Bacteria 605
58 Ga0070674_100037699 3300005356 Bacteria 3253
59 Ga0070674_100040651 3300005356 Bacteria 3147
60 Ga0070674_100128890 3300005356 Bacteria 1883
61 Ga0070674_100505812 3300005356 Unclassified 1007
62 Ga0070674_100655860 3300005356 Bacteria 892
63 Ga0070673_100071066 3300005364 Bacteria 2795
64 Ga0070673_100080829 3300005364 Bacteria 2634
65 Ga0070673_100147861 3300005364 Bacteria 1987
66 Ga0070673_100211650 3300005364 Bacteria 1675
67 Ga0070673_100240260 3300005364 Bacteria 1575
68 Ga0070659_100072449 3300005366 Bacteria 2741
69 Ga0070659_100869860 3300005366 Bacteria 786
70 Ga0070659_100903111 3300005366 Bacteria 772
71 Ga0070667_100015480 3300005367 Bacteria 6307
72 Ga0070667_100115413 3300005367 Bacteria 2332
73 Ga0070667_101406114 3300005367 Bacteria 654
74 Ga0070667_101564555 3300005367 Bacteria 620
75 Ga0070714_100160244 3300005435 Bacteria 2035
76 Ga0070701_10246503 3300005438 Unclassified 1077
77 Ga0070705_100656974 3300005440 Unclassified 818
78 Ga0070700_100114245 3300005441 Bacteria 1800
79 Ga0070700_100730774 3300005441 Bacteria 790
80 Ga0070663_100084285 3300005455 Bacteria 2342
81 Ga0070663_100116503 3300005455 Bacteria 2014
82 Ga0070663_100159814 3300005455 Unclassified 1734
83 Ga0070663_100969231 3300005455 Unclassified 738
84 Ga0070678_100027913 3300005456 Bacteria 3840
85 Ga0070678_100039946 3300005456 Bacteria 3316
86 Ga0070678_100045900 3300005456 Bacteria 3129
87 Ga0070678_100082689 3300005456 Bacteria 2438
88 Ga0070678_100117441 3300005456 Bacteria 2092
89 Ga0070678_100162789 3300005456 Unclassified 1809
90 Ga0070678_100336630 3300005456 Bacteria 1293
91 Ga0070662_100001774 3300005457 Bacteria 13279
92 Ga0070662_100207769 3300005457 Bacteria 1556
93 Ga0070662_100557306 3300005457 Bacteria 961
94 Ga0070681_10083564 3300005458 Bacteria 3146
95 Ga0070681_10282097 3300005458 Bacteria 1572
96 Ga0070681_10611755 3300005458 Bacteria 1004
97 Ga0068867_100046068 3300005459 Bacteria 3201
98 Ga0068867_100070621 3300005459 Bacteria 2611
99 Ga0068867_100139210 3300005459 Bacteria 1895
100 Ga0068867_100170866 3300005459 Bacteria 1721
101 Ga0068867_100237790 3300005459 Bacteria 1475
102 Ga0068867_101805498 3300005459 Unclassified 575
103 Ga0070685_10555892 3300005466 Bacteria 820
104 Ga0070685_11172801 3300005466 Bacteria 583
105 Ga0070706_100001321 3300005467 Bacteria 26375
106 Ga0070679_100007300 3300005530 Bacteria 10322
107 Ga0070679_100049516 3300005530 Bacteria 4184
108 Ga0070679_100108721 3300005530 Bacteria 2759
109 Ga0070679_100119331 3300005530 Bacteria 2622
110 Ga0070679_100377045 3300005530 Unclassified 1365
111 Ga0070684_100429118 3300005535 Bacteria 1220
112 Ga0068853_100066614 3300005539 Bacteria 3128
113 Ga0068853_100240639 3300005539 Bacteria 1658
114 Ga0068853_100403968 3300005539 Bacteria 1279
115 Ga0068853_100417023 3300005539 Bacteria 1258
116 Ga0070672_100031678 3300005543 Bacteria 3983
117 Ga0070672_100032759 3300005543 Bacteria 3926
118 Ga0070672_100049417 3300005543 Bacteria 3272
119 Ga0070672_100117027 3300005543 Bacteria 2178
120 Ga0070672_100502894 3300005543 Bacteria 1048
121 Ga0070672_100761020 3300005543 Bacteria 850
122 Ga0070672_101177146 3300005543 Bacteria 682
123 Ga0070695_100057250 3300005545 Bacteria 2518
124 Ga0070693_100633731 3300005547 Bacteria 775
125 Ga0070665_100181093 3300005548 Unclassified 2108
126 Ga0070665_100670861 3300005548 Bacteria 1050
127 Ga0070665_100717355 3300005548 Bacteria 1013
128 Ga0070704_100076360 3300005549 Bacteria 2450
129 Ga0068855_100094822 3300005563 Bacteria 3440
130 Ga0068855_100286825 3300005563 Bacteria 1826
131 Ga0068855_100840090 3300005563 Bacteria 974
132 Ga0070664_100229538 3300005564 Bacteria 1663
133 Ga0070664_100503551 3300005564 Bacteria 1116
134 Ga0070664_100851069 3300005564 Bacteria 854
135 Ga0070664_101596094 3300005564 Unclassified 618
136 Ga0068857_100721813 3300005577 Bacteria 948
137 Ga0068857_100992733 3300005577 Bacteria 808
138 Ga0068857_101311638 3300005577 Unclassified 703
139 Ga0068854_100122069 3300005578 Bacteria 1979
140 Ga0068854_100164439 3300005578 Bacteria 1721
141 Ga0068854_100229682 3300005578 Unclassified 1472
142 Ga0068854_100571364 3300005578 Unclassified 962
143 Ga0068854_100898121 3300005578 Bacteria 778
144 Ga0068856_101013700 3300005614 Unclassified 848
145 Ga0070702_100372520 3300005615 Bacteria 1013
146 Ga0070702_100475900 3300005615 Unclassified 912
147 Ga0070702_100853915 3300005615 Bacteria 709
148 Ga0068852_100038496 3300005616 Bacteria 4020
149 Ga0068852_100040894 3300005616 Bacteria 3915
150 Ga0068852_100044597 3300005616 Bacteria 3767
151 Ga0068852_100064487 3300005616 Bacteria 3193
152 Ga0068852_100179260 3300005616 Bacteria 1991
153 Ga0068852_100209509 3300005616 Bacteria 1848
154 Ga0068852_100280507 3300005616 Bacteria 1606
155 Ga0068859_100081504 3300005617 Bacteria 3278
156 Ga0068859_100201403 3300005617 Bacteria 2075
157 Ga0068859_100399142 3300005617 Bacteria 1471
158 Ga0068859_100789602 3300005617 Bacteria 1037
159 Ga0068864_100152733 3300005618 Bacteria 2093
160 Ga0068864_100456448 3300005618 Bacteria 1223
161 Ga0068866_10017752 3300005718 Bacteria 3205
162 Ga0068866_10335247 3300005718 Bacteria 956
163 Ga0068861_100000591 3300005719 Bacteria 21480
164 Ga0068861_100000937 3300005719 Bacteria 17730
165 Ga0068861_100024517 3300005719 Bacteria 4363
166 Ga0068861_100094695 3300005719 Bacteria 2363
167 Ga0068861_100103922 3300005719 Bacteria 2265
168 Ga0068861_100570822 3300005719 Bacteria 1034
169 Ga0068851_10203956 3300005834 Bacteria 1105
170 Ga0068851_10230706 3300005834 Bacteria 1043
171 Ga0068870_10685222 3300005840 Bacteria 706
172 Ga0068863_100009060 3300005841 Bacteria 9717
173 Ga0068863_100095859 3300005841 Bacteria 2816
174 Ga0068863_100107921 3300005841 Bacteria 2649
175 Ga0068863_100169318 3300005841 Bacteria 2095
176 Ga0068863_101487693 3300005841 Bacteria 686
177 Ga0068863_102357198 3300005841 Bacteria 542
178 Ga0068858_100011904 3300005842 Bacteria 8199
179 Ga0068858_100013394 3300005842 Bacteria 7740
180 Ga0068858_100017876 3300005842 Bacteria 6640
181 Ga0068858_100103413 3300005842 Bacteria 2657
182 Ga0068858_100276439 3300005842 Bacteria 1599
183 Ga0068858_100473059 3300005842 Bacteria 1209
184 Ga0068860_100002318 3300005843 Bacteria 20001
185 Ga0068860_100005410 3300005843 Bacteria 12957
186 Ga0068860_100079579 3300005843 Bacteria 3116
187 Ga0068860_100120259 3300005843 Bacteria 2514
188 Ga0068860_101571768 3300005843 Bacteria 679
189 Ga0068862_100003340 3300005844 Bacteria 13852
190 Ga0068862_100176384 3300005844 Bacteria 1916
191 Ga0068862_101277805 3300005844 Bacteria 734
192 Ga0097621_100013671 3300006237 Bacteria 6060
193 Ga0097621_100014225 3300006237 Bacteria 5951
194 Ga0097621_100043719 3300006237 Bacteria 3612
195 Ga0097621_100195219 3300006237 Bacteria 1755
196 Ga0097621_100337523 3300006237 Bacteria 1338
197 Ga0097621_100856155 3300006237 Bacteria 845
198 Ga0097621_100953642 3300006237 Bacteria 801
199 Ga0068871_101008390 3300006358 Bacteria 775
200 Ga0075434_100263211 3300006871 Unclassified 1744
201 Ga0068865_100000824 3300006881 Bacteria 17479
202 Ga0068865_100003127 3300006881 Bacteria 9904
203 Ga0068865_100426108 3300006881 Bacteria 1092
204 Ga0068865_100588159 3300006881 Bacteria 939
205 Ga0097620_100081508 3300006931 Bacteria 3278
206 Ga0097620_100201397 3300006931 Bacteria 2075
207 Ga0097620_100399184 3300006931 Bacteria 1471
208 Ga0097620_100789577 3300006931 Bacteria 1037
209 Ga0105244_10356443 3300009036 Bacteria 674
210 Ga0105240_10031201 3300009093 Bacteria 6915
211 Ga0105240_10334801 3300009093 Bacteria 1721
212 Ga0111539_11023760 3300009094 Unclassified 960
213 Ga0111539_11222174 3300009094 Bacteria 873
214 Ga0105245_10266527 3300009098 Bacteria 1669
215 Ga0105245_10828959 3300009098 Bacteria 964
216 Ga0114129_10046086 3300009147 Bacteria 6129
217 Ga0105243_10034857 3300009148 Bacteria 3900
218 Ga0105243_10423029 3300009148 Bacteria 1243
219 Ga0105241_10178942 3300009174 Bacteria 1757
220 Ga0105241_10264011 3300009174 Bacteria 1464
221 Ga0105242_10318680 3300009176 Bacteria 1425
222 Ga0105242_10376378 3300009176 Bacteria 1319
223 Ga0105242_11222117 3300009176 Bacteria 772
224 Ga0105248_10029299 3300009177 Bacteria 6141
225 Ga0105248_10064628 3300009177 Bacteria 4108
226 Ga0105248_10130417 3300009177 Bacteria 2836
227 Ga0105248_10252885 3300009177 Bacteria 1983
228 Ga0105248_10736298 3300009177 Unclassified 1112
229 Ga0105248_11449952 3300009177 Bacteria 777
230 Ga0105237_10170442 3300009545 Bacteria 2176
231 Ga0105238_10110544 3300009551 Bacteria 2729
232 Ga0105238_10258946 3300009551 Bacteria 1719
233 Ga0105249_10010970 3300009553 Bacteria 7962
234 Ga0105249_10017612 3300009553 Bacteria 6343
235 Ga0105249_11273901 3300009553 Bacteria 807
236 Ga0105249_12646331 3300009553 Bacteria 574
237 Ga0105246_10598325 3300011119 Bacteria 952
238 Ga0157371_10127119 3300013102 Bacteria 1813
239 Ga0157371_10128566 3300013102 Bacteria 1802
240 Ga0157371_10590414 3300013102 Unclassified 826
241 Ga0157371_11080295 3300013102 Unclassified 615
242 Ga0157370_10042767 3300013104 Bacteria 4364
243 Ga0157369_10238473 3300013105 Bacteria 1900
244 Ga0157369_11385958 3300013105 Bacteria 716
245 Ga0157369_12552032 3300013105 Unclassified 517
246 Ga0157374_10041458 3300013296 Bacteria 4243
247 Ga0157374_10082837 3300013296 Bacteria 3046
248 Ga0157374_10124467 3300013296 Bacteria 2491
249 Ga0157374_10183751 3300013296 Bacteria 2044
250 Ga0157374_10822516 3300013296 Bacteria 945
251 Ga0157378_10029728 3300013297 Bacteria 4824
252 Ga0157378_10745995 3300013297 Bacteria 1001
253 Ga0157378_11438883 3300013297 Unclassified 733
254 Ga0163162_10002191 3300013306 Bacteria 18337
255 Ga0163162_10004820 3300013306 Bacteria 13020
256 Ga0163162_10033512 3300013306 Bacteria 5105
257 Ga0163162_10215298 3300013306 Bacteria 2051
258 Ga0163162_10507954 3300013306 Bacteria 1335
259 Ga0163162_10563859 3300013306 Bacteria 1266
260 Ga0163162_11384011 3300013306 Bacteria 800
261 Ga0163162_12761403 3300013306 Unclassified 565
262 Ga0157372_10038036 3300013307 Bacteria 5310
263 Ga0157372_10107526 3300013307 Bacteria 3192
264 Ga0157372_10154966 3300013307 Bacteria 2646
265 Ga0157375_10003928 3300013308 Bacteria 12895
266 Ga0157375_10023737 3300013308 Bacteria 5665
267 Ga0157375_10089780 3300013308 Bacteria 3130
268 Ga0157375_10483719 3300013308 Bacteria 1403
269 Ga0157375_10747799 3300013308 Bacteria 1129
270 Ga0157375_11997979 3300013308 Bacteria 689
271 Ga0163163_10330400 3300014325 Bacteria 1579
272 Ga0163163_10353927 3300014325 Bacteria 1525
273 Ga0163163_11700390 3300014325 Bacteria 692
274 Ga0157380_10003603 3300014326 Bacteria 10652
275 Ga0157380_10005792 3300014326 Bacteria 8650
276 Ga0157380_10090760 3300014326 Bacteria 2521
277 Ga0157380_10671162 3300014326 Bacteria 1037
278 Ga0157377_10139846 3300014745 Bacteria 1487
279 Ga0157379_10066719 3300014968 Bacteria 3217
280 Ga0157379_10069064 3300014968 Bacteria 3159
281 Ga0157379_10112368 3300014968 Bacteria 2448
282 Ga0157379_10301163 3300014968 Bacteria 1461
283 Ga0157379_10323424 3300014968 Bacteria 1408
284 Ga0157379_10469557 3300014968 Bacteria 1163
285 Ga0157379_10990165 3300014968 Bacteria 801
286 Ga0157376_10032810 3300014969 Bacteria 4173
287 Ga0157376_10180793 3300014969 Bacteria 1928
288 Ga0157376_10697829 3300014969 Bacteria 1020
289 Ga0163161_10020215 3300017792 Bacteria 4671
290 Ga0163161_10045448 3300017792 Bacteria 3167
291 Ga0163161_10064595 3300017792 Bacteria 2670
292 Ga0163161_10127486 3300017792 Bacteria 1917
293 Ga0163161_10153503 3300017792 Bacteria 1751
294 Ga0207697_10013101 3300025315 Bacteria 3463
295 Ga0207697_10052585 3300025315 Bacteria 1686
296 Ga0207697_10102923 3300025315 Bacteria 1218
297 Ga0207656_10282327 3300025321 Bacteria 819
298 Ga0207682_10008565 3300025893 Bacteria 4044
299 Ga0207682_10009175 3300025893 Bacteria 3908
300 Ga0207682_10270044 3300025893 Unclassified 794
301 Ga0207688_10312146 3300025901 Bacteria 963
302 Ga0207688_10540205 3300025901 Bacteria 732
303 Ga0207680_10059331 3300025903 Bacteria 2323
304 Ga0207680_10309238 3300025903 Unclassified 1103
305 Ga0207680_10910659 3300025903 Archaea 630
306 Ga0207645_10019005 3300025907 Bacteria 4512
307 Ga0207645_10020526 3300025907 Bacteria 4323
308 Ga0207645_10065512 3300025907 Bacteria 2322
309 Ga0207645_10109156 3300025907 Unclassified 1790
310 Ga0207643_10185810 3300025908 Bacteria 1260
311 Ga0207705_10548271 3300025909 Bacteria 899
312 Ga0207705_10713916 3300025909 Bacteria 779
313 Ga0207654_10464530 3300025911 Bacteria 889
314 Ga0207707_10106425 3300025912 Bacteria 2452
315 Ga0207695_10137504 3300025913 Bacteria 2395
316 Ga0207671_10844212 3300025914 Bacteria 725
317 Ga0207660_10032716 3300025917 Bacteria 3591
318 Ga0207660_11007120 3300025917 Bacteria 679
319 Ga0207662_10016078 3300025918 Bacteria 4217
320 Ga0207662_10036980 3300025918 Bacteria 2856
321 Ga0207657_10024087 3300025919 Bacteria 5651
322 Ga0207657_10040102 3300025919 Bacteria 4153
323 Ga0207649_10095142 3300025920 Bacteria 1959
324 Ga0207649_10187045 3300025920 Bacteria 1454
325 Ga0207649_10947015 3300025920 Bacteria 676
326 Ga0207652_10068899 3300025921 Bacteria 3070
327 Ga0207652_10328847 3300025921 Unclassified 1380
328 Ga0207652_10334998 3300025921 Bacteria 1366
329 Ga0207652_10529430 3300025921 Bacteria 1060
330 Ga0207652_10588933 3300025921 Bacteria 998
331 Ga0207681_10000507 3300025923 Bacteria 27091
332 Ga0207681_11102992 3300025923 Bacteria 666
333 Ga0207694_10621171 3300025924 Bacteria 909
334 Ga0207650_10057805 3300025925 Bacteria 2886
335 Ga0207650_10132824 3300025925 Bacteria 1950
336 Ga0207650_10264447 3300025925 Unclassified 1396
337 Ga0207659_10008077 3300025926 Bacteria 6515
338 Ga0207659_10013390 3300025926 Bacteria 5250
339 Ga0207659_10037985 3300025926 Bacteria 3347
340 Ga0207659_10055005 3300025926 Bacteria 2844
341 Ga0207659_10466415 3300025926 Bacteria 1065
342 Ga0207687_10027748 3300025927 Bacteria 3800
343 Ga0207644_10000462 3300025931 Bacteria 26318
344 Ga0207644_10196489 3300025931 Bacteria 1589
345 Ga0207690_10021793 3300025932 Bacteria 3978
346 Ga0207690_10221745 3300025932 Bacteria 1447
347 Ga0207690_10942928 3300025932 Bacteria 717
348 Ga0207706_10025673 3300025933 Bacteria 5278
349 Ga0207706_10065497 3300025933 Bacteria 3199
350 Ga0207706_10073410 3300025933 Unclassified 3008
351 Ga0207706_10112458 3300025933 Bacteria 2396
352 Ga0207686_10121165 3300025934 Bacteria 1781
353 Ga0207709_10004564 3300025935 Bacteria 7974
354 Ga0207709_10205169 3300025935 Bacteria 1411
355 Ga0207669_10007739 3300025937 Bacteria 4998
356 Ga0207669_10220310 3300025937 Bacteria 1392
357 Ga0207669_10222393 3300025937 Bacteria 1386
358 Ga0207669_10618285 3300025937 Bacteria 882
359 Ga0207669_10676335 3300025937 Bacteria 846
360 Ga0207704_10024750 3300025938 Bacteria 3262
361 Ga0207704_10031886 3300025938 Bacteria 2975
362 Ga0207704_10393483 3300025938 Bacteria 1091
363 Ga0207704_10686719 3300025938 Bacteria 846
364 Ga0207691_10003503 3300025940 Bacteria 15273
365 Ga0207691_10008918 3300025940 Bacteria 9629
366 Ga0207691_10041105 3300025940 Bacteria 4271
367 Ga0207691_10050718 3300025940 Bacteria 3797
368 Ga0207691_10089880 3300025940 Bacteria 2753
369 Ga0207691_10090811 3300025940 Bacteria 2737
370 Ga0207691_10149488 3300025940 Bacteria 2054
371 Ga0207691_10453618 3300025940 Bacteria 1091
372 Ga0207711_10014240 3300025941 Bacteria 6606
373 Ga0207711_10025126 3300025941 Bacteria 4998
374 Ga0207711_10078412 3300025941 Bacteria 2882
375 Ga0207711_10140763 3300025941 Bacteria 2170
376 Ga0207689_10001974 3300025942 Bacteria 19384
377 Ga0207689_10012115 3300025942 Bacteria 7381
378 Ga0207689_10227203 3300025942 Bacteria 1543
379 Ga0207689_10369147 3300025942 Bacteria 1194
380 Ga0207661_10462926 3300025944 Bacteria 1156
381 Ga0207679_10053493 3300025945 Bacteria 2967
382 Ga0207679_10146286 3300025945 Bacteria 1917
383 Ga0207667_10189504 3300025949 Bacteria 2110
384 Ga0207667_10232189 3300025949 Bacteria 1889
385 Ga0207651_10015846 3300025960 Bacteria 4395
386 Ga0207651_10061226 3300025960 Bacteria 2617
387 Ga0207651_10109835 3300025960 Bacteria 2067
388 Ga0207651_10204605 3300025960 Bacteria 1584
389 Ga0207651_10273509 3300025960 Bacteria 1392
390 Ga0207651_10299241 3300025960 Bacteria 1337
391 Ga0207712_10003891 3300025961 Bacteria 9438
392 Ga0207712_10203120 3300025961 Bacteria 1573
393 Ga0207712_10485339 3300025961 Bacteria 1054
394 Ga0207712_11350784 3300025961 Bacteria 637
395 Ga0207712_11524822 3300025961 Bacteria 599
396 Ga0207668_10108075 3300025972 Bacteria 2081
397 Ga0207668_10328905 3300025972 Bacteria 1271
398 Ga0207668_10671221 3300025972 Unclassified 909
399 Ga0207640_10143216 3300025981 Bacteria 1745
400 Ga0207640_10179661 3300025981 Bacteria 1585
401 Ga0207640_10225572 3300025981 Unclassified 1437
402 Ga0207640_10329565 3300025981 Unclassified 1219
403 Ga0207640_10839661 3300025981 Unclassified 798
404 Ga0207658_10001563 3300025986 Bacteria 17747
405 Ga0207658_10053341 3300025986 Bacteria 2987
406 Ga0207677_10320341 3300026023 Bacteria 1288
407 Ga0207677_10326333 3300026023 Bacteria 1277
408 Ga0207677_10621450 3300026023 Bacteria 950
409 Ga0207677_10695148 3300026023 Bacteria 902
410 Ga0207703_10002328 3300026035 Bacteria 16574
411 Ga0207703_10050301 3300026035 Bacteria 3372
412 Ga0207703_10308913 3300026035 Bacteria 1445
413 Ga0207703_11317301 3300026035 Bacteria 695
414 Ga0207639_10174172 3300026041 Bacteria 1825
415 Ga0207639_10308666 3300026041 Bacteria 1401
416 Ga0207678_10270051 3300026067 Bacteria 1458
417 Ga0207678_10270122 3300026067 Unclassified 1458
418 Ga0207678_10471658 3300026067 Bacteria 1092
419 Ga0207678_10576945 3300026067 Bacteria 985
420 Ga0207708_10043949 3300026075 Bacteria 3404
421 Ga0207708_10081963 3300026075 Bacteria 2480
422 Ga0207708_12030928 3300026075 Bacteria 503
423 Ga0207702_11460559 3300026078 Unclassified 677
424 Ga0207702_11708928 3300026078 Bacteria 622
425 Ga0207641_10004027 3300026088 Bacteria 12826
426 Ga0207641_10012670 3300026088 Bacteria 6914
427 Ga0207641_10060063 3300026088 Bacteria 3239
428 Ga0207641_10190778 3300026088 Bacteria 1883
429 Ga0207641_10577983 3300026088 Bacteria 1098
430 Ga0207641_11030009 3300026088 Bacteria 820
431 Ga0207648_10000319 3300026089 Bacteria 52621
432 Ga0207648_10008528 3300026089 Bacteria 9919
433 Ga0207648_10023359 3300026089 Bacteria 5541
434 Ga0207648_10062150 3300026089 Bacteria 3256
435 Ga0207648_10177414 3300026089 Bacteria 1884
436 Ga0207648_10181059 3300026089 Bacteria 1865
437 Ga0207648_11899537 3300026089 Unclassified 557
438 Ga0207676_10053702 3300026095 Bacteria 3154
439 Ga0207676_10173458 3300026095 Bacteria 1881
440 Ga0207676_10178442 3300026095 Bacteria 1857
441 Ga0207676_10389406 3300026095 Bacteria 1299
442 Ga0207676_10569841 3300026095 Bacteria 1084
443 Ga0207674_10080417 3300026116 Bacteria 3262
444 Ga0207674_10213840 3300026116 Bacteria 1877
445 Ga0207675_100000483 3300026118 Bacteria 38723
446 Ga0207675_100001938 3300026118 Bacteria 20656
447 Ga0207675_100004711 3300026118 Bacteria 13130
448 Ga0207675_100005279 3300026118 Bacteria 12426
449 Ga0207675_100494355 3300026118 Bacteria 1217
450 Ga0207675_101305191 3300026118 Bacteria 746
451 Ga0207683_10033956 3300026121 Bacteria 4432
452 Ga0207683_10081702 3300026121 Bacteria 2869
453 Ga0207683_10093144 3300026121 Bacteria 2685
454 Ga0207683_10093778 3300026121 Bacteria 2675
455 Ga0207683_10147069 3300026121 Bacteria 2125
456 Ga0207683_10173705 3300026121 Bacteria 1952
457 Ga0207698_10018538 3300026142 Bacteria 4745
458 Ga0207698_10053910 3300026142 Bacteria 3091
459 Ga0207698_10175852 3300026142 Bacteria 1890
460 Ga0207698_10425518 3300026142 Unclassified 1275
461 Ga0207698_10799453 3300026142 Bacteria 945
462 Ga0209281_1000103 3300027111 Bacteria 221425
463 Ga0268266_10166453 3300028379 Unclassified 1998
464 Ga0268266_10288088 3300028379 Bacteria 1529
465 Ga0268265_10002776 3300028380 Bacteria 12916
466 Ga0268265_10140469 3300028380 Bacteria 2021
467 Ga0268264_10000629 3300028381 Bacteria 41961
468 Ga0268264_10009506 3300028381 Bacteria 8053
469 Ga0268264_10537009 3300028381 Bacteria 1145
470 Ga0307517_10511161 3300028786 Bacteria 609
471 Ga0307515_10017525 3300028794 Bacteria 13037
472 Ga0307513_10232518 3300031456 Bacteria 1655
473 Ga0307509_10296988 3300031507 Unclassified 1366
474 Ga0307509_10304296 3300031507 Bacteria 1340
475 Ga0307508_10000028 3300031616 Bacteria 168639
476 Ga0307508_10256473 3300031616 Bacteria 1344
477 Ga0316579_10019234 3300031691 Unclassified 3015
478 Ga0316578_10008717 3300031728 Bacteria 5177
479 Ga0307516_10453660 3300031730 Bacteria 938
480 Ga0307516_10824426 3300031730 Bacteria 590
481 Ga0307412_10366990 3300031911 Bacteria 1161
482 Ga0307411_10135664 3300032005 Bacteria 1806
483 Ga0307507_10103698 3300033179 Bacteria 2365
484 Ga0307510_10061923 3300033180 Bacteria 3829
485 Ga0316592_1027594 3300033524 Unclassified 1228
486 Ga0316596_1039471 3300033541 Bacteria 1238
487 Ga0373928_0055252 3300035084 Bacteria 947
488 Ga0373944_0029104 3300035089 Bacteria 1650
489 Ga0373939_0317469 3300035114 Bacteria 625
490 Ga0373941_0268366 3300035115 Bacteria 671
491 Ga0373960_0145688 3300035121 Bacteria 805
492 Ga0373943_0033822 3300035170 Bacteria 2437
493 Ga0373946_0234074 3300035171 Unclassified 891
494 Ga0373942_0104674 3300035207 Bacteria 868
495 Ga0316574_0537777 3300035398 Unclassified 726
496 Ga0373931_0459527 3300035691 Bacteria 815
497 Ga0373931_0851945 3300035691 Bacteria 610
498 Ga0373933_0250903 3300035724 Bacteria 1140
499 Ga0373947_0310668 3300035725 Bacteria 1053
500 Ga0316584_0690544 3300036712 Bacteria 700
501 Ga0316584_0762441 3300036712 Unclassified 659
502 Ga0373925_0101440 3300037068 Bacteria 2213
503 Ga0373925_0260474 3300037068 Bacteria 1393
504 Ga0395900_0819180 3300037418 Unclassified 858
505 Ga0395905_0061795 3300037471 Bacteria 3504
506 Ga0395905_1340162 3300037471 Bacteria 620
507 Ga0395901_0200832 3300038443 Bacteria 2090
508 Ga0395901_0905009 3300038443 Bacteria 864
509 Ga0451800_0158904 3300041459 Bacteria 869
510 Ga0451839_1132686 3300041496 Unclassified 619
511 Ga0451851_1081764 3300041507 Bacteria 761
512 Ga0451853_2577876 3300041512 Bacteria 513
513 Ga0439449_0002141 3300042007 Bacteria 7749
514 Ga0439462_0001869 3300042015 Bacteria 4782
515 Ga0450903_051236 3300042138 Bacteria 604
516 Ga0439464_0002040 3300042439 Bacteria 4909
517 Ga0466965_0252746 3300044683 Bacteria 946
518 Ga0453684_0622577 3300044712 Bacteria 1181
519 Ga0453684_0752393 3300044712 Bacteria 1055
520 Ga0453684_2533945 3300044712 Unclassified 505
521 Ga0466959_0200907 3300045049 Bacteria 1388
522 Ga0495603_0119115 3300046455 Bacteria 1539
523 Ga0495638_0000752 3300046460 Bacteria 34566
524 Ga0495638_0333634 3300046460 Bacteria 806
525 Ga0495638_0448075 3300046460 Bacteria 660
526 Ga0495580_0197073 3300046472 Bacteria 1388
527 Ga0495605_0059938 3300046474 Bacteria 1826
528 Ga0495596_0383215 3300046500 Bacteria 548
529 Ga0495620_0264753 3300046515 Unclassified 655
530 Ga0495632_0227837 3300046519 Bacteria 841
531 Ga0495643_0132379 3300046522 Bacteria 1251
532 Ga0495666_0098426 3300046526 Unclassified 1379
533 Ga0495642_0294166 3300046528 Unclassified 711
534 Ga0495625_0023983 3300046660 Unclassified 4652
535 Ga0495635_0025152 3300046663 Bacteria 4148
536 Ga0495658_0032685 3300046683 Bacteria 2843
537 Ga0495669_0049465 3300046684 Bacteria 1882
538 Ga0495649_0047006 3300046694 Bacteria 2348
539 Ga0495589_0028159 3300046794 Bacteria 2837
540 Ga0495683_0046481 3300047323 Bacteria 2178
541 Ga0495684_0051415 3300047471 Bacteria 3145
542 Ga0496100_0774847 3300048903 Unclassified 751
543 Ga0496101_0565936 3300048904 Bacteria 899
544 Ga0496101_0627536 3300048904 Bacteria 849
545 Ga0496101_1384080 3300048904 Unclassified 549
546 Ga0496102_0015391 3300048905 Bacteria 6662
547 Ga0496102_0046614 3300048905 Bacteria 3937
548 Ga0496104_0520875 3300048907 Bacteria 1100
549 Ga0496104_0573911 3300048907 Bacteria 1038
550 Ga0496104_0831072 3300048907 Bacteria 829
551 Ga0496104_1710176 3300048907 Bacteria 531
552 Ga0496105_0019171 3300048908 Bacteria 5515
553 Ga0496106_0029512 3300048909 Bacteria 4087
554 Ga0496106_0081220 3300048909 Bacteria 2490
555 Ga0496107_0035814 3300048910 Bacteria 3559
556 Ga0496108_1662074 3300048911 Bacteria 527
557 Ga0496109_0361036 3300048912 Bacteria 1372
558 Ga0496110_0126417 3300048913 Bacteria 2307
559 Ga0496110_0677045 3300048913 Unclassified 932
560 Ga0496111_0368589 3300048914 Bacteria 1063
561 Ga0496112_0038779 3300048915 Bacteria 4654
562 Ga0496113_0354442 3300048916 Bacteria 1177
563 Ga0496113_0370130 3300048916 Unclassified 1150
564 Ga0496114_0047188 3300048917 Bacteria 3582
565 Ga0496114_0049718 3300048917 Bacteria 3489
566 Ga0496114_0193456 3300048917 Bacteria 1780
567 Ga0496114_0769727 3300048917 Bacteria 840
568 Ga0501034_0014133 3300049571 Bacteria 8227
569 Ga0501043_0000112 3300049579 Bacteria 76249
570 Ga0501046_0000146 3300049580 Bacteria 74204
571 Ga0501047_0000192 3300049581 Bacteria 74300
572 Ga0501048_0000874 3300049582 Bacteria 22228
573 Ga0501067_0023254 3300049583 Bacteria 3434
574 Ga0501068_0305666 3300049584 Bacteria 1018
575 Ga0501069_0940407 3300049585 Bacteria 527
576 Ga0501070_0002912 3300049586 Bacteria 14892
577 Ga0501070_0999634 3300049586 Bacteria 649
578 Ga0501072_0035179 3300049588 Bacteria 3926
579 Ga0501073_0005162 3300049589 Bacteria 9797
580 Ga0501074_0154733 3300049590 Bacteria 1638
581 Ga0501079_1537212 3300049741 Bacteria 523
582 Ga0501080_0237015 3300049742 Bacteria 1666
583 Ga0501083_0163418 3300049744 Bacteria 1456
584 Ga0501264_014901 3300049761 Unclassified 780
585 Ga0501280_000245 3300049776 Bacteria 13596
586 Ga0501035_1016803 3300049822 Bacteria 651
587 Ga0501045_0033230 3300049824 Bacteria 3740
588 nmdc:mga0k408_7246_c1 3300050493 Bacteria 5928
589 nmdc:mga05p37_1912223_c1 3300050507 Unclassified 566
590 nmdc:mga08y16_1090279_c1 3300050511 Bacteria 774
591 nmdc:mga08y16_669391_c1 3300050511 Bacteria 1040
592 nmdc:mga0n895_205852_c1 3300050512 Bacteria 1998
593 nmdc:mga0a205_506892_c1 3300050515 Bacteria 1063
594 Ga0500590_005144 3300053148 Bacteria 6274
595 Ga0500619_072884 3300053154 Bacteria 1145
596 Ga0501084_1564184 3300054114 Bacteria 551
597 Ga0501082_0154760 3300060353 Bacteria 1992
598 Ga0501282_004369
599 MBSR1b_contig_5816244
600 rootL2_10044705
601 Ga0065715_10084327
602 Ga0070658_10096885
603 Ga0070658_10150737
604 Ga0070658_10159991
605 Ga0070676_10003182
606 Ga0070676_10039058
607 Ga0070676_10075206
608 Ga0070676_10889810
609 Ga0070683_100864872
610 Ga0070683_102167060
611 Ga0070690_100001778
612 Ga0070690_100371727
613 Ga0070670_100065541
614 Ga0070670_100147044
615 Ga0070670_100250651
616 Ga0070670_100795879
617 Ga0070677_10030699
618 Ga0070677_10069013
619 Ga0070677_10453890
620 Ga0070677_10668484
621 Ga0068869_100000718
622 Ga0068869_100007560
623 Ga0068869_100257694
624 Ga0068869_100872280
625 Ga0070666_10049572
626 Ga0070666_10255360
627 Ga0070666_10929426
628 Ga0070680_100011800
629 Ga0068868_100099259
630 Ga0068868_100538589
631 Ga0068868_100702629
632 Ga0068868_101291258
633 Ga0070660_100162290
634 Ga0070660_100421153
635 Ga0070660_101429958
636 Ga0070689_101613965
637 Ga0070687_100127316
638 Ga0070687_100580536
639 Ga0070661_100293791
640 Ga0070661_100510123
641 Ga0070668_100008010
642 Ga0070668_100015262
643 Ga0070669_100001820
644 Ga0070669_100046828
645 Ga0070669_100517504
646 Ga0070669_100597020
647 Ga0070675_100004647
648 Ga0070675_100042054
649 Ga0070675_100144168
650 Ga0070675_100682799
651 Ga0070675_101012871
652 Ga0070671_100012493
653 Ga0070671_100108381
654 Ga0070671_101460893
655 Ga0070674_100037699
656 Ga0070674_100040651
657 Ga0070674_100128890
658 Ga0070674_100505812
659 Ga0070674_100655860
660 Ga0070673_100071066
661 Ga0070673_100080829
662 Ga0070673_100147861
663 Ga0070673_100211650
664 Ga0070673_100240260
665 Ga0070659_100072449
666 Ga0070659_100869860
667 Ga0070659_100903111
668 Ga0070667_100015480
669 Ga0070667_100115413
670 Ga0070667_101406114
671 Ga0070667_101564555
672 Ga0070714_100160244
673 Ga0070701_10246503
674 Ga0070705_100656974
675 Ga0070700_100114245
676 Ga0070700_100730774
677 Ga0070663_100084285
678 Ga0070663_100116503
679 Ga0070663_100159814
680 Ga0070663_100969231
681 Ga0070678_100027913
682 Ga0070678_100039946
683 Ga0070678_100045900
684 Ga0070678_100082689
685 Ga0070678_100117441
686 Ga0070678_100162789
687 Ga0070678_100336630
688 Ga0070662_100001774
689 Ga0070662_100207769
690 Ga0070662_100557306
691 Ga0070681_10083564
692 Ga0070681_10282097
693 Ga0070681_10611755
694 Ga0068867_100046068
695 Ga0068867_100070621
696 Ga0068867_100139210
697 Ga0068867_100170866
698 Ga0068867_100237790
699 Ga0068867_101805498
700 Ga0070685_10555892
701 Ga0070685_11172801
702 Ga0070706_100001321
703 Ga0070679_100007300
704 Ga0070679_100049516
705 Ga0070679_100108721
706 Ga0070679_100119331
707 Ga0070679_100377045
708 Ga0070684_100429118
709 Ga0068853_100066614
710 Ga0068853_100240639
711 Ga0068853_100403968
712 Ga0068853_100417023
713 Ga0070672_100031678
714 Ga0070672_100032759
715 Ga0070672_100049417
716 Ga0070672_100117027
717 Ga0070672_100502894
718 Ga0070672_100761020
719 Ga0070672_101177146
720 Ga0070695_100057250
721 Ga0070693_100633731
722 Ga0070665_100181093
723 Ga0070665_100670861
724 Ga0070665_100717355
725 Ga0070704_100076360
726 Ga0068855_100094822
727 Ga0068855_100286825
728 Ga0068855_100840090
729 Ga0070664_100229538
730 Ga0070664_100503551
731 Ga0070664_100851069
732 Ga0070664_101596094
733 Ga0068857_100721813
734 Ga0068857_100992733
735 Ga0068857_101311638
736 Ga0068854_100122069
737 Ga0068854_100164439
738 Ga0068854_100229682
739 Ga0068854_100571364
740 Ga0068854_100898121
741 Ga0068856_101013700
742 Ga0070702_100372520
743 Ga0070702_100475900
744 Ga0070702_100853915
745 Ga0068852_100038496
746 Ga0068852_100040894
747 Ga0068852_100044597
748 Ga0068852_100064487
749 Ga0068852_100179260
750 Ga0068852_100209509
751 Ga0068852_100280507
752 Ga0068859_100081504
753 Ga0068859_100201403
754 Ga0068859_100399142
755 Ga0068859_100789602
756 Ga0068864_100152733
757 Ga0068864_100456448
758 Ga0068866_10017752
759 Ga0068866_10335247
760 Ga0068861_100000591
761 Ga0068861_100000937
762 Ga0068861_100024517
763 Ga0068861_100094695
764 Ga0068861_100103922
765 Ga0068861_100570822
766 Ga0068851_10203956
767 Ga0068851_10230706
768 Ga0068870_10685222
769 Ga0068863_100009060
770 Ga0068863_100095859
771 Ga0068863_100107921
772 Ga0068863_100169318
773 Ga0068863_101487693
774 Ga0068863_102357198
775 Ga0068858_100011904
776 Ga0068858_100013394
777 Ga0068858_100017876
778 Ga0068858_100103413
779 Ga0068858_100276439
780 Ga0068858_100473059
781 Ga0068860_100002318
782 Ga0068860_100005410
783 Ga0068860_100079579
784 Ga0068860_100120259
785 Ga0068860_101571768
786 Ga0068862_100003340
787 Ga0068862_100176384
788 Ga0068862_101277805
789 Ga0097621_100013671
790 Ga0097621_100014225
791 Ga0097621_100043719
792 Ga0097621_100195219
793 Ga0097621_100337523
794 Ga0097621_100856155
795 Ga0097621_100953642
796 Ga0068871_101008390
797 Ga0075434_100263211
798 Ga0068865_100000824
799 Ga0068865_100003127
800 Ga0068865_100426108
801 Ga0068865_100588159
802 Ga0097620_100081508
803 Ga0097620_100201397
804 Ga0097620_100399184
805 Ga0097620_100789577
806 Ga0105244_10356443
807 Ga0105240_10031201
808 Ga0105240_10334801
809 Ga0111539_11023760
810 Ga0111539_11222174
811 Ga0105245_10266527
812 Ga0105245_10828959
813 Ga0114129_10046086
814 Ga0105243_10034857
815 Ga0105243_10423029
816 Ga0105241_10178942
817 Ga0105241_10264011
818 Ga0105242_10318680
819 Ga0105242_10376378
820 Ga0105242_11222117
821 Ga0105248_10029299
822 Ga0105248_10064628
823 Ga0105248_10130417
824 Ga0105248_10252885
825 Ga0105248_10736298
826 Ga0105248_11449952
827 Ga0105237_10170442
828 Ga0105238_10110544
829 Ga0105238_10258946
830 Ga0105249_10010970
831 Ga0105249_10017612
832 Ga0105249_11273901
833 Ga0105249_12646331
834 Ga0105246_10598325
835 Ga0157371_10127119
836 Ga0157371_10128566
837 Ga0157371_10590414
838 Ga0157371_11080295
839 Ga0157370_10042767
840 Ga0157369_10238473
841 Ga0157369_11385958
842 Ga0157369_12552032
843 Ga0157374_10041458
844 Ga0157374_10082837
845 Ga0157374_10124467
846 Ga0157374_10183751
847 Ga0157374_10822516
848 Ga0157378_10029728
849 Ga0157378_10745995
850 Ga0157378_11438883
851 Ga0163162_10002191
852 Ga0163162_10004820
853 Ga0163162_10033512
854 Ga0163162_10215298
855 Ga0163162_10507954
856 Ga0163162_10563859
857 Ga0163162_11384011
858 Ga0163162_12761403
859 Ga0157372_10038036
860 Ga0157372_10107526
861 Ga0157372_10154966
862 Ga0157375_10003928
863 Ga0157375_10023737
864 Ga0157375_10089780
865 Ga0157375_10483719
866 Ga0157375_10747799
867 Ga0157375_11997979
868 Ga0163163_10330400
869 Ga0163163_10353927
870 Ga0163163_11700390
871 Ga0157380_10003603
872 Ga0157380_10005792
873 Ga0157380_10090760
874 Ga0157380_10671162
875 Ga0157377_10139846
876 Ga0157379_10066719
877 Ga0157379_10069064
878 Ga0157379_10112368
879 Ga0157379_10301163
880 Ga0157379_10323424
881 Ga0157379_10469557
882 Ga0157379_10990165
883 Ga0157376_10032810
884 Ga0157376_10180793
885 Ga0157376_10697829
886 Ga0163161_10020215
887 Ga0163161_10045448
888 Ga0163161_10064595
889 Ga0163161_10127486
890 Ga0163161_10153503
891 Ga0207697_10013101
892 Ga0207697_10052585
893 Ga0207697_10102923
894 Ga0207656_10282327
895 Ga0207682_10008565
896 Ga0207682_10009175
897 Ga0207682_10270044
898 Ga0207688_10312146
899 Ga0207688_10540205
900 Ga0207680_10059331
901 Ga0207680_10309238
902 Ga0207680_10910659
903 Ga0207645_10019005
904 Ga0207645_10020526
905 Ga0207645_10065512
906 Ga0207645_10109156
907 Ga0207643_10185810
908 Ga0207705_10548271
909 Ga0207705_10713916
910 Ga0207654_10464530
911 Ga0207707_10106425
912 Ga0207695_10137504
913 Ga0207671_10844212
914 Ga0207660_10032716
915 Ga0207660_11007120
916 Ga0207662_10016078
917 Ga0207662_10036980
918 Ga0207657_10024087
919 Ga0207657_10040102
920 Ga0207649_10095142
921 Ga0207649_10187045
922 Ga0207649_10947015
923 Ga0207652_10068899
924 Ga0207652_10328847
925 Ga0207652_10334998
926 Ga0207652_10529430
927 Ga0207652_10588933
928 Ga0207681_10000507
929 Ga0207681_11102992
930 Ga0207694_10621171
931 Ga0207650_10057805
932 Ga0207650_10132824
933 Ga0207650_10264447
934 Ga0207659_10008077
935 Ga0207659_10013390
936 Ga0207659_10037985
937 Ga0207659_10055005
938 Ga0207659_10466415
939 Ga0207687_10027748
940 Ga0207644_10000462
941 Ga0207644_10196489
942 Ga0207690_10021793
943 Ga0207690_10221745
944 Ga0207690_10942928
945 Ga0207706_10025673
946 Ga0207706_10065497
947 Ga0207706_10073410
948 Ga0207706_10112458
949 Ga0207686_10121165
950 Ga0207709_10004564
951 Ga0207709_10205169
952 Ga0207669_10007739
953 Ga0207669_10220310
954 Ga0207669_10222393
955 Ga0207669_10618285
956 Ga0207669_10676335
957 Ga0207704_10024750
958 Ga0207704_10031886
959 Ga0207704_10393483
960 Ga0207704_10686719
961 Ga0207691_10003503
962 Ga0207691_10008918
963 Ga0207691_10041105
964 Ga0207691_10050718
965 Ga0207691_10089880
966 Ga0207691_10090811
967 Ga0207691_10149488
968 Ga0207691_10453618
969 Ga0207711_10014240
970 Ga0207711_10025126
971 Ga0207711_10078412
972 Ga0207711_10140763
973 Ga0207689_10001974
974 Ga0207689_10012115
975 Ga0207689_10227203
976 Ga0207689_10369147
977 Ga0207661_10462926
978 Ga0207679_10053493
979 Ga0207679_10146286
980 Ga0207667_10189504
981 Ga0207667_10232189
982 Ga0207651_10015846
983 Ga0207651_10061226
984 Ga0207651_10109835
985 Ga0207651_10204605
986 Ga0207651_10273509
987 Ga0207651_10299241
988 Ga0207712_10003891
989 Ga0207712_10203120
990 Ga0207712_10485339
991 Ga0207712_11350784
992 Ga0207712_11524822
993 Ga0207668_10108075
994 Ga0207668_10328905
995 Ga0207668_10671221
996 Ga0207640_10143216
997 Ga0207640_10179661
998 Ga0207640_10225572
999 Ga0207640_10329565
1000 Ga0207640_10839661
1001 Ga0207658_10001563
1002 Ga0207658_10053341
1003 Ga0207677_10320341
1004 Ga0207677_10326333
1005 Ga0207677_10621450
1006 Ga0207677_10695148
1007 Ga0207703_10002328
1008 Ga0207703_10050301
1009 Ga0207703_10308913
1010 Ga0207703_11317301
1011 Ga0207639_10174172
1012 Ga0207639_10308666
1013 Ga0207678_10270051
1014 Ga0207678_10270122
1015 Ga0207678_10471658
1016 Ga0207678_10576945
1017 Ga0207708_10043949
1018 Ga0207708_10081963
1019 Ga0207708_12030928
1020 Ga0207702_11460559
1021 Ga0207702_11708928
1022 Ga0207641_10004027
1023 Ga0207641_10012670
1024 Ga0207641_10060063
1025 Ga0207641_10190778
1026 Ga0207641_10577983
1027 Ga0207641_11030009
1028 Ga0207648_10000319
1029 Ga0207648_10008528
1030 Ga0207648_10023359
1031 Ga0207648_10062150
1032 Ga0207648_10177414
1033 Ga0207648_10181059
1034 Ga0207648_11899537
1035 Ga0207676_10053702
1036 Ga0207676_10173458
1037 Ga0207676_10178442
1038 Ga0207676_10389406
1039 Ga0207676_10569841
1040 Ga0207674_10080417
1041 Ga0207674_10213840
1042 Ga0207675_100000483
1043 Ga0207675_100001938
1044 Ga0207675_100004711
1045 Ga0207675_100005279
1046 Ga0207675_100494355
1047 Ga0207675_101305191
1048 Ga0207683_10033956
1049 Ga0207683_10081702
1050 Ga0207683_10093144
1051 Ga0207683_10093778
1052 Ga0207683_10147069
1053 Ga0207683_10173705
1054 Ga0207698_10018538
1055 Ga0207698_10053910
1056 Ga0207698_10175852
1057 Ga0207698_10425518
1058 Ga0207698_10799453
1059 Ga0209281_1000103
1060 Ga0268266_10166453
1061 Ga0268266_10288088
1062 Ga0268265_10002776
1063 Ga0268265_10140469
1064 Ga0268264_10000629
1065 Ga0268264_10009506
1066 Ga0268264_10537009
1067 Ga0307517_10511161
1068 Ga0307515_10017525
1069 Ga0307513_10232518
1070 Ga0307509_10296988
1071 Ga0307509_10304296
1072 Ga0307508_10000028
1073 Ga0307508_10256473
1074 Ga0316579_10019234
1075 Ga0316578_10008717
1076 Ga0307516_10453660
1077 Ga0307516_10824426
1078 Ga0307412_10366990
1079 Ga0307411_10135664
1080 Ga0307507_10103698
1081 Ga0307510_10061923
1082 Ga0316592_1027594
1083 Ga0316596_1039471
1084 Ga0373928_0055252
1085 Ga0373944_0029104
1086 Ga0373939_0317469
1087 Ga0373941_0268366
1088 Ga0373960_0145688
1089 Ga0373943_0033822
1090 Ga0373946_0234074
1091 Ga0373942_0104674
1092 Ga0316574_0537777
1093 Ga0373931_0459527
1094 Ga0373931_0851945
1095 Ga0373933_0250903
1096 Ga0373947_0310668
1097 Ga0316584_0690544
1098 Ga0316584_0762441
1099 Ga0373925_0101440
1100 Ga0373925_0260474
1101 Ga0395900_0819180
1102 Ga0395905_0061795
1103 Ga0395905_1340162
1104 Ga0395901_0200832
1105 Ga0395901_0905009
1106 Ga0451800_0158904
1107 Ga0451839_1132686
1108 Ga0451851_1081764
1109 Ga0451853_2577876
1110 Ga0439449_0002141
1111 Ga0439462_0001869
1112 Ga0450903_051236
1113 Ga0439464_0002040
1114 Ga0466965_0252746
1115 Ga0453684_0622577
1116 Ga0453684_0752393
1117 Ga0453684_2533945
1118 Ga0466959_0200907
1119 Ga0495603_0119115
1120 Ga0495638_0000752
1121 Ga0495638_0333634
1122 Ga0495638_0448075
1123 Ga0495580_0197073
1124 Ga0495605_0059938
1125 Ga0495596_0383215
1126 Ga0495620_0264753
1127 Ga0495632_0227837
1128 Ga0495643_0132379
1129 Ga0495666_0098426
1130 Ga0495642_0294166
1131 Ga0495625_0023983
1132 Ga0495635_0025152
1133 Ga0495658_0032685
1134 Ga0495669_0049465
1135 Ga0495649_0047006
1136 Ga0495589_0028159
1137 Ga0495683_0046481
1138 Ga0495684_0051415
1139 Ga0496100_0774847
1140 Ga0496101_0565936
1141 Ga0496101_0627536
1142 Ga0496101_1384080
1143 Ga0496102_0015391
1144 Ga0496102_0046614
1145 Ga0496104_0520875
1146 Ga0496104_0573911
1147 Ga0496104_0831072
1148 Ga0496104_1710176
1149 Ga0496105_0019171
1150 Ga0496106_0029512
1151 Ga0496106_0081220
1152 Ga0496107_0035814
1153 Ga0496108_1662074
1154 Ga0496109_0361036
1155 Ga0496110_0126417
1156 Ga0496110_0677045
1157 Ga0496111_0368589
1158 Ga0496112_0038779
1159 Ga0496113_0354442
1160 Ga0496113_0370130
1161 Ga0496114_0047188
1162 Ga0496114_0049718
1163 Ga0496114_0193456
1164 Ga0496114_0769727
1165 Ga0501034_0014133
1166 Ga0501043_0000112
1167 Ga0501046_0000146
1168 Ga0501047_0000192
1169 Ga0501048_0000874
1170 Ga0501067_0023254
1171 Ga0501068_0305666
1172 Ga0501069_0940407
1173 Ga0501070_0002912
1174 Ga0501070_0999634
1175 Ga0501072_0035179
1176 Ga0501073_0005162
1177 Ga0501074_0154733
1178 Ga0501079_1537212
1179 Ga0501080_0237015
1180 Ga0501083_0163418
1181 Ga0501264_014901
1182 Ga0501280_000245
1183 Ga0501035_1016803
1184 Ga0501045_0033230
1185 nmdc:mga0k408_7246_c1
1186 nmdc:mga05p37_1912223_c1
1187 nmdc:mga08y16_1090279_c1
1188 nmdc:mga08y16_669391_c1
1189 nmdc:mga0n895_205852_c1
1190 nmdc:mga0a205_506892_c1
1191 Ga0500590_005144
1192 Ga0500619_072884
1193 Ga0501084_1564184
1194 Ga0501082_0154760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

43

105

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9381 38 119
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.9327 36 118
7x85-assembly2.cif.gz_C crystal structure of chicken cenp-c cupin domain 0.9223 33 118
3h8u-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.918 36 129
3ww2-assembly1.cif.gz_A x-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose 0.9117 37 118
ID Description Score Start End Superfamily
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9241 25 118 2.60.120.10
af_Q2G2A6_62_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9201 39 117 2.60.120.10
3h8uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9167 36 129 2.60.120.10
af_Q5A3Z5_62_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9167 38 130 2.60.120.10
2oa2A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9146 36 119 2.60.120.10
ID Description Score Start End GO Terms
AF-N6XJC9-F1-model_v4 Cupin 0.9977 41 131
AF-A0A538NES1-F1-model_v4 Cupin domain-containing protein 0.982 41 131
AF-A0A0P9NKE3-F1-model_v4 Cupin type-2 domain-containing protein 0.9804 43 128
AF-A0A2E9WSI7-F1-model_v4 Cupin 0.9749 55 132
AF-A0A535GG01-F1-model_v4 Cupin domain-containing protein 0.9733 23 129

Map