metagRoot

F467771

General Info

Members	Datasets	Scaffolds	Average Seq Length
598	275	598	154

Family's Representative Sequence

Representative Sequence	3300006358\|Ga0068871_100748223\|Ga0068871_1007482232
Length	157
Sequence	MRRAAVAIATVGGLGYFPIAPGTVGSAAGVALYLLTNSWSWQAQLALIAAVSLVGIWASSEAALHFKREDPGAVVVDEVAGQLVTLFAIGGVGLVLSWRGLLIGFLIFRVLDIIKPYPANRFERLHGGLGIMADDLMAGLYGNLLMWAVVSVFPSMR

Samples

	Sample ID	Description	Type	Environment
1	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
2	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
3	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
4	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
5	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
6	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
7	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
8	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
9	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
10	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
14	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
15	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
16	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
17	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
18	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
19	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
20	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
21	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
22	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
23	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
24	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
25	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
26	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
27	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
28	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
29	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
30	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
31	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
32	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
33	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
34	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
35	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
36	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
37	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
38	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
39	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
40	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
41	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
42	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
43	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
44	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
47	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
48	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
49	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
50	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
51	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
52	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
53	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
54	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
55	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
56	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
57	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
58	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
59	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
60	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
61	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
62	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
63	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
64	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
65	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
66	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
67	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
68	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
69	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
71	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
72	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
73	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
74	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
75	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
76	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
77	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
78	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
79	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
81	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
82	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
84	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
86	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
87	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
88	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
89	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
90	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
91	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
92	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
93	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
94	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
95	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
96	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
97	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
98	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
99	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
102	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
103	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
104	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
105	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
149	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
150	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
153	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
154	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
155	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
156	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
157	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
158	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
159	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
160	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
161	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
162	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
163	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
164	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
165	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
166	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
167	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
168	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
169	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
170	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
171	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
172	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
173	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
175	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
176	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
177	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
178	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
179	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
180	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
181	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
182	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
183	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
184	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
185	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
186	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
187	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
188	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
189	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
190	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
191	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
192	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
193	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
194	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
195	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
196	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
197	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
198	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
199	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
200	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
201	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
202	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
203	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
204	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
205	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
206	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
207	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
208	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
209	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
210	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
211	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
212	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
213	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
214	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
215	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
216	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
217	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
218	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
219	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
223	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
224	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
225	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
229	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
232	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
234	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
237	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
238	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
240	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
241	3300049666	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control	Metagenome	Rhizosphere
242	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
243	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
244	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
245	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
246	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
247	3300049774	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought	Metagenome	Rhizosphere
248	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
249	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
251	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
252	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
253	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
254	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
255	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
256	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
257	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
258	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
259	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
260	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
261	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
262	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
263	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
264	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
265	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
266	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
267	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
268	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
269	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
270	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
271	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
272	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
273	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
274	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
275	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.18
Nodule	0
Rhizoplane	3.68
Rhizosphere	90.97
Stem	0
Stem Tuber	0
Unclassified	0.17

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065712_10107179	3300005290	Bacteria	1901
2	Ga0065712_10109863	3300005290	Bacteria	1848
3	Ga0065715_10146348	3300005293	Bacteria	1784
4	Ga0065715_10209276	3300005293	Bacteria	1301
5	Ga0065707_10131583	3300005295	Bacteria	1911
6	Ga0070676_10062834	3300005328	Bacteria	2210
7	Ga0070676_10072224	3300005328	Bacteria	2074
8	Ga0070683_100000214	3300005329	Bacteria	39384
9	Ga0070683_100008011	3300005329	Bacteria	8968
10	Ga0070690_100015534	3300005330	Bacteria	4545
11	Ga0070670_100014483	3300005331	Bacteria	6772
12	Ga0070670_100045920	3300005331	Archaea	3756
13	Ga0070677_10056885	3300005333	Bacteria	1601
14	Ga0068869_100212671	3300005334	Unclassified	1529
15	Ga0068869_100459976	3300005334	Bacteria	1056
16	Ga0070666_10155895	3300005335	Bacteria	1595
17	Ga0070680_100201559	3300005336	Unclassified	1678
18	Ga0070689_100073883	3300005340	Bacteria	2667
19	Ga0070689_100082191	3300005340	Bacteria	2530
20	Ga0070689_101019929	3300005340	Bacteria	737
21	Ga0070691_10030579	3300005341	Bacteria	2522
22	Ga0070661_100018770	3300005344	Bacteria	4922
23	Ga0070661_100096734	3300005344	Unclassified	2191
24	Ga0070669_100015102	3300005353	Bacteria	5501
25	Ga0070669_100149169	3300005353	Bacteria	1809
26	Ga0070675_100031187	3300005354	Unclassified	4308
27	Ga0070675_100280956	3300005354	Unclassified	1463
28	Ga0070675_100282542	3300005354	Unclassified	1459
29	Ga0070675_100502276	3300005354	Bacteria	1093
30	Ga0070675_101285196	3300005354	Bacteria	674
31	Ga0070671_100062622	3300005355	Bacteria	3097
32	Ga0070674_100396668	3300005356	Unclassified	1126
33	Ga0070673_100176894	3300005364	Bacteria	1824
34	Ga0070673_100683188	3300005364	Unclassified	942
35	Ga0070688_100231149	3300005365	Bacteria	1308
36	Ga0070659_100318117	3300005366	Bacteria	1301
37	Ga0070659_100676348	3300005366	Bacteria	891
38	Ga0070659_100787857	3300005366	Bacteria	826
39	Ga0070659_101027565	3300005366	Archaea	724
40	Ga0070667_100068350	3300005367	Unclassified	3023
41	Ga0070667_101280396	3300005367	Bacteria	687
42	Ga0070713_100201655	3300005436	Bacteria	1797
43	Ga0070701_10072175	3300005438	Bacteria	1848
44	Ga0070711_100071238	3300005439	Unclassified	2449
45	Ga0070705_100215703	3300005440	Bacteria	1326
46	Ga0070700_100012253	3300005441	Bacteria	4779
47	Ga0070700_100082681	3300005441	Bacteria	2077
48	Ga0070700_100700387	3300005441	Unclassified	805
49	Ga0070694_100323939	3300005444	Unclassified	1187
50	Ga0070663_100011990	3300005455	Bacteria	5469
51	Ga0070663_100156958	3300005455	Bacteria	1749
52	Ga0070678_100076525	3300005456	Unclassified	2521
53	Ga0070678_100356611	3300005456	Unclassified	1259
54	Ga0070678_100365150	3300005456	Bacteria	1245
55	Ga0070662_100187073	3300005457	Unclassified	1635
56	Ga0070681_10421491	3300005458	Unclassified	1247
57	Ga0070681_10953732	3300005458	Archaea	777
58	Ga0068867_100178176	3300005459	Bacteria	1688
59	Ga0068867_100557381	3300005459	Bacteria	994
60	Ga0070706_100538010	3300005467	Bacteria	1087
61	Ga0070706_100561290	3300005467	Bacteria	1062
62	Ga0070698_100034473	3300005471	Bacteria	5238
63	Ga0070698_101082567	3300005471	Bacteria	750
64	Ga0070699_100002056	3300005518	Bacteria	18203
65	Ga0070699_100173231	3300005518	Bacteria	1913
66	Ga0070679_100504250	3300005530	Archaea	1154
67	Ga0070679_100605285	3300005530	Bacteria	1039
68	Ga0070684_100000085	3300005535	Bacteria	61530
69	Ga0070684_100051787	3300005535	Bacteria	3568
70	Ga0070697_100130381	3300005536	Unclassified	2108
71	Ga0070672_100067786	3300005543	Bacteria	2829
72	Ga0070672_100348232	3300005543	Bacteria	1262
73	Ga0070672_100861904	3300005543	Unclassified	799
74	Ga0070695_100635670	3300005545	Bacteria	841
75	Ga0070696_100204554	3300005546	Bacteria	1475
76	Ga0070693_100077878	3300005547	Bacteria	1969
77	Ga0070665_100081080	3300005548	Bacteria	3250
78	Ga0070704_100096470	3300005549	Bacteria	2217
79	Ga0070704_100544464	3300005549	Bacteria	1013
80	Ga0070704_100705280	3300005549	Unclassified	895
81	Ga0068855_100778040	3300005563	Bacteria	1019
82	Ga0070664_100225210	3300005564	Archaea	1679
83	Ga0070664_100388851	3300005564	Bacteria	1274
84	Ga0070664_100433627	3300005564	Bacteria	1205
85	Ga0070664_101056182	3300005564	Bacteria	764
86	Ga0068857_100245455	3300005577	Unclassified	1640
87	Ga0068857_100402908	3300005577	Bacteria	1273
88	Ga0068857_101154063	3300005577	Bacteria	749
89	Ga0068857_101485082	3300005577	Bacteria	660
90	Ga0068854_100079347	3300005578	Bacteria	2420
91	Ga0068854_100352463	3300005578	Bacteria	1205
92	Ga0068854_100667106	3300005578	Unclassified	894
93	Ga0070702_100608393	3300005615	Bacteria	820
94	Ga0068852_100473243	3300005616	Bacteria	1244
95	Ga0068859_100388348	3300005617	Bacteria	1492
96	Ga0068859_100534342	3300005617	Unclassified	1267
97	Ga0068864_100039414	3300005618	Bacteria	4038
98	Ga0068864_100272497	3300005618	Bacteria	1577
99	Ga0068864_100312132	3300005618	Unclassified	1474
100	Ga0068864_101386228	3300005618	Unclassified	704
101	Ga0068861_100264110	3300005719	Bacteria	1475
102	Ga0068861_100440104	3300005719	Bacteria	1166
103	Ga0068861_100617769	3300005719	Bacteria	997
104	Ga0068851_10061313	3300005834	Bacteria	1928
105	Ga0068863_100243129	3300005841	Bacteria	1737
106	Ga0068858_100165857	3300005842	Bacteria	2081
107	Ga0068858_100953936	3300005842	Bacteria	840
108	Ga0068860_100251140	3300005843	Bacteria	1722
109	Ga0068860_100758595	3300005843	Bacteria	982
110	Ga0068862_100059432	3300005844	Bacteria	3283
111	Ga0068862_100167757	3300005844	Bacteria	1964
112	Ga0081455_10420053	3300005937	Unclassified	922
113	Ga0070717_10036421	3300006028	Bacteria	3991
114	Ga0075365_10054007	3300006038	Bacteria	2663
115	Ga0075365_10153267	3300006038	Unclassified	1604
116	Ga0075365_10648987	3300006038	Unclassified	746
117	Ga0075368_10019433	3300006042	Bacteria	2564
118	Ga0075364_10009962	3300006051	Bacteria	5720
119	Ga0075364_10010806	3300006051	Bacteria	5525
120	Ga0075432_10304926	3300006058	Unclassified	662
121	Ga0075362_10000285	3300006177	Bacteria	14268
122	Ga0075367_10020309	3300006178	Bacteria	3697
123	Ga0075367_10035482	3300006178	Bacteria	2887
124	Ga0075366_10020438	3300006195	Bacteria	3843
125	Ga0075366_10032940	3300006195	Bacteria	3052
126	Ga0097621_100192837	3300006237	Unclassified	1765
127	Ga0097621_100837141	3300006237	Unclassified	854
128	Ga0075370_10011529	3300006353	Bacteria	4648
129	Ga0068871_100748223	3300006358	Bacteria	898
130	Ga0075428_100000003	3300006844	Bacteria	365483
131	Ga0075428_100001536	3300006844	Bacteria	24707
132	Ga0075428_100006015	3300006844	Bacteria	13480
133	Ga0075428_100006271	3300006844	Bacteria	13222
134	Ga0075428_100014536	3300006844	Bacteria	8743
135	Ga0075428_100202410	3300006844	Bacteria	2146
136	Ga0075428_101628935	3300006844	Bacteria	674
137	Ga0075430_100001106	3300006846	Bacteria	21428
138	Ga0075430_100004207	3300006846	Bacteria	12144
139	Ga0075430_100030597	3300006846	Bacteria	4572
140	Ga0075430_100063947	3300006846	Unclassified	3091
141	Ga0075430_100072437	3300006846	Bacteria	2890
142	Ga0075430_100201573	3300006846	Bacteria	1652
143	Ga0075430_100268723	3300006846	Bacteria	1412
144	Ga0075430_101135934	3300006846	Unclassified	643
145	Ga0075431_100002553	3300006847	Bacteria	17577
146	Ga0075431_100011757	3300006847	Bacteria	8833
147	Ga0075431_100017923	3300006847	Bacteria	7202
148	Ga0075431_100035192	3300006847	Bacteria	5157
149	Ga0075431_100035389	3300006847	Bacteria	5142
150	Ga0075431_100092106	3300006847	Unclassified	3128
151	Ga0075431_100358864	3300006847	Bacteria	1464
152	Ga0075431_100472989	3300006847	Unclassified	1247
153	Ga0075431_100613222	3300006847	Bacteria	1071
154	Ga0075431_101079071	3300006847	Bacteria	768
155	Ga0075431_101574552	3300006847	Unclassified	615
156	Ga0075433_10022960	3300006852	Bacteria	5244
157	Ga0075433_10029166	3300006852	Bacteria	4698
158	Ga0075433_10485562	3300006852	Unclassified	1088
159	Ga0075434_100025348	3300006871	Bacteria	5802
160	Ga0075434_100045799	3300006871	Bacteria	4340
161	Ga0075434_100149331	3300006871	Bacteria	2357
162	Ga0075434_100170087	3300006871	Bacteria	2199
163	Ga0075434_100777722	3300006871	Bacteria	974
164	Ga0075434_101104213	3300006871	Bacteria	806
165	Ga0075429_100003154	3300006880	Bacteria	14009
166	Ga0075429_100027804	3300006880	Bacteria	4909
167	Ga0075429_100034928	3300006880	Bacteria	4370
168	Ga0075429_100092422	3300006880	Unclassified	2639
169	Ga0075429_100350077	3300006880	Unclassified	1293
170	Ga0075429_100416873	3300006880	Unclassified	1176
171	Ga0075429_101139448	3300006880	Bacteria	681
172	Ga0068865_100384176	3300006881	Bacteria	1146
173	Ga0068865_100558892	3300006881	Unclassified	962
174	Ga0097620_100388354	3300006931	Bacteria	1492
175	Ga0097620_100534316	3300006931	Unclassified	1267
176	Ga0075435_100006103	3300007076	Bacteria	8493
177	Ga0075435_100017781	3300007076	Bacteria	5389
178	Ga0075435_100189380	3300007076	Bacteria	1741
179	Ga0075435_101384770	3300007076	Bacteria	616
180	Ga0105240_10227694	3300009093	Bacteria	2168
181	Ga0105240_10304122	3300009093	Unclassified	1823
182	Ga0111539_10000001	3300009094	Bacteria	1035431
183	Ga0111539_10002570	3300009094	Bacteria	24028
184	Ga0111539_10002608	3300009094	Bacteria	23892
185	Ga0111539_10024150	3300009094	Bacteria	7465
186	Ga0111539_10107679	3300009094	Bacteria	3271
187	Ga0111539_10249528	3300009094	Unclassified	2066
188	Ga0111539_10443543	3300009094	Unclassified	1511
189	Ga0111539_10496669	3300009094	Bacteria	1421
190	Ga0111539_10864814	3300009094	Bacteria	1052
191	Ga0111539_11249262	3300009094	Bacteria	862
192	Ga0105245_10096137	3300009098	Bacteria	2733
193	Ga0105245_10399444	3300009098	Bacteria	1373
194	Ga0114129_10000321	3300009147	Bacteria	56314
195	Ga0114129_10002632	3300009147	Bacteria	24977
196	Ga0114129_10004917	3300009147	Bacteria	18865
197	Ga0114129_10005465	3300009147	Bacteria	17963
198	Ga0114129_10006827	3300009147	Bacteria	16216
199	Ga0114129_10007113	3300009147	Bacteria	15921
200	Ga0114129_10035915	3300009147	Bacteria	6998
201	Ga0114129_10068701	3300009147	Bacteria	4940
202	Ga0114129_12044733	3300009147	Bacteria	692
203	Ga0105243_10250865	3300009148	Bacteria	1580
204	Ga0105243_10360263	3300009148	Bacteria	1338
205	Ga0105242_11833303	3300009176	Bacteria	646
206	Ga0105248_10064510	3300009177	Bacteria	4112
207	Ga0105248_10077895	3300009177	Bacteria	3727
208	Ga0105248_10152055	3300009177	Unclassified	2611
209	Ga0105237_10403348	3300009545	Unclassified	1372
210	Ga0105238_10447377	3300009551	Bacteria	1289
211	Ga0105249_10030131	3300009553	Bacteria	4903
212	Ga0105249_10369676	3300009553	Bacteria	1457
213	Ga0105249_10442783	3300009553	Unclassified	1337
214	Ga0105249_10482949	3300009553	Bacteria	1282
215	Ga0105239_10278566	3300010375	Bacteria	1882
216	Ga0105239_10738509	3300010375	Unclassified	1126
217	Ga0105239_11402716	3300010375	Bacteria	806
218	Ga0105246_10135176	3300011119	Unclassified	1847
219	Ga0105246_10342307	3300011119	Unclassified	1223
220	Ga0157342_1031098	3300012507	Unclassified	673
221	Ga0157370_10698765	3300013104	Unclassified	926
222	Ga0157374_10029401	3300013296	Bacteria	4976
223	Ga0157378_10921685	3300013297	Unclassified	905
224	Ga0157378_11135591	3300013297	Bacteria	819
225	Ga0163162_10106689	3300013306	Unclassified	2896
226	Ga0163162_11131991	3300013306	Bacteria	887
227	Ga0157372_10080485	3300013307	Bacteria	3686
228	Ga0157372_10157301	3300013307	Unclassified	2625
229	Ga0157375_11063759	3300013308	Unclassified	946
230	Ga0157375_11365465	3300013308	Bacteria	834
231	Ga0157380_10085156	3300014326	Unclassified	2594
232	Ga0157380_10579084	3300014326	Bacteria	1106
233	Ga0157377_10078436	3300014745	Bacteria	1925
234	Ga0157379_10797633	3300014968	Bacteria	891
235	Ga0157376_10694273	3300014969	Bacteria	1022
236	Ga0163161_11209011	3300017792	Bacteria	654
237	Ga0207697_10072472	3300025315	Unclassified	1444
238	Ga0207656_10063400	3300025321	Bacteria	1627
239	Ga0207682_10101929	3300025893	Unclassified	1256
240	Ga0207688_10090747	3300025901	Bacteria	1754
241	Ga0207699_10042968	3300025906	Bacteria	2623
242	Ga0207645_10120680	3300025907	Bacteria	1701
243	Ga0207684_10112534	3300025910	Bacteria	2330
244	Ga0207707_10994913	3300025912	Unclassified	688
245	Ga0207707_11444974	3300025912	Archaea	547
246	Ga0207695_10397298	3300025913	Bacteria	1263
247	Ga0207663_10573519	3300025916	Unclassified	884
248	Ga0207662_10003082	3300025918	Bacteria	8507
249	Ga0207662_10359200	3300025918	Bacteria	980
250	Ga0207649_10230944	3300025920	Unclassified	1323
251	Ga0207652_10187544	3300025921	Archaea	1860
252	Ga0207646_10099436	3300025922	Unclassified	2607
253	Ga0207681_10051433	3300025923	Unclassified	2791
254	Ga0207681_10113429	3300025923	Bacteria	1976
255	Ga0207650_10000805	3300025925	Bacteria	24084
256	Ga0207650_10056861	3300025925	Bacteria	2908
257	Ga0207659_10113307	3300025926	Bacteria	2065
258	Ga0207659_10180468	3300025926	Bacteria	1672
259	Ga0207659_10281973	3300025926	Unclassified	1359
260	Ga0207659_10714543	3300025926	Unclassified	858
261	Ga0207659_10880854	3300025926	Bacteria	770
262	Ga0207659_11239723	3300025926	Bacteria	641
263	Ga0207687_10343112	3300025927	Unclassified	1215
264	Ga0207700_10208829	3300025928	Bacteria	1650
265	Ga0207644_10210125	3300025931	Bacteria	1538
266	Ga0207706_11417715	3300025933	Unclassified	570
267	Ga0207670_10051068	3300025936	Bacteria	2775
268	Ga0207670_10324214	3300025936	Bacteria	1213
269	Ga0207669_10205614	3300025937	Bacteria	1433
270	Ga0207669_11651347	3300025937	Bacteria	547
271	Ga0207704_10471138	3300025938	Bacteria	1006
272	Ga0207691_10006590	3300025940	Bacteria	11214
273	Ga0207691_10279144	3300025940	Bacteria	1437
274	Ga0207691_10708419	3300025940	Bacteria	849
275	Ga0207711_10015562	3300025941	Bacteria	6314
276	Ga0207711_10123532	3300025941	Unclassified	2313
277	Ga0207711_10127610	3300025941	Bacteria	2277
278	Ga0207689_10074280	3300025942	Bacteria	2793
279	Ga0207689_10471940	3300025942	Bacteria	1050
280	Ga0207689_10839505	3300025942	Unclassified	775
281	Ga0207661_10006203	3300025944	Bacteria	8457
282	Ga0207661_10023647	3300025944	Bacteria	4645
283	Ga0207679_10413174	3300025945	Bacteria	1189
284	Ga0207679_10414441	3300025945	Archaea	1188
285	Ga0207679_10714269	3300025945	Unclassified	910
286	Ga0207667_11025975	3300025949	Bacteria	811
287	Ga0207651_10124663	3300025960	Bacteria	1960
288	Ga0207712_10035537	3300025961	Unclassified	3387
289	Ga0207712_10995818	3300025961	Bacteria	743
290	Ga0207668_10745623	3300025972	Bacteria	864
291	Ga0207640_10103938	3300025981	Bacteria	1998
292	Ga0207703_10295940	3300026035	Bacteria	1474
293	Ga0207678_10099190	3300026067	Bacteria	2488
294	Ga0207708_10083908	3300026075	Bacteria	2450
295	Ga0207708_10382210	3300026075	Bacteria	1161
296	Ga0207641_10128397	3300026088	Unclassified	2273
297	Ga0207641_10568084	3300026088	Bacteria	1108
298	Ga0207641_11096400	3300026088	Bacteria	795
299	Ga0207648_10045332	3300026089	Bacteria	3857
300	Ga0207648_10333609	3300026089	Unclassified	1364
301	Ga0207676_10107150	3300026095	Bacteria	2330
302	Ga0207674_10022018	3300026116	Bacteria	6855
303	Ga0207674_10583410	3300026116	Bacteria	1080
304	Ga0207675_100360939	3300026118	Bacteria	1425
305	Ga0207675_100510117	3300026118	Bacteria	1198
306	Ga0207675_100578485	3300026118	Bacteria	1124
307	Ga0207683_10109573	3300026121	Bacteria	2472
308	Ga0207683_10381914	3300026121	Bacteria	1295
309	Ga0207683_10730401	3300026121	Unclassified	918
310	Ga0209813_10067800	3300027866	Bacteria	1154
311	Ga0209813_10094875	3300027866	Bacteria	1007
312	Ga0207428_10000002	3300027907	Bacteria	854851
313	Ga0207428_10026228	3300027907	Bacteria	4865
314	Ga0207428_10048420	3300027907	Unclassified	3410
315	Ga0207428_10372325	3300027907	Unclassified	1049
316	Ga0268265_10299594	3300028380	Bacteria	1447
317	Ga0268265_10533423	3300028380	Bacteria	1111
318	Ga0268265_10734281	3300028380	Bacteria	957
319	Ga0268264_10210294	3300028381	Bacteria	1785
320	Ga0268264_10505449	3300028381	Unclassified	1179
321	Ga0268264_11242706	3300028381	Bacteria	755
322	Ga0307408_100008981	3300031548	Bacteria	6603
323	Ga0307408_100043248	3300031548	Bacteria	3205
324	Ga0307408_100063320	3300031548	Unclassified	2705
325	Ga0307408_100115522	3300031548	Bacteria	2070
326	Ga0307408_100148381	3300031548	Archaea	1849
327	Ga0307408_100153251	3300031548	Bacteria	1822
328	Ga0307408_100263582	3300031548	Bacteria	1427
329	Ga0307408_100554354	3300031548	Bacteria	1015
330	Ga0307405_10046532	3300031731	Bacteria	2666
331	Ga0307405_10127746	3300031731	Bacteria	1751
332	Ga0307405_10676019	3300031731	Bacteria	852
333	Ga0307405_11990633	3300031731	Bacteria	520
334	Ga0307413_10053786	3300031824	Bacteria	2439
335	Ga0307413_10535406	3300031824	Bacteria	947
336	Ga0307413_10761728	3300031824	Bacteria	810
337	Ga0307410_11417452	3300031852	Bacteria	610
338	Ga0307406_10462791	3300031901	Bacteria	1020
339	Ga0307406_10651535	3300031901	Bacteria	874
340	Ga0307407_10063854	3300031903	Unclassified	2162
341	Ga0307407_10136064	3300031903	Bacteria	1579
342	Ga0307407_10725994	3300031903	Bacteria	750
343	Ga0307412_10004542	3300031911	Bacteria	7731
344	Ga0307412_10175064	3300031911	Bacteria	1608
345	Ga0307412_10586028	3300031911	Unclassified	942
346	Ga0307409_100464228	3300031995	Unclassified	1225
347	Ga0307409_100486571	3300031995	Bacteria	1198
348	Ga0307416_100023401	3300032002	Bacteria	4482
349	Ga0307416_100085556	3300032002	Bacteria	2684
350	Ga0307416_100086912	3300032002	Bacteria	2667
351	Ga0307416_100132809	3300032002	Bacteria	2245
352	Ga0307416_100220193	3300032002	Bacteria	1819
353	Ga0307416_100637734	3300032002	Unclassified	1149
354	Ga0307416_100857676	3300032002	Bacteria	1006
355	Ga0307416_101404800	3300032002	Unclassified	804
356	Ga0307416_102844663	3300032002	Unclassified	579
357	Ga0307414_10239575	3300032004	Bacteria	1501
358	Ga0307411_10099707	3300032005	Bacteria	2051
359	Ga0307411_10100001	3300032005	Bacteria	2048
360	Ga0307411_10114354	3300032005	Bacteria	1939
361	Ga0307411_10148071	3300032005	Unclassified	1741
362	Ga0307411_11014916	3300032005	Unclassified	743
363	Ga0307415_100088501	3300032126	Bacteria	2234
364	Ga0307415_100095444	3300032126	Unclassified	2165
365	Ga0307415_100348211	3300032126	Bacteria	1246
366	Ga0373951_0198473	3300035091	Bacteria	583
367	Ga0373957_0373087	3300035120	Unclassified	611
368	Ga0373955_0069829	3300035172	Unclassified	1961
369	Ga0373924_0115942	3300035410	Bacteria	1160
370	Ga0373931_0151298	3300035691	Bacteria	1353
371	Ga0373935_0636609	3300035692	Unclassified	782
372	Ga0373935_1083714	3300035692	Unclassified	596
373	Ga0373933_0002856	3300035724	Bacteria	9645
374	Ga0373947_0015999	3300035725	Bacteria	4311
375	Ga0373937_0109927	3300036401	Bacteria	2563
376	Ga0373937_0496139	3300036401	Bacteria	1160
377	Ga0373937_1042215	3300036401	Unclassified	767
378	Ga0373925_0160613	3300037068	Bacteria	1770
379	Ga0373925_0481555	3300037068	Bacteria	1018
380	Ga0373925_0710054	3300037068	Unclassified	829
381	Ga0395905_1096673	3300037471	Bacteria	699
382	Ga0439439_0129889	3300041406	Bacteria	707
383	Ga0451807_1789922	3300041486	Bacteria	713
384	Ga0451853_1731505	3300041512	Unclassified	863
385	Ga0439433_0045425	3300041999	Bacteria	1028
386	Ga0439433_0086016	3300041999	Unclassified	769
387	Ga0439449_0075254	3300042007	Bacteria	1244
388	Ga0439449_0179303	3300042007	Bacteria	792
389	Ga0439450_002202	3300042008	Bacteria	3026
390	Ga0439462_0015280	3300042015	Bacteria	1978
391	Ga0450923_009025	3300042125	Unclassified	1733
392	Ga0439446_0044455	3300042156	Bacteria	1314
393	Ga0439434_0146095	3300042435	Bacteria	781
394	Ga0439435_0016689	3300042436	Unclassified	1846
395	Ga0439435_0076839	3300042436	Bacteria	997
396	Ga0439444_0041676	3300042437	Bacteria	904
397	Ga0439464_0004726	3300042439	Bacteria	3489
398	Ga0439460_0231194	3300042461	Bacteria	636
399	Ga0451577_0729093	3300042876	Bacteria	897
400	Ga0439440_0026783	3300042993	Bacteria	1336
401	Ga0451576_1896307	3300045051	Unclassified	615
402	Ga0495592_0169300	3300046454	Bacteria	1497
403	Ga0495603_0033007	3300046455	Unclassified	3115
404	Ga0495629_0688650	3300046459	Bacteria	679
405	Ga0495582_0574386	3300046473	Unclassified	652
406	Ga0495608_0128006	3300046511	Unclassified	1626
407	Ga0495630_0313270	3300046517	Bacteria	1200
408	Ga0495630_0945115	3300046517	Unclassified	656
409	Ga0495635_0689917	3300046663	Bacteria	663
410	Ga0495647_0210406	3300046681	Bacteria	855
411	Ga0495613_1071093	3300046689	Unclassified	515
412	Ga0495600_0122772	3300046809	Bacteria	1689
413	Ga0495684_0273487	3300047471	Bacteria	1221
414	Ga0495684_0391336	3300047471	Bacteria	978
415	Ga0495684_0678619	3300047471	Bacteria	686
416	Ga0496100_1295935	3300048903	Bacteria	575
417	Ga0496101_0038113	3300048904	Bacteria	3413
418	Ga0496101_0089666	3300048904	Unclassified	2286
419	Ga0496102_0015215	3300048905	Bacteria	6698
420	Ga0496104_0154473	3300048907	Bacteria	2203
421	Ga0496104_0570843	3300048907	Unclassified	1042
422	Ga0496105_1206432	3300048908	Unclassified	557
423	Ga0496106_0036771	3300048909	Unclassified	3663
424	Ga0496106_0488616	3300048909	Unclassified	989
425	Ga0496106_0598765	3300048909	Unclassified	883
426	Ga0496107_0816088	3300048910	Bacteria	682
427	Ga0496108_0000873	3300048911	Bacteria	23508
428	Ga0496109_0000242	3300048912	Bacteria	52965
429	Ga0496110_0041917	3300048913	Unclassified	3995
430	Ga0496111_0200814	3300048914	Bacteria	1482
431	Ga0496112_0025573	3300048915	Bacteria	5669
432	Ga0496112_0184471	3300048915	Bacteria	2050
433	Ga0496112_0189217	3300048915	Bacteria	2021
434	Ga0496113_0201124	3300048916	Bacteria	1584
435	Ga0496113_0238870	3300048916	Bacteria	1449
436	Ga0496114_0315232	3300048917	Unclassified	1382
437	Ga0501291_091573	3300049514	Bacteria	621
438	Ga0501299_035394	3300049522	Bacteria	981
439	Ga0501031_0544437	3300049568	Bacteria	748
440	Ga0501031_0732457	3300049568	Unclassified	634
441	Ga0501034_0012586	3300049571	Bacteria	8732
442	Ga0501034_0019449	3300049571	Bacteria	6947
443	Ga0501034_0138407	3300049571	Bacteria	2415
444	Ga0501036_0047225	3300049572	Unclassified	3647
445	Ga0501036_0196922	3300049572	Unclassified	1695
446	Ga0501038_0092326	3300049574	Unclassified	2535
447	Ga0501039_0368073	3300049575	Bacteria	1129
448	Ga0501039_0368486	3300049575	Bacteria	1128
449	Ga0501039_1065823	3300049575	Unclassified	627
450	Ga0501040_0028955	3300049576	Unclassified	3736
451	Ga0501040_0070820	3300049576	Bacteria	2407
452	Ga0501040_0396264	3300049576	Bacteria	991
453	Ga0501041_0029418	3300049577	Bacteria	3314
454	Ga0501041_0069370	3300049577	Unclassified	2162
455	Ga0501041_0189686	3300049577	Bacteria	1287
456	Ga0501041_1016656	3300049577	Unclassified	533
457	Ga0501042_0245718	3300049578	Unclassified	1291
458	Ga0501043_0101544	3300049579	Bacteria	2261
459	Ga0501043_0315390	3300049579	Bacteria	1193
460	Ga0501046_0376280	3300049580	Unclassified	1028
461	Ga0501046_0470453	3300049580	Unclassified	903
462	Ga0501048_0051905	3300049582	Bacteria	2918
463	Ga0501048_0063885	3300049582	Bacteria	2603
464	Ga0501048_0697561	3300049582	Unclassified	729
465	Ga0501067_0267971	3300049583	Bacteria	951
466	Ga0501070_0864536	3300049586	Bacteria	707
467	Ga0501071_0021505	3300049587	Bacteria	4494
468	Ga0501071_0094684	3300049587	Unclassified	2197
469	Ga0501071_0124476	3300049587	Bacteria	1912
470	Ga0501071_0128303	3300049587	Unclassified	1883
471	Ga0501071_0152067	3300049587	Unclassified	1727
472	Ga0501071_0395910	3300049587	Bacteria	1054
473	Ga0501072_0050641	3300049588	Bacteria	3270
474	Ga0501072_0347746	3300049588	Bacteria	1177
475	Ga0501072_0530266	3300049588	Unclassified	931
476	Ga0501073_0269312	3300049589	Unclassified	1175
477	Ga0501074_0103741	3300049590	Unclassified	2035
478	Ga0501074_0291953	3300049590	Bacteria	1158
479	Ga0501075_0010047	3300049591	Bacteria	6640
480	Ga0501075_0061057	3300049591	Bacteria	2840
481	Ga0501075_0224092	3300049591	Unclassified	1434
482	Ga0501075_0510996	3300049591	Unclassified	917
483	Ga0501075_0598486	3300049591	Bacteria	841
484	Ga0501075_0726733	3300049591	Bacteria	756
485	Ga0501076_0075405	3300049592	Bacteria	2703
486	Ga0501076_0309015	3300049592	Unclassified	1296
487	Ga0501076_0583276	3300049592	Unclassified	922
488	Ga0501076_1004028	3300049592	Bacteria	687
489	Ga0501077_0235879	3300049593	Unclassified	1163
490	Ga0501202_039651	3300049652	Unclassified	1013
491	Ga0501216_057883	3300049660	Bacteria	775
492	Ga0501228_006311	3300049666	Unclassified	1079
493	Ga0501249_093925	3300049679	Unclassified	714
494	Ga0501079_0082664	3300049741	Unclassified	2484
495	Ga0501079_0088137	3300049741	Unclassified	2403
496	Ga0501079_0463983	3300049741	Unclassified	995
497	Ga0501080_0066325	3300049742	Unclassified	3357
498	Ga0501080_0146349	3300049742	Bacteria	2184
499	Ga0501080_0151681	3300049742	Bacteria	2142
500	Ga0501081_0065646	3300049743	Bacteria	2523
501	Ga0501081_0101465	3300049743	Bacteria	2035
502	Ga0501081_0234247	3300049743	Bacteria	1338
503	Ga0501081_0816886	3300049743	Bacteria	702
504	Ga0501083_0442297	3300049744	Bacteria	846
505	Ga0501278_008031	3300049774	Bacteria	811
506	Ga0501283_071348	3300049779	Unclassified	640
507	Ga0501044_0839984	3300049823	Unclassified	796
508	Ga0501045_0007379	3300049824	Bacteria	7641
509	Ga0501045_0017491	3300049824	Bacteria	5091
510	Ga0501045_0054905	3300049824	Bacteria	2913
511	Ga0501045_0067639	3300049824	Bacteria	2624
512	Ga0501045_0117394	3300049824	Bacteria	1975
513	Ga0501045_0256010	3300049824	Unclassified	1303
514	nmdc:mga03683_1413_c1	3300050489	Bacteria	7157
515	nmdc:mga03n38_132944_c1	3300050490	Bacteria	1235
516	nmdc:mga00v17_11261_c1	3300050491	Bacteria	4914
517	nmdc:mga00v17_200518_c1	3300050491	Bacteria	1290
518	nmdc:mga00v17_844016_c1	3300050491	Unclassified	582
519	nmdc:mga0yw44_134231_c1	3300050492	Unclassified	1604
520	nmdc:mga0yw44_56649_c1	3300050492	Bacteria	2389
521	nmdc:mga0k408_12801_c1	3300050493	Bacteria	4590
522	nmdc:mga0k408_17356_c1	3300050493	Bacteria	4010
523	nmdc:mga06z11_190241_c1	3300050494	Bacteria	1188
524	nmdc:mga06z11_21063_c1	3300050494	Bacteria	3024
525	nmdc:mga06z11_335862_c1	3300050494	Bacteria	903
526	nmdc:mga04h51_112662_c1	3300050495	Bacteria	1005
527	nmdc:mga04h51_66477_c1	3300050495	Bacteria	1249
528	nmdc:mga07m45_205779_c1	3300050496	Unclassified	1145
529	nmdc:mga05p37_1437207_c1	3300050507	Bacteria	692
530	nmdc:mga05p37_247894_c1	3300050507	Bacteria	2138
531	nmdc:mga05p37_33982_c1	3300050507	Bacteria	6246
532	nmdc:mga05p37_4611_c1	3300050507	Bacteria	16111
533	nmdc:mga05p37_567112_c1	3300050507	Bacteria	1289
534	nmdc:mga05p37_5852_c1	3300050507	Bacteria	14455
535	nmdc:mga05p37_707300_c1	3300050507	Unclassified	1118
536	nmdc:mga05p37_7376_c1	3300050507	Bacteria	12971
537	nmdc:mga05p37_9359_c1	3300050507	Bacteria	11594
538	nmdc:mga09592_1080369_c1	3300050508	Unclassified	668
539	nmdc:mga09592_254850_c1	3300050508	Bacteria	1521
540	nmdc:mga09592_37036_c1	3300050508	Bacteria	4089
541	nmdc:mga09592_459585_c1	3300050508	Unclassified	1098
542	nmdc:mga09592_8544_c1	3300050508	Bacteria	8330
543	nmdc:mga0qj67_108192_c1	3300050509	Unclassified	2243
544	nmdc:mga0qj67_115127_c1	3300050509	Bacteria	2172
545	nmdc:mga0qj67_122521_c1	3300050509	Bacteria	2103
546	nmdc:mga0qj67_213806_c1	3300050509	Bacteria	1566
547	nmdc:mga0qj67_25887_c1	3300050509	Bacteria	4538
548	nmdc:mga0qj67_345273_c1	3300050509	Bacteria	1204
549	nmdc:mga0qj67_421146_c1	3300050509	Bacteria	1076
550	nmdc:mga0qj67_64328_c1	3300050509	Bacteria	2917
551	nmdc:mga0qj67_97824_c1	3300050509	Bacteria	2364
552	nmdc:mga06r32_1496597_c1	3300050510	Unclassified	615
553	nmdc:mga06r32_193251_c1	3300050510	Bacteria	2022
554	nmdc:mga06r32_332687_c1	3300050510	Bacteria	1504
555	nmdc:mga06r32_566569_c1	3300050510	Bacteria	1109
556	nmdc:mga06r32_60642_c1	3300050510	Bacteria	3641
557	nmdc:mga06r32_62404_c1	3300050510	Unclassified	3591
558	nmdc:mga06r32_809087_c1	3300050510	Bacteria	897
559	nmdc:mga06r32_81001_c1	3300050510	Bacteria	3161
560	nmdc:mga06r32_842525_c1	3300050510	Bacteria	876
561	nmdc:mga08y16_20285_c1	3300050511	Bacteria	7016
562	nmdc:mga08y16_22861_c1	3300050511	Bacteria	6599
563	nmdc:mga08y16_282733_c1	3300050511	Unclassified	1711
564	nmdc:mga08y16_3_c1	3300050511	Bacteria	936907
565	nmdc:mga08y16_405654_c1	3300050511	Bacteria	1394
566	nmdc:mga08y16_5212_c1	3300050511	Bacteria	13573
567	nmdc:mga08y16_695385_c1	3300050511	Bacteria	1017
568	nmdc:mga08y16_864756_c1	3300050511	Bacteria	893
569	nmdc:mga0n895_104321_c1	3300050512	Unclassified	2847
570	nmdc:mga0n895_1104614_c1	3300050512	Bacteria	770
571	nmdc:mga0n895_164746_c1	3300050512	Bacteria	2248
572	nmdc:mga0n895_266890_c1	3300050512	Bacteria	1736
573	nmdc:mga0n895_429561_c1	3300050512	Bacteria	1335
574	nmdc:mga0n895_45944_c1	3300050512	Bacteria	4264
575	nmdc:mga0n895_647159_c1	3300050512	Bacteria	1056
576	nmdc:mga0n895_94505_c1	3300050512	Bacteria	2993
577	nmdc:mga0rr50_57180_c1	3300050513	Bacteria	2917
578	nmdc:mga0rr50_72621_c1	3300050513	Bacteria	2628
579	nmdc:mga0rr50_887273_c1	3300050513	Bacteria	760
580	nmdc:mga0a205_170819_c1	3300050515	Unclassified	1349
581	nmdc:mga0a205_22380_c1	3300050515	Bacteria	5986
582	nmdc:mga0a205_8813_c1	3300050515	Bacteria	9188
583	Ga0495601_0547532	3300053077	Bacteria	745
584	Ga0500556_0084855	3300053104	Bacteria	1202
585	Ga0500628_009475	3300053129	Bacteria	1718
586	Ga0501084_0039752	3300054114	Unclassified	3934
587	Ga0501084_0056841	3300054114	Unclassified	3274
588	Ga0501084_0233273	3300054114	Bacteria	1553
589	Ga0501084_0274370	3300054114	Unclassified	1424
590	Ga0501084_1460849	3300054114	Bacteria	572
591	Ga0590071_000399	3300059421	Bacteria	12751
592	Ga0590075_000116	3300059424	Bacteria	20677
593	Ga0590077_000069	3300059426	Bacteria	25800
594	Ga0501082_0112351	3300060353	Unclassified	2359
595	Ga0501082_0113043	3300060353	Unclassified	2351
596	Ga0501082_0214347	3300060353	Unclassified	1675
597	Ga0530510_0013148	3300061734	Bacteria	5822
598	Ga0530510_0748500	3300061734	Bacteria	745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005548	Ga0070665_100081080	Ga0070665_1000810802	124
2	3300025942	Ga0207689_10839505	Ga0207689_108395051	124
3	3300028381	Ga0268264_11242706	Ga0268264_112427062	124
4	3300026088	Ga0207641_10568084	Ga0207641_105680841	126
5	3300005471	Ga0070698_100034473	Ga0070698_1000344732	145
6	3300005518	Ga0070699_100002056	Ga0070699_10000205613	145
7	3300005536	Ga0070697_100130381	Ga0070697_1001303812	145
8	3300005549	Ga0070704_100544464	Ga0070704_1005444642	145
9	3300006844	Ga0075428_101628935	Ga0075428_1016289352	145
10	3300009147	Ga0114129_10005465	Ga0114129_1000546521	145
11	3300026088	Ga0207641_11096400	Ga0207641_110964002	145
12	3300050507	nmdc:mga05p37_247894_c1	nmdc:mga05p37_247894_c1_607_1077	145
13	3300011119	Ga0105246_10135176	Ga0105246_101351762	147
14	3300013306	Ga0163162_11131991	Ga0163162_111319912	147
15	3300042015	Ga0439462_0015280	Ga0439462_0015280_221_670	147
16	3300042156	Ga0439446_0044455	Ga0439446_0044455_456_905	147
17	3300048911	Ga0496108_0000873	Ga0496108_0000873_16743_17192	147
18	3300048912	Ga0496109_0000242	Ga0496109_0000242_48844_49293	147
19	3300048913	Ga0496110_0041917	Ga0496110_0041917_1374_1823	147
20	3300048914	Ga0496111_0200814	Ga0496111_0200814_633_1082	147
21	3300048915	Ga0496112_0025573	Ga0496112_0025573_4159_4608	147
22	3300053104	Ga0500556_0084855	Ga0500556_0084855_97_561	150
23	3300005293	Ga0065715_10146348	Ga0065715_101463481	151
24	3300005354	Ga0070675_100280956	Ga0070675_1002809562	151
25	3300005354	Ga0070675_101285196	Ga0070675_1012851961	151
26	3300005456	Ga0070678_100076525	Ga0070678_1000765253	151
27	3300005457	Ga0070662_100187073	Ga0070662_1001870732	151
28	3300006058	Ga0075432_10304926	Ga0075432_103049262	151
29	3300006844	Ga0075428_100001536	Ga0075428_10000153615	151
30	3300006844	Ga0075428_100006015	Ga0075428_1000060155	151
31	3300006846	Ga0075430_100001106	Ga0075430_1000011069	151
32	3300006846	Ga0075430_100063947	Ga0075430_1000639473	151
33	3300006846	Ga0075430_100268723	Ga0075430_1002687232	151
34	3300006847	Ga0075431_100011757	Ga0075431_1000117575	151
35	3300006847	Ga0075431_100092106	Ga0075431_1000921063	151
36	3300006847	Ga0075431_101079071	Ga0075431_1010790712	151
37	3300006852	Ga0075433_10022960	Ga0075433_100229606	151
38	3300006880	Ga0075429_100003154	Ga0075429_1000031548	151
39	3300006880	Ga0075429_100027804	Ga0075429_1000278044	151
40	3300006880	Ga0075429_101139448	Ga0075429_1011394482	151
41	3300009094	Ga0111539_10002608	Ga0111539_1000260813	151
42	3300009094	Ga0111539_10249528	Ga0111539_102495282	151
43	3300009094	Ga0111539_10443543	Ga0111539_104435432	151
44	3300009147	Ga0114129_10000321	Ga0114129_1000032142	151
45	3300009147	Ga0114129_10007113	Ga0114129_1000711310	151
46	3300009147	Ga0114129_10068701	Ga0114129_100687013	151
47	3300025926	Ga0207659_10714543	Ga0207659_107145431	151
48	3300025926	Ga0207659_11239723	Ga0207659_112397231	151
49	3300026121	Ga0207683_10730401	Ga0207683_107304011	151
50	3300027907	Ga0207428_10026228	Ga0207428_100262285	151
51	3300027907	Ga0207428_10372325	Ga0207428_103723252	151
52	3300031548	Ga0307408_100008981	Ga0307408_1000089813	151
53	3300031548	Ga0307408_100063320	Ga0307408_1000633203	151
54	3300031548	Ga0307408_100153251	Ga0307408_1001532512	151
55	3300031548	Ga0307408_100263582	Ga0307408_1002635822	151
56	3300031731	Ga0307405_10046532	Ga0307405_100465322	151
57	3300031731	Ga0307405_11990633	Ga0307405_119906331	151
58	3300031901	Ga0307406_10462791	Ga0307406_104627912	151
59	3300031911	Ga0307412_10004542	Ga0307412_100045426	151
60	3300031911	Ga0307412_10175064	Ga0307412_101750642	151
61	3300032002	Ga0307416_100023401	Ga0307416_1000234015	151
62	3300032002	Ga0307416_100132809	Ga0307416_1001328092	151
63	3300032002	Ga0307416_100220193	Ga0307416_1002201932	151
64	3300032002	Ga0307416_101404800	Ga0307416_1014048002	151
65	3300032005	Ga0307411_10099707	Ga0307411_100997072	151
66	3300032005	Ga0307411_10100001	Ga0307411_101000012	151
67	3300032005	Ga0307411_10148071	Ga0307411_101480713	151
68	3300032126	Ga0307415_100095444	Ga0307415_1000954442	151
69	3300042008	Ga0439450_002202	Ga0439450_002202_1179_1640	151
70	3300042437	Ga0439444_0041676	Ga0439444_0041676_154_615	151
71	3300042439	Ga0439464_0004726	Ga0439464_0004726_1329_1790	151
72	3300042993	Ga0439440_0026783	Ga0439440_0026783_697_1158	151
73	3300048909	Ga0496106_0598765	Ga0496106_0598765_109_570	151
74	3300049514	Ga0501291_091573	Ga0501291_091573_110_571	151
75	3300049522	Ga0501299_035394	Ga0501299_035394_146_607	151
76	3300049660	Ga0501216_057883	Ga0501216_057883_243_704	151
77	3300049666	Ga0501228_006311	Ga0501228_006311_71_532	151
78	3300049774	Ga0501278_008031	Ga0501278_008031_58_519	151
79	3300049779	Ga0501283_071348	Ga0501283_071348_132_593	151
80	3300050507	nmdc:mga05p37_5852_c1	nmdc:mga05p37_5852_c1_13111_13572	151
81	3300050507	nmdc:mga05p37_707300_c1	nmdc:mga05p37_707300_c1_321_782	151
82	3300050507	nmdc:mga05p37_7376_c1	nmdc:mga05p37_7376_c1_8671_9132	151
83	3300050508	nmdc:mga09592_8544_c1	nmdc:mga09592_8544_c1_6064_6525	151
84	3300050509	nmdc:mga0qj67_108192_c1	nmdc:mga0qj67_108192_c1_673_1134	151
85	3300050509	nmdc:mga0qj67_115127_c1	nmdc:mga0qj67_115127_c1_278_739	151
86	3300050509	nmdc:mga0qj67_97824_c1	nmdc:mga0qj67_97824_c1_1758_2219	151
87	3300050510	nmdc:mga06r32_809087_c1	nmdc:mga06r32_809087_c1_122_583	151
88	3300050511	nmdc:mga08y16_5212_c1	nmdc:mga08y16_5212_c1_12256_12717	151
89	3300050511	nmdc:mga08y16_864756_c1	nmdc:mga08y16_864756_c1_24_485	151
90	3300050515	nmdc:mga0a205_22380_c1	nmdc:mga0a205_22380_c1_5226_5687	151
91	3300005290	Ga0065712_10109863	Ga0065712_101098632	152
92	3300005293	Ga0065715_10209276	Ga0065715_102092762	152
93	3300005295	Ga0065707_10131583	Ga0065707_101315832	152
94	3300005328	Ga0070676_10062834	Ga0070676_100628342	152
95	3300005328	Ga0070676_10072224	Ga0070676_100722243	152
96	3300005329	Ga0070683_100000214	Ga0070683_10000021427	152
97	3300005329	Ga0070683_100008011	Ga0070683_1000080115	152
98	3300005330	Ga0070690_100015534	Ga0070690_1000155342	152
99	3300005331	Ga0070670_100014483	Ga0070670_1000144835	152
100	3300005331	Ga0070670_100045920	Ga0070670_1000459202	152
101	3300005333	Ga0070677_10056885	Ga0070677_100568852	152
102	3300005334	Ga0068869_100212671	Ga0068869_1002126712	152
103	3300005334	Ga0068869_100459976	Ga0068869_1004599762	152
104	3300005335	Ga0070666_10155895	Ga0070666_101558951	152
105	3300005336	Ga0070680_100201559	Ga0070680_1002015591	152
106	3300005340	Ga0070689_100082191	Ga0070689_1000821912	152
107	3300005340	Ga0070689_101019929	Ga0070689_1010199291	152
108	3300005341	Ga0070691_10030579	Ga0070691_100305792	152
109	3300005344	Ga0070661_100018770	Ga0070661_1000187706	152
110	3300005344	Ga0070661_100096734	Ga0070661_1000967342	152
111	3300005353	Ga0070669_100015102	Ga0070669_1000151024	152
112	3300005354	Ga0070675_100031187	Ga0070675_1000311872	152
113	3300005354	Ga0070675_100502276	Ga0070675_1005022762	152
114	3300005355	Ga0070671_100062622	Ga0070671_1000626223	152
115	3300005356	Ga0070674_100396668	Ga0070674_1003966682	152
116	3300005364	Ga0070673_100176894	Ga0070673_1001768941	152
117	3300005364	Ga0070673_100683188	Ga0070673_1006831882	152
118	3300005365	Ga0070688_100231149	Ga0070688_1002311492	152
119	3300005366	Ga0070659_100318117	Ga0070659_1003181172	152
120	3300005366	Ga0070659_100676348	Ga0070659_1006763481	152
121	3300005366	Ga0070659_100787857	Ga0070659_1007878571	152
122	3300005366	Ga0070659_101027565	Ga0070659_1010275652	152
123	3300005367	Ga0070667_100068350	Ga0070667_1000683502	152
124	3300005367	Ga0070667_101280396	Ga0070667_1012803962	152
125	3300005436	Ga0070713_100201655	Ga0070713_1002016552	152
126	3300005439	Ga0070711_100071238	Ga0070711_1000712383	152
127	3300005440	Ga0070705_100215703	Ga0070705_1002157032	152
128	3300005441	Ga0070700_100012253	Ga0070700_1000122532	152
129	3300005441	Ga0070700_100082681	Ga0070700_1000826812	152
130	3300005441	Ga0070700_100700387	Ga0070700_1007003872	152
131	3300005444	Ga0070694_100323939	Ga0070694_1003239392	152
132	3300005455	Ga0070663_100011990	Ga0070663_1000119906	152
133	3300005455	Ga0070663_100156958	Ga0070663_1001569583	152
134	3300005456	Ga0070678_100356611	Ga0070678_1003566112	152
135	3300005456	Ga0070678_100365150	Ga0070678_1003651502	152
136	3300005458	Ga0070681_10421491	Ga0070681_104214912	152
137	3300005458	Ga0070681_10953732	Ga0070681_109537322	152
138	3300005459	Ga0068867_100178176	Ga0068867_1001781762	152
139	3300005459	Ga0068867_100557381	Ga0068867_1005573812	152
140	3300005467	Ga0070706_100538010	Ga0070706_1005380102	152
141	3300005467	Ga0070706_100561290	Ga0070706_1005612902	152
142	3300005471	Ga0070698_101082567	Ga0070698_1010825671	152
143	3300005518	Ga0070699_100173231	Ga0070699_1001732312	152
144	3300005530	Ga0070679_100504250	Ga0070679_1005042501	152
145	3300005530	Ga0070679_100605285	Ga0070679_1006052852	152
146	3300005535	Ga0070684_100000085	Ga0070684_10000008541	152
147	3300005535	Ga0070684_100051787	Ga0070684_1000517875	152
148	3300005543	Ga0070672_100067786	Ga0070672_1000677863	152
149	3300005543	Ga0070672_100348232	Ga0070672_1003482322	152
150	3300005543	Ga0070672_100861904	Ga0070672_1008619041	152
151	3300005545	Ga0070695_100635670	Ga0070695_1006356702	152
152	3300005546	Ga0070696_100204554	Ga0070696_1002045542	152
153	3300005547	Ga0070693_100077878	Ga0070693_1000778782	152
154	3300005549	Ga0070704_100705280	Ga0070704_1007052802	152
155	3300005563	Ga0068855_100778040	Ga0068855_1007780402	152
156	3300005564	Ga0070664_100225210	Ga0070664_1002252102	152
157	3300005564	Ga0070664_100388851	Ga0070664_1003888512	152
158	3300005564	Ga0070664_100433627	Ga0070664_1004336272	152
159	3300005564	Ga0070664_101056182	Ga0070664_1010561822	152
160	3300005577	Ga0068857_100245455	Ga0068857_1002454552	152
161	3300005577	Ga0068857_101154063	Ga0068857_1011540632	152
162	3300005577	Ga0068857_101485082	Ga0068857_1014850822	152
163	3300005578	Ga0068854_100079347	Ga0068854_1000793472	152
164	3300005578	Ga0068854_100352463	Ga0068854_1003524632	152
165	3300005578	Ga0068854_100667106	Ga0068854_1006671062	152
166	3300005615	Ga0070702_100608393	Ga0070702_1006083932	152
167	3300005616	Ga0068852_100473243	Ga0068852_1004732432	152
168	3300005617	Ga0068859_100388348	Ga0068859_1003883481	152
169	3300005617	Ga0068859_100534342	Ga0068859_1005343422	152
170	3300005618	Ga0068864_100039414	Ga0068864_1000394143	152
171	3300005618	Ga0068864_100272497	Ga0068864_1002724972	152
172	3300005618	Ga0068864_100312132	Ga0068864_1003121322	152
173	3300005618	Ga0068864_101386228	Ga0068864_1013862282	152
174	3300005719	Ga0068861_100264110	Ga0068861_1002641103	152
175	3300005719	Ga0068861_100440104	Ga0068861_1004401042	152
176	3300005834	Ga0068851_10061313	Ga0068851_100613132	152
177	3300005841	Ga0068863_100243129	Ga0068863_1002431292	152
178	3300005842	Ga0068858_100165857	Ga0068858_1001658572	152
179	3300005842	Ga0068858_100953936	Ga0068858_1009539362	152
180	3300005843	Ga0068860_100251140	Ga0068860_1002511402	152
181	3300005843	Ga0068860_100758595	Ga0068860_1007585952	152
182	3300005844	Ga0068862_100059432	Ga0068862_1000594325	152
183	3300005844	Ga0068862_100167757	Ga0068862_1001677572	152
184	3300005937	Ga0081455_10420053	Ga0081455_104200532	152
185	3300006028	Ga0070717_10036421	Ga0070717_100364214	152
186	3300006038	Ga0075365_10054007	Ga0075365_100540072	152
187	3300006038	Ga0075365_10153267	Ga0075365_101532672	152
188	3300006038	Ga0075365_10648987	Ga0075365_106489872	152
189	3300006042	Ga0075368_10019433	Ga0075368_100194332	152
190	3300006051	Ga0075364_10009962	Ga0075364_100099622	152
191	3300006051	Ga0075364_10010806	Ga0075364_100108067	152
192	3300006177	Ga0075362_10000285	Ga0075362_1000028513	152
193	3300006178	Ga0075367_10020309	Ga0075367_100203095	152
194	3300006178	Ga0075367_10035482	Ga0075367_100354822	152
195	3300006195	Ga0075366_10020438	Ga0075366_100204383	152
196	3300006195	Ga0075366_10032940	Ga0075366_100329404	152
197	3300006237	Ga0097621_100192837	Ga0097621_1001928372	152
198	3300006237	Ga0097621_100837141	Ga0097621_1008371412	152
199	3300006353	Ga0075370_10011529	Ga0075370_100115293	152
200	3300006358	Ga0068871_100748223	Ga0068871_1007482232	152
201	3300006844	Ga0075428_100000003	Ga0075428_10000000369	152
202	3300006844	Ga0075428_100006271	Ga0075428_10000627113	152
203	3300006844	Ga0075428_100014536	Ga0075428_1000145367	152
204	3300006844	Ga0075428_100202410	Ga0075428_1002024102	152
205	3300006846	Ga0075430_100004207	Ga0075430_1000042073	152
206	3300006846	Ga0075430_100030597	Ga0075430_1000305975	152
207	3300006846	Ga0075430_100072437	Ga0075430_1000724374	152
208	3300006846	Ga0075430_100201573	Ga0075430_1002015732	152
209	3300006846	Ga0075430_101135934	Ga0075430_1011359342	152
210	3300006847	Ga0075431_100002553	Ga0075431_1000025532	152
211	3300006847	Ga0075431_100017923	Ga0075431_1000179231	152
212	3300006847	Ga0075431_100035192	Ga0075431_1000351923	152
213	3300006847	Ga0075431_100035389	Ga0075431_1000353894	152
214	3300006847	Ga0075431_100358864	Ga0075431_1003588642	152
215	3300006847	Ga0075431_100472989	Ga0075431_1004729892	152
216	3300006847	Ga0075431_100613222	Ga0075431_1006132222	152
217	3300006847	Ga0075431_101574552	Ga0075431_1015745521	152
218	3300006852	Ga0075433_10029166	Ga0075433_100291665	152
219	3300006852	Ga0075433_10485562	Ga0075433_104855622	152
220	3300006871	Ga0075434_100025348	Ga0075434_1000253485	152
221	3300006871	Ga0075434_100149331	Ga0075434_1001493312	152
222	3300006871	Ga0075434_100170087	Ga0075434_1001700873	152
223	3300006871	Ga0075434_100777722	Ga0075434_1007777222	152
224	3300006871	Ga0075434_101104213	Ga0075434_1011042132	152
225	3300006880	Ga0075429_100034928	Ga0075429_1000349284	152
226	3300006880	Ga0075429_100092422	Ga0075429_1000924223	152
227	3300006880	Ga0075429_100350077	Ga0075429_1003500772	152
228	3300006880	Ga0075429_100416873	Ga0075429_1004168732	152
229	3300006881	Ga0068865_100384176	Ga0068865_1003841762	152
230	3300006881	Ga0068865_100558892	Ga0068865_1005588922	152
231	3300006931	Ga0097620_100388354	Ga0097620_1003883541	152
232	3300006931	Ga0097620_100534316	Ga0097620_1005343162	152
233	3300007076	Ga0075435_100006103	Ga0075435_1000061034	152
234	3300007076	Ga0075435_100017781	Ga0075435_1000177812	152
235	3300007076	Ga0075435_100189380	Ga0075435_1001893802	152
236	3300007076	Ga0075435_101384770	Ga0075435_1013847701	152
237	3300009093	Ga0105240_10227694	Ga0105240_102276942	152
238	3300009093	Ga0105240_10304122	Ga0105240_103041221	152
239	3300009094	Ga0111539_10000001	Ga0111539_10000001328	152
240	3300009094	Ga0111539_10002570	Ga0111539_100025705	152
241	3300009094	Ga0111539_10107679	Ga0111539_101076794	152
242	3300009094	Ga0111539_10496669	Ga0111539_104966692	152
243	3300009094	Ga0111539_10864814	Ga0111539_108648142	152
244	3300009094	Ga0111539_11249262	Ga0111539_112492622	152
245	3300009098	Ga0105245_10096137	Ga0105245_100961374	152
246	3300009147	Ga0114129_10002632	Ga0114129_1000263215	152
247	3300009147	Ga0114129_10004917	Ga0114129_1000491715	152
248	3300009147	Ga0114129_10006827	Ga0114129_1000682718	152
249	3300009147	Ga0114129_10035915	Ga0114129_100359156	152
250	3300009147	Ga0114129_12044733	Ga0114129_120447332	152
251	3300009148	Ga0105243_10250865	Ga0105243_102508652	152
252	3300009148	Ga0105243_10360263	Ga0105243_103602632	152
253	3300009176	Ga0105242_11833303	Ga0105242_118333032	152
254	3300009177	Ga0105248_10064510	Ga0105248_100645105	152
255	3300009177	Ga0105248_10077895	Ga0105248_100778952	152
256	3300009177	Ga0105248_10152055	Ga0105248_101520551	152
257	3300009545	Ga0105237_10403348	Ga0105237_104033482	152
258	3300009551	Ga0105238_10447377	Ga0105238_104473772	152
259	3300009553	Ga0105249_10030131	Ga0105249_100301315	152
260	3300009553	Ga0105249_10369676	Ga0105249_103696761	152
261	3300010375	Ga0105239_10278566	Ga0105239_102785662	152
262	3300010375	Ga0105239_10738509	Ga0105239_107385092	152
263	3300010375	Ga0105239_11402716	Ga0105239_114027162	152
264	3300011119	Ga0105246_10342307	Ga0105246_103423072	152
265	3300012507	Ga0157342_1031098	Ga0157342_10310981	152
266	3300013104	Ga0157370_10698765	Ga0157370_106987652	152
267	3300013296	Ga0157374_10029401	Ga0157374_100294013	152
268	3300013297	Ga0157378_10921685	Ga0157378_109216852	152
269	3300013297	Ga0157378_11135591	Ga0157378_111355912	152
270	3300013306	Ga0163162_10106689	Ga0163162_101066892	152
271	3300013307	Ga0157372_10080485	Ga0157372_100804854	152
272	3300013307	Ga0157372_10157301	Ga0157372_101573012	152
273	3300013308	Ga0157375_11063759	Ga0157375_110637591	152
274	3300013308	Ga0157375_11365465	Ga0157375_113654652	152
275	3300014326	Ga0157380_10085156	Ga0157380_100851563	152
276	3300014326	Ga0157380_10579084	Ga0157380_105790842	152
277	3300014745	Ga0157377_10078436	Ga0157377_100784362	152
278	3300014968	Ga0157379_10797633	Ga0157379_107976332	152
279	3300014969	Ga0157376_10694273	Ga0157376_106942732	152
280	3300017792	Ga0163161_11209011	Ga0163161_112090112	152
281	3300025315	Ga0207697_10072472	Ga0207697_100724722	152
282	3300025321	Ga0207656_10063400	Ga0207656_100634003	152
283	3300025893	Ga0207682_10101929	Ga0207682_101019292	152
284	3300025901	Ga0207688_10090747	Ga0207688_100907472	152
285	3300025906	Ga0207699_10042968	Ga0207699_100429682	152
286	3300025907	Ga0207645_10120680	Ga0207645_101206802	152
287	3300025910	Ga0207684_10112534	Ga0207684_101125342	152
288	3300025912	Ga0207707_10994913	Ga0207707_109949132	152
289	3300025912	Ga0207707_11444974	Ga0207707_114449741	152
290	3300025913	Ga0207695_10397298	Ga0207695_103972982	152
291	3300025916	Ga0207663_10573519	Ga0207663_105735192	152
292	3300025918	Ga0207662_10003082	Ga0207662_100030827	152
293	3300025918	Ga0207662_10359200	Ga0207662_103592002	152
294	3300025920	Ga0207649_10230944	Ga0207649_102309442	152
295	3300025921	Ga0207652_10187544	Ga0207652_101875441	152
296	3300025922	Ga0207646_10099436	Ga0207646_100994363	152
297	3300025923	Ga0207681_10051433	Ga0207681_100514335	152
298	3300025923	Ga0207681_10113429	Ga0207681_101134292	152
299	3300025925	Ga0207650_10000805	Ga0207650_1000080522	152
300	3300025925	Ga0207650_10056861	Ga0207650_100568612	152
301	3300025926	Ga0207659_10113307	Ga0207659_101133072	152
302	3300025926	Ga0207659_10180468	Ga0207659_101804682	152
303	3300025926	Ga0207659_10880854	Ga0207659_108808542	152
304	3300025928	Ga0207700_10208829	Ga0207700_102088292	152
305	3300025931	Ga0207644_10210125	Ga0207644_102101252	152
306	3300025933	Ga0207706_11417715	Ga0207706_114177151	152
307	3300025936	Ga0207670_10051068	Ga0207670_100510682	152
308	3300025936	Ga0207670_10324214	Ga0207670_103242142	152
309	3300025937	Ga0207669_10205614	Ga0207669_102056142	152
310	3300025937	Ga0207669_11651347	Ga0207669_116513471	152
311	3300025938	Ga0207704_10471138	Ga0207704_104711382	152
312	3300025940	Ga0207691_10006590	Ga0207691_1000659010	152
313	3300025940	Ga0207691_10279144	Ga0207691_102791442	152
314	3300025940	Ga0207691_10708419	Ga0207691_107084192	152
315	3300025941	Ga0207711_10015562	Ga0207711_100155622	152
316	3300025941	Ga0207711_10123532	Ga0207711_101235322	152
317	3300025941	Ga0207711_10127610	Ga0207711_101276102	152
318	3300025942	Ga0207689_10074280	Ga0207689_100742802	152
319	3300025942	Ga0207689_10471940	Ga0207689_104719401	152
320	3300025944	Ga0207661_10006203	Ga0207661_100062037	152
321	3300025944	Ga0207661_10023647	Ga0207661_100236474	152
322	3300025945	Ga0207679_10413174	Ga0207679_104131742	152
323	3300025945	Ga0207679_10414441	Ga0207679_104144412	152
324	3300025945	Ga0207679_10714269	Ga0207679_107142692	152
325	3300025949	Ga0207667_11025975	Ga0207667_110259752	152
326	3300025960	Ga0207651_10124663	Ga0207651_101246632	152
327	3300025961	Ga0207712_10035537	Ga0207712_100355372	152
328	3300025961	Ga0207712_10995818	Ga0207712_109958182	152
329	3300025972	Ga0207668_10745623	Ga0207668_107456232	152
330	3300025981	Ga0207640_10103938	Ga0207640_101039382	152
331	3300026035	Ga0207703_10295940	Ga0207703_102959402	152
332	3300026067	Ga0207678_10099190	Ga0207678_100991902	152
333	3300026075	Ga0207708_10083908	Ga0207708_100839083	152
334	3300026075	Ga0207708_10382210	Ga0207708_103822102	152
335	3300026088	Ga0207641_10128397	Ga0207641_101283972	152
336	3300026089	Ga0207648_10045332	Ga0207648_100453323	152
337	3300026089	Ga0207648_10333609	Ga0207648_103336092	152
338	3300026095	Ga0207676_10107150	Ga0207676_101071503	152
339	3300026116	Ga0207674_10022018	Ga0207674_100220185	152
340	3300026118	Ga0207675_100510117	Ga0207675_1005101172	152
341	3300026118	Ga0207675_100578485	Ga0207675_1005784852	152
342	3300026121	Ga0207683_10109573	Ga0207683_101095732	152
343	3300026121	Ga0207683_10381914	Ga0207683_103819142	152
344	3300027866	Ga0209813_10067800	Ga0209813_100678002	152
345	3300027866	Ga0209813_10094875	Ga0209813_100948752	152
346	3300027907	Ga0207428_10000002	Ga0207428_10000002340	152
347	3300027907	Ga0207428_10048420	Ga0207428_100484205	152
348	3300028380	Ga0268265_10533423	Ga0268265_105334232	152
349	3300028380	Ga0268265_10734281	Ga0268265_107342811	152
350	3300028381	Ga0268264_10505449	Ga0268264_105054492	152
351	3300031548	Ga0307408_100043248	Ga0307408_1000432482	152
352	3300031548	Ga0307408_100115522	Ga0307408_1001155222	152
353	3300031548	Ga0307408_100148381	Ga0307408_1001483812	152
354	3300031548	Ga0307408_100554354	Ga0307408_1005543542	152
355	3300031731	Ga0307405_10127746	Ga0307405_101277463	152
356	3300031731	Ga0307405_10676019	Ga0307405_106760192	152
357	3300031824	Ga0307413_10053786	Ga0307413_100537863	152
358	3300031824	Ga0307413_10535406	Ga0307413_105354062	152
359	3300031824	Ga0307413_10761728	Ga0307413_107617282	152
360	3300031852	Ga0307410_11417452	Ga0307410_114174522	152
361	3300031901	Ga0307406_10651535	Ga0307406_106515352	152
362	3300031903	Ga0307407_10063854	Ga0307407_100638542	152
363	3300031903	Ga0307407_10136064	Ga0307407_101360642	152
364	3300031903	Ga0307407_10725994	Ga0307407_107259942	152
365	3300031911	Ga0307412_10586028	Ga0307412_105860282	152
366	3300031995	Ga0307409_100464228	Ga0307409_1004642282	152
367	3300031995	Ga0307409_100486571	Ga0307409_1004865712	152
368	3300032002	Ga0307416_100085556	Ga0307416_1000855562	152
369	3300032002	Ga0307416_100086912	Ga0307416_1000869123	152
370	3300032002	Ga0307416_100637734	Ga0307416_1006377342	152
371	3300032002	Ga0307416_100857676	Ga0307416_1008576762	152
372	3300032002	Ga0307416_102844663	Ga0307416_1028446632	152
373	3300032004	Ga0307414_10239575	Ga0307414_102395752	152
374	3300032005	Ga0307411_10114354	Ga0307411_101143543	152
375	3300032005	Ga0307411_11014916	Ga0307411_110149161	152
376	3300032126	Ga0307415_100088501	Ga0307415_1000885012	152
377	3300032126	Ga0307415_100348211	Ga0307415_1003482111	152
378	3300035091	Ga0373951_0198473	Ga0373951_0198473_82_546	152
379	3300035120	Ga0373957_0373087	Ga0373957_0373087_10_474	152
380	3300035172	Ga0373955_0069829	Ga0373955_0069829_287_751	152
381	3300035410	Ga0373924_0115942	Ga0373924_0115942_442_906	152
382	3300035691	Ga0373931_0151298	Ga0373931_0151298_421_885	152
383	3300035692	Ga0373935_0636609	Ga0373935_0636609_67_531	152
384	3300035692	Ga0373935_1083714	Ga0373935_1083714_25_489	152
385	3300035724	Ga0373933_0002856	Ga0373933_0002856_9045_9509	152
386	3300035725	Ga0373947_0015999	Ga0373947_0015999_358_822	152
387	3300036401	Ga0373937_0109927	Ga0373937_0109927_360_824	152
388	3300036401	Ga0373937_0496139	Ga0373937_0496139_297_755	152
389	3300036401	Ga0373937_1042215	Ga0373937_1042215_166_630	152
390	3300037068	Ga0373925_0160613	Ga0373925_0160613_134_598	152
391	3300037068	Ga0373925_0481555	Ga0373925_0481555_443_907	152
392	3300037068	Ga0373925_0710054	Ga0373925_0710054_44_502	152
393	3300037471	Ga0395905_1096673	Ga0395905_1096673_68_532	152
394	3300041406	Ga0439439_0129889	Ga0439439_0129889_127_591	152
395	3300041486	Ga0451807_1789922	Ga0451807_1789922_193_657	152
396	3300041512	Ga0451853_1731505	Ga0451853_1731505_167_631	152
397	3300041999	Ga0439433_0045425	Ga0439433_0045425_350_814	152
398	3300041999	Ga0439433_0086016	Ga0439433_0086016_230_694	152
399	3300042007	Ga0439449_0075254	Ga0439449_0075254_391_855	152
400	3300042007	Ga0439449_0179303	Ga0439449_0179303_49_516	152
401	3300042125	Ga0450923_009025	Ga0450923_009025_171_635	152
402	3300042435	Ga0439434_0146095	Ga0439434_0146095_212_676	152
403	3300042436	Ga0439435_0016689	Ga0439435_0016689_387_851	152
404	3300042436	Ga0439435_0076839	Ga0439435_0076839_193_657	152
405	3300042461	Ga0439460_0231194	Ga0439460_0231194_87_551	152
406	3300042876	Ga0451577_0729093	Ga0451577_0729093_311_775	152
407	3300045051	Ga0451576_1896307	Ga0451576_1896307_50_514	152
408	3300046454	Ga0495592_0169300	Ga0495592_0169300_493_951	152
409	3300046455	Ga0495603_0033007	Ga0495603_0033007_721_1185	152
410	3300046459	Ga0495629_0688650	Ga0495629_0688650_74_538	152
411	3300046473	Ga0495582_0574386	Ga0495582_0574386_163_627	152
412	3300046511	Ga0495608_0128006	Ga0495608_0128006_85_549	152
413	3300046517	Ga0495630_0313270	Ga0495630_0313270_393_857	152
414	3300046517	Ga0495630_0945115	Ga0495630_0945115_38_496	152
415	3300046663	Ga0495635_0689917	Ga0495635_0689917_135_599	152
416	3300046681	Ga0495647_0210406	Ga0495647_0210406_340_804	152
417	3300046689	Ga0495613_1071093	Ga0495613_1071093_25_483	152
418	3300046809	Ga0495600_0122772	Ga0495600_0122772_1104_1568	152
419	3300047471	Ga0495684_0273487	Ga0495684_0273487_725_1183	152
420	3300047471	Ga0495684_0391336	Ga0495684_0391336_322_786	152
421	3300047471	Ga0495684_0678619	Ga0495684_0678619_130_594	152
422	3300048903	Ga0496100_1295935	Ga0496100_1295935_65_529	152
423	3300048904	Ga0496101_0038113	Ga0496101_0038113_617_1081	152
424	3300048904	Ga0496101_0089666	Ga0496101_0089666_1773_2237	152
425	3300048905	Ga0496102_0015215	Ga0496102_0015215_4461_4925	152
426	3300048907	Ga0496104_0154473	Ga0496104_0154473_1513_1977	152
427	3300048907	Ga0496104_0570843	Ga0496104_0570843_240_704	152
428	3300048908	Ga0496105_1206432	Ga0496105_1206432_62_526	152
429	3300048909	Ga0496106_0036771	Ga0496106_0036771_920_1384	152
430	3300048909	Ga0496106_0488616	Ga0496106_0488616_352_816	152
431	3300048910	Ga0496107_0816088	Ga0496107_0816088_32_496	152
432	3300048915	Ga0496112_0184471	Ga0496112_0184471_507_971	152
433	3300048915	Ga0496112_0189217	Ga0496112_0189217_1298_1762	152
434	3300048916	Ga0496113_0201124	Ga0496113_0201124_1093_1557	152
435	3300048916	Ga0496113_0238870	Ga0496113_0238870_662_1126	152
436	3300048917	Ga0496114_0315232	Ga0496114_0315232_141_605	152
437	3300049568	Ga0501031_0544437	Ga0501031_0544437_40_504	152
438	3300049568	Ga0501031_0732457	Ga0501031_0732457_127_591	152
439	3300049571	Ga0501034_0019449	Ga0501034_0019449_2539_3003	152
440	3300049571	Ga0501034_0138407	Ga0501034_0138407_896_1360	152
441	3300049572	Ga0501036_0047225	Ga0501036_0047225_102_566	152
442	3300049572	Ga0501036_0196922	Ga0501036_0196922_1191_1655	152
443	3300049574	Ga0501038_0092326	Ga0501038_0092326_1092_1556	152
444	3300049575	Ga0501039_0368073	Ga0501039_0368073_413_877	152
445	3300049575	Ga0501039_0368486	Ga0501039_0368486_267_731	152
446	3300049575	Ga0501039_1065823	Ga0501039_1065823_31_495	152
447	3300049576	Ga0501040_0028955	Ga0501040_0028955_1065_1529	152
448	3300049576	Ga0501040_0070820	Ga0501040_0070820_318_782	152
449	3300049576	Ga0501040_0396264	Ga0501040_0396264_336_800	152
450	3300049577	Ga0501041_0029418	Ga0501041_0029418_2487_2951	152
451	3300049577	Ga0501041_0069370	Ga0501041_0069370_1078_1542	152
452	3300049577	Ga0501041_0189686	Ga0501041_0189686_351_815	152
453	3300049577	Ga0501041_1016656	Ga0501041_1016656_40_507	152
454	3300049578	Ga0501042_0245718	Ga0501042_0245718_501_965	152
455	3300049579	Ga0501043_0101544	Ga0501043_0101544_1193_1657	152
456	3300049579	Ga0501043_0315390	Ga0501043_0315390_261_725	152
457	3300049580	Ga0501046_0376280	Ga0501046_0376280_403_867	152
458	3300049580	Ga0501046_0470453	Ga0501046_0470453_309_773	152
459	3300049582	Ga0501048_0051905	Ga0501048_0051905_2421_2885	152
460	3300049582	Ga0501048_0063885	Ga0501048_0063885_1136_1600	152
461	3300049582	Ga0501048_0697561	Ga0501048_0697561_195_662	152
462	3300049583	Ga0501067_0267971	Ga0501067_0267971_409_873	152
463	3300049586	Ga0501070_0864536	Ga0501070_0864536_61_534	152
464	3300049587	Ga0501071_0021505	Ga0501071_0021505_1768_2232	152
465	3300049587	Ga0501071_0094684	Ga0501071_0094684_855_1319	152
466	3300049587	Ga0501071_0124476	Ga0501071_0124476_62_526	152
467	3300049587	Ga0501071_0128303	Ga0501071_0128303_837_1310	152
468	3300049587	Ga0501071_0152067	Ga0501071_0152067_667_1131	152
469	3300049587	Ga0501071_0395910	Ga0501071_0395910_75_563	152
470	3300049588	Ga0501072_0050641	Ga0501072_0050641_1824_2288	152
471	3300049588	Ga0501072_0347746	Ga0501072_0347746_31_495	152
472	3300049588	Ga0501072_0530266	Ga0501072_0530266_243_731	152
473	3300049589	Ga0501073_0269312	Ga0501073_0269312_421_894	152
474	3300049590	Ga0501074_0103741	Ga0501074_0103741_1114_1578	152
475	3300049590	Ga0501074_0291953	Ga0501074_0291953_651_1115	152
476	3300049591	Ga0501075_0010047	Ga0501075_0010047_5231_5695	152
477	3300049591	Ga0501075_0061057	Ga0501075_0061057_441_905	152
478	3300049591	Ga0501075_0224092	Ga0501075_0224092_493_957	152
479	3300049591	Ga0501075_0510996	Ga0501075_0510996_138_611	152
480	3300049591	Ga0501075_0598486	Ga0501075_0598486_166_630	152
481	3300049591	Ga0501075_0726733	Ga0501075_0726733_217_681	152
482	3300049592	Ga0501076_0075405	Ga0501076_0075405_135_599	152
483	3300049592	Ga0501076_0309015	Ga0501076_0309015_588_1052	152
484	3300049592	Ga0501076_0583276	Ga0501076_0583276_261_749	152
485	3300049592	Ga0501076_1004028	Ga0501076_1004028_48_521	152
486	3300049593	Ga0501077_0235879	Ga0501077_0235879_629_1093	152
487	3300049652	Ga0501202_039651	Ga0501202_039651_345_812	152
488	3300049679	Ga0501249_093925	Ga0501249_093925_36_503	152
489	3300049741	Ga0501079_0082664	Ga0501079_0082664_1322_1786	152
490	3300049741	Ga0501079_0088137	Ga0501079_0088137_1021_1485	152
491	3300049741	Ga0501079_0463983	Ga0501079_0463983_433_897	152
492	3300049742	Ga0501080_0066325	Ga0501080_0066325_802_1266	152
493	3300049742	Ga0501080_0146349	Ga0501080_0146349_995_1459	152
494	3300049742	Ga0501080_0151681	Ga0501080_0151681_1263_1727	152
495	3300049743	Ga0501081_0065646	Ga0501081_0065646_1278_1742	152
496	3300049743	Ga0501081_0101465	Ga0501081_0101465_67_531	152
497	3300049743	Ga0501081_0234247	Ga0501081_0234247_586_1050	152
498	3300049743	Ga0501081_0816886	Ga0501081_0816886_131_604	152
499	3300049744	Ga0501083_0442297	Ga0501083_0442297_76_540	152
500	3300049823	Ga0501044_0839984	Ga0501044_0839984_277_741	152
501	3300049824	Ga0501045_0007379	Ga0501045_0007379_3846_4310	152
502	3300049824	Ga0501045_0017491	Ga0501045_0017491_2770_3234	152
503	3300049824	Ga0501045_0054905	Ga0501045_0054905_1120_1584	152
504	3300049824	Ga0501045_0067639	Ga0501045_0067639_633_1100	152
505	3300049824	Ga0501045_0117394	Ga0501045_0117394_401_865	152
506	3300049824	Ga0501045_0256010	Ga0501045_0256010_376_864	152
507	3300050489	nmdc:mga03683_1413_c1	nmdc:mga03683_1413_c1_4121_4585	152
508	3300050490	nmdc:mga03n38_132944_c1	nmdc:mga03n38_132944_c1_459_923	152
509	3300050491	nmdc:mga00v17_11261_c1	nmdc:mga00v17_11261_c1_1926_2390	152
510	3300050491	nmdc:mga00v17_200518_c1	nmdc:mga00v17_200518_c1_655_1119	152
511	3300050491	nmdc:mga00v17_844016_c1	nmdc:mga00v17_844016_c1_76_540	152
512	3300050492	nmdc:mga0yw44_134231_c1	nmdc:mga0yw44_134231_c1_130_594	152
513	3300050492	nmdc:mga0yw44_56649_c1	nmdc:mga0yw44_56649_c1_348_812	152
514	3300050493	nmdc:mga0k408_12801_c1	nmdc:mga0k408_12801_c1_200_664	152
515	3300050493	nmdc:mga0k408_17356_c1	nmdc:mga0k408_17356_c1_2735_3199	152
516	3300050494	nmdc:mga06z11_190241_c1	nmdc:mga06z11_190241_c1_643_1107	152
517	3300050494	nmdc:mga06z11_21063_c1	nmdc:mga06z11_21063_c1_558_1022	152
518	3300050494	nmdc:mga06z11_335862_c1	nmdc:mga06z11_335862_c1_180_644	152
519	3300050495	nmdc:mga04h51_112662_c1	nmdc:mga04h51_112662_c1_74_538	152
520	3300050495	nmdc:mga04h51_66477_c1	nmdc:mga04h51_66477_c1_298_762	152
521	3300050496	nmdc:mga07m45_205779_c1	nmdc:mga07m45_205779_c1_341_805	152
522	3300050507	nmdc:mga05p37_1437207_c1	nmdc:mga05p37_1437207_c1_94_558	152
523	3300050507	nmdc:mga05p37_33982_c1	nmdc:mga05p37_33982_c1_4631_5095	152
524	3300050507	nmdc:mga05p37_4611_c1	nmdc:mga05p37_4611_c1_9915_10379	152
525	3300050507	nmdc:mga05p37_567112_c1	nmdc:mga05p37_567112_c1_208_672	152
526	3300050507	nmdc:mga05p37_9359_c1	nmdc:mga05p37_9359_c1_8226_8690	152
527	3300050508	nmdc:mga09592_1080369_c1	nmdc:mga09592_1080369_c1_51_515	152
528	3300050508	nmdc:mga09592_254850_c1	nmdc:mga09592_254850_c1_807_1271	152
529	3300050508	nmdc:mga09592_37036_c1	nmdc:mga09592_37036_c1_1863_2327	152
530	3300050508	nmdc:mga09592_459585_c1	nmdc:mga09592_459585_c1_392_856	152
531	3300050509	nmdc:mga0qj67_122521_c1	nmdc:mga0qj67_122521_c1_787_1251	152
532	3300050509	nmdc:mga0qj67_213806_c1	nmdc:mga0qj67_213806_c1_1023_1487	152
533	3300050509	nmdc:mga0qj67_25887_c1	nmdc:mga0qj67_25887_c1_3537_4001	152
534	3300050509	nmdc:mga0qj67_345273_c1	nmdc:mga0qj67_345273_c1_388_852	152
535	3300050509	nmdc:mga0qj67_421146_c1	nmdc:mga0qj67_421146_c1_308_772	152
536	3300050509	nmdc:mga0qj67_64328_c1	nmdc:mga0qj67_64328_c1_2093_2557	152
537	3300050510	nmdc:mga06r32_1496597_c1	nmdc:mga06r32_1496597_c1_32_496	152
538	3300050510	nmdc:mga06r32_193251_c1	nmdc:mga06r32_193251_c1_1133_1597	152
539	3300050510	nmdc:mga06r32_332687_c1	nmdc:mga06r32_332687_c1_495_959	152
540	3300050510	nmdc:mga06r32_566569_c1	nmdc:mga06r32_566569_c1_319_783	152
541	3300050510	nmdc:mga06r32_60642_c1	nmdc:mga06r32_60642_c1_544_1008	152
542	3300050510	nmdc:mga06r32_62404_c1	nmdc:mga06r32_62404_c1_2047_2511	152
543	3300050510	nmdc:mga06r32_81001_c1	nmdc:mga06r32_81001_c1_665_1129	152
544	3300050510	nmdc:mga06r32_842525_c1	nmdc:mga06r32_842525_c1_104_568	152
545	3300050511	nmdc:mga08y16_22861_c1	nmdc:mga08y16_22861_c1_4751_5215	152
546	3300050511	nmdc:mga08y16_282733_c1	nmdc:mga08y16_282733_c1_466_924	152
547	3300050511	nmdc:mga08y16_3_c1	nmdc:mga08y16_3_c1_354551_355015	152
548	3300050511	nmdc:mga08y16_405654_c1	nmdc:mga08y16_405654_c1_138_626	152
549	3300050511	nmdc:mga08y16_695385_c1	nmdc:mga08y16_695385_c1_83_547	152
550	3300050512	nmdc:mga0n895_104321_c1	nmdc:mga0n895_104321_c1_1341_1805	152
551	3300050512	nmdc:mga0n895_1104614_c1	nmdc:mga0n895_1104614_c1_141_599	152
552	3300050512	nmdc:mga0n895_164746_c1	nmdc:mga0n895_164746_c1_471_935	152
553	3300050512	nmdc:mga0n895_266890_c1	nmdc:mga0n895_266890_c1_684_1148	152
554	3300050512	nmdc:mga0n895_45944_c1	nmdc:mga0n895_45944_c1_488_952	152
555	3300050512	nmdc:mga0n895_647159_c1	nmdc:mga0n895_647159_c1_404_868	152
556	3300050512	nmdc:mga0n895_94505_c1	nmdc:mga0n895_94505_c1_2385_2849	152
557	3300050513	nmdc:mga0rr50_57180_c1	nmdc:mga0rr50_57180_c1_1126_1590	152
558	3300050513	nmdc:mga0rr50_72621_c1	nmdc:mga0rr50_72621_c1_183_647	152
559	3300050513	nmdc:mga0rr50_887273_c1	nmdc:mga0rr50_887273_c1_94_558	152
560	3300050515	nmdc:mga0a205_170819_c1	nmdc:mga0a205_170819_c1_737_1201	152
561	3300050515	nmdc:mga0a205_8813_c1	nmdc:mga0a205_8813_c1_4304_4768	152
562	3300053077	Ga0495601_0547532	Ga0495601_0547532_28_492	152
563	3300053129	Ga0500628_009475	Ga0500628_009475_551_1015	152
564	3300054114	Ga0501084_0039752	Ga0501084_0039752_1347_1811	152
565	3300054114	Ga0501084_0056841	Ga0501084_0056841_2219_2683	152
566	3300054114	Ga0501084_0233273	Ga0501084_0233273_808_1272	152
567	3300054114	Ga0501084_0274370	Ga0501084_0274370_631_1104	152
568	3300054114	Ga0501084_1460849	Ga0501084_1460849_55_522	152
569	3300059421	Ga0590071_000399	Ga0590071_000399_2804_3268	152
570	3300059424	Ga0590075_000116	Ga0590075_000116_6512_6976	152
571	3300059426	Ga0590077_000069	Ga0590077_000069_1140_1604	152
572	3300060353	Ga0501082_0112351	Ga0501082_0112351_1797_2270	152
573	3300060353	Ga0501082_0113043	Ga0501082_0113043_1149_1613	152
574	3300060353	Ga0501082_0214347	Ga0501082_0214347_830_1294	152
575	3300061734	Ga0530510_0013148	Ga0530510_0013148_4747_5211	152
576	3300061734	Ga0530510_0748500	Ga0530510_0748500_238_702	152
577	3300005290	Ga0065712_10107179	Ga0065712_101071792	153
578	3300005340	Ga0070689_100073883	Ga0070689_1000738833	153
579	3300005353	Ga0070669_100149169	Ga0070669_1001491692	153
580	3300005354	Ga0070675_100282542	Ga0070675_1002825422	153
581	3300005438	Ga0070701_10072175	Ga0070701_100721752	153
582	3300005549	Ga0070704_100096470	Ga0070704_1000964702	153
583	3300005577	Ga0068857_100402908	Ga0068857_1004029082	153
584	3300005719	Ga0068861_100617769	Ga0068861_1006177692	153
585	3300006871	Ga0075434_100045799	Ga0075434_1000457992	153
586	3300009094	Ga0111539_10024150	Ga0111539_100241507	153
587	3300009098	Ga0105245_10399444	Ga0105245_103994442	153
588	3300009553	Ga0105249_10442783	Ga0105249_104427832	153
589	3300009553	Ga0105249_10482949	Ga0105249_104829492	153
590	3300025926	Ga0207659_10281973	Ga0207659_102819732	153
591	3300025927	Ga0207687_10343112	Ga0207687_103431122	153
592	3300026116	Ga0207674_10583410	Ga0207674_105834102	153
593	3300026118	Ga0207675_100360939	Ga0207675_1003609392	153
594	3300028380	Ga0268265_10299594	Ga0268265_102995942	153
595	3300028381	Ga0268264_10210294	Ga0268264_102102942	153
596	3300049571	Ga0501034_0012586	Ga0501034_0012586_800_1264	153
597	3300050511	nmdc:mga08y16_20285_c1	nmdc:mga08y16_20285_c1_754_1218	153
598	3300050512	nmdc:mga0n895_429561_c1	nmdc:mga0n895_429561_c1_712_1176	153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04608

PgpA

Phosphatidylglycerophosphatase A

7

150

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5aex-assembly3.cif.gz_I	crystal structure of saccharomyces cerevisiae mep2	0.4609	37	141
6ejh-assembly1.cif.gz_A	crystal structure of the g343c mutant of candida albicans mep2	0.4605	36	140
6ids-assembly1.cif.gz_A	crystal structure of vibrio cholerae mate transporter vcmn d35n mutant	0.4453	37	148
8sdz-assembly1.cif.gz_A	structure of rat organic anion transporter 1 (oat1) in complex with probenecid	0.3957	19	143
1rfz-assembly1.cif.gz_C	structure of protein of unknown function from bacillus stearothermophilus	0.3942	1	146

ID	Description	Score	Start	End	Superfamily
af_Q58726_1_127_1.10.3760.10	Mainly Alpha;Orthogonal Bundle;YutG-like;PgpA-like	0.5932	26	143	1.10.3760.10
af_Q58726_1_127_1.10.3760.10	Mainly Alpha;Orthogonal Bundle;YutG-like;PgpA-like	0.5128	26	143	1.10.3760.10
af_Q10153_10_168_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.432	15	142	1.20.120.1760
af_Q58713_262_398_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.4222	22	145	1.20.1250.20
af_P37746_280_415_1.20.1070.10	Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins	0.4208	26	149	1.20.1070.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1E3YQZ0-F1-model_v4	YutG/PgpA domain-containing protein	0.995	1	148	GO:0006629 GO:0008962 GO:0016020
AF-A0A2W4S2Q0-F1-model_v4	Phosphatidylglycerophosphatase A	0.9925	1	148	GO:0006629 GO:0008962 GO:0016020
AF-A0A1F2R5Q0-F1-model_v4	YutG/PgpA domain-containing protein	0.9843	7	148	GO:0006629 GO:0008962 GO:0016020
AF-A0A7W1SH13-F1-model_v4	Phosphatidylglycerophosphatase A	0.9836	1	136	GO:0006629 GO:0008962 GO:0016020
AF-A0A1F9I8L0-F1-model_v4	YutG/PgpA domain-containing protein	0.9812	2	151	GO:0006655 GO:0008962 GO:0016020

Feature Viewer

pLDDT	pTM	Quality
93.86	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F467771

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04608

PgpA

Phosphatidylglycerophosphatase A

7

150

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map