F467784
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 598 | 241 | 1196 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10019527|Ga0157369_100195275 |
| Length | 317 |
| Sequence | MIPHIHRVECFGTGIANEIAESAAAERPVRIGPGMNRRLATVLFSAFVVAALCSYLVYRVIGNRLGMMQPKATQVIVAATDIKLGSVLRDVDLTTAEFVGSLPKEAILKKQDAIGRGVVSNLYQGEPVLDSRLAAVGSGGGLAATIRQGMRACAVKVDEVVGVAGFVTPGMRVDVLISGNPPGPINVAEGQKVKTLFQNVEVLSAGTDIQKDGEGKPKSVQVVNLLVTPEQAEMLSLASTQTHIQLVLRNPLDTEVAQVPGSALMNLYTDPNAKRALKPLAAPRRVTHSVPQSQLYLVEVFNGSKRSEEKFVTAEGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 76 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 77 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 78 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 127 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 136 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 138 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 143 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 153 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 154 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 155 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 207 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 215 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 240 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.16 |
| Metatranscriptomes | 0.84 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 2.17 |
| Rhizosphere | 93.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157369_10019527 | 3300013105 | Bacteria | 7584 |
| 2 | Ga0070658_10019622 | 3300005327 | Bacteria | 5412 |
| 3 | Ga0070658_10039888 | 3300005327 | Unclassified | 3788 |
| 4 | Ga0070658_10045940 | 3300005327 | Unclassified | 3533 |
| 5 | Ga0070658_10096997 | 3300005327 | Bacteria | 2434 |
| 6 | Ga0070658_10112987 | 3300005327 | Bacteria | 2252 |
| 7 | Ga0070658_10212442 | 3300005327 | Unclassified | 1635 |
| 8 | Ga0070658_10272018 | 3300005327 | Bacteria | 1441 |
| 9 | Ga0070683_100005597 | 3300005329 | Bacteria | 10494 |
| 10 | Ga0070683_100029641 | 3300005329 | Unclassified | 4958 |
| 11 | Ga0070683_100039974 | 3300005329 | Bacteria | 4309 |
| 12 | Ga0070666_10066592 | 3300005335 | Bacteria | 2444 |
| 13 | Ga0070666_10402405 | 3300005335 | Unclassified | 984 |
| 14 | Ga0070680_100010431 | 3300005336 | Bacteria | 7164 |
| 15 | Ga0070680_100019766 | 3300005336 | Bacteria | 5340 |
| 16 | Ga0070680_100038657 | 3300005336 | Unclassified | 3860 |
| 17 | Ga0068868_100025061 | 3300005338 | Bacteria | 4531 |
| 18 | Ga0070660_100004375 | 3300005339 | Bacteria | 9755 |
| 19 | Ga0070660_100011208 | 3300005339 | Bacteria | 6362 |
| 20 | Ga0070660_100020089 | 3300005339 | Bacteria | 4904 |
| 21 | Ga0070660_100076414 | 3300005339 | Bacteria | 2623 |
| 22 | Ga0070661_100017359 | 3300005344 | Bacteria | 5106 |
| 23 | Ga0070661_100098720 | 3300005344 | Bacteria | 2169 |
| 24 | Ga0070659_100001030 | 3300005366 | Bacteria | 20402 |
| 25 | Ga0070659_100006418 | 3300005366 | Bacteria | 8493 |
| 26 | Ga0070659_100024110 | 3300005366 | Unclassified | 4662 |
| 27 | Ga0070667_100109707 | 3300005367 | Unclassified | 2392 |
| 28 | Ga0070709_10124773 | 3300005434 | Bacteria | 1750 |
| 29 | Ga0070714_100012180 | 3300005435 | Bacteria | 6855 |
| 30 | Ga0070714_100024092 | 3300005435 | Bacteria | 5008 |
| 31 | Ga0070714_100033898 | 3300005435 | Unclassified | 4274 |
| 32 | Ga0070714_100509025 | 3300005435 | Bacteria | 1149 |
| 33 | Ga0070713_100034320 | 3300005436 | Unclassified | 4074 |
| 34 | Ga0070713_100320998 | 3300005436 | Unclassified | 1430 |
| 35 | Ga0070711_100022375 | 3300005439 | Bacteria | 4097 |
| 36 | Ga0070705_100040530 | 3300005440 | Bacteria | 2649 |
| 37 | Ga0070708_100223354 | 3300005445 | Unclassified | 1767 |
| 38 | Ga0070708_100384281 | 3300005445 | Unclassified | 1324 |
| 39 | Ga0070663_100063068 | 3300005455 | Unclassified | 2674 |
| 40 | Ga0070663_100253340 | 3300005455 | Unclassified | 1394 |
| 41 | Ga0070663_100305239 | 3300005455 | Bacteria | 1275 |
| 42 | Ga0070681_10001139 | 3300005458 | Bacteria | 22872 |
| 43 | Ga0070681_10028431 | 3300005458 | Bacteria | 5621 |
| 44 | Ga0070681_10045407 | 3300005458 | Unclassified | 4395 |
| 45 | Ga0070681_10089116 | 3300005458 | Bacteria | 3036 |
| 46 | Ga0070681_10090312 | 3300005458 | Unclassified | 3014 |
| 47 | Ga0070681_10124204 | 3300005458 | Bacteria | 2514 |
| 48 | Ga0070681_10160873 | 3300005458 | Bacteria | 2169 |
| 49 | Ga0070681_10439535 | 3300005458 | Bacteria | 1216 |
| 50 | Ga0070706_100236314 | 3300005467 | Bacteria | 1706 |
| 51 | Ga0070707_100084484 | 3300005468 | Bacteria | 3067 |
| 52 | Ga0070698_100011088 | 3300005471 | Bacteria | 9578 |
| 53 | Ga0070699_100111207 | 3300005518 | Bacteria | 2405 |
| 54 | Ga0070679_100019100 | 3300005530 | Bacteria | 6659 |
| 55 | Ga0070679_100029891 | 3300005530 | Bacteria | 5376 |
| 56 | Ga0070679_100038448 | 3300005530 | Bacteria | 4757 |
| 57 | Ga0070679_100147518 | 3300005530 | Bacteria | 2330 |
| 58 | Ga0070679_100178141 | 3300005530 | Bacteria | 2099 |
| 59 | Ga0070684_100027609 | 3300005535 | Unclassified | 4793 |
| 60 | Ga0070684_100051516 | 3300005535 | Bacteria | 3576 |
| 61 | Ga0070684_100132702 | 3300005535 | Bacteria | 2247 |
| 62 | Ga0070684_100134480 | 3300005535 | Unclassified | 2232 |
| 63 | Ga0070684_100153062 | 3300005535 | Bacteria | 2090 |
| 64 | Ga0070684_100172588 | 3300005535 | Unclassified | 1964 |
| 65 | Ga0070684_100709816 | 3300005535 | Bacteria | 938 |
| 66 | Ga0070697_100105357 | 3300005536 | Unclassified | 2346 |
| 67 | Ga0070697_100486388 | 3300005536 | Unclassified | 1078 |
| 68 | Ga0068853_100000020 | 3300005539 | Bacteria | 157450 |
| 69 | Ga0068853_100009335 | 3300005539 | Bacteria | 7908 |
| 70 | Ga0068853_100078007 | 3300005539 | Unclassified | 2894 |
| 71 | Ga0068853_100117054 | 3300005539 | Bacteria | 2373 |
| 72 | Ga0068853_100202000 | 3300005539 | Bacteria | 1809 |
| 73 | Ga0070695_100032759 | 3300005545 | Bacteria | 3249 |
| 74 | Ga0070696_100004115 | 3300005546 | Bacteria | 9697 |
| 75 | Ga0070696_100026877 | 3300005546 | Bacteria | 3917 |
| 76 | Ga0070665_100076995 | 3300005548 | Unclassified | 3342 |
| 77 | Ga0070665_100300762 | 3300005548 | Unclassified | 1607 |
| 78 | Ga0070665_100312440 | 3300005548 | Bacteria | 1575 |
| 79 | Ga0070665_100382137 | 3300005548 | Bacteria | 1416 |
| 80 | Ga0068855_100000760 | 3300005563 | Bacteria | 39704 |
| 81 | Ga0068855_100010159 | 3300005563 | Bacteria | 11346 |
| 82 | Ga0068855_100020516 | 3300005563 | Bacteria | 7923 |
| 83 | Ga0068855_100030070 | 3300005563 | Bacteria | 6496 |
| 84 | Ga0068855_100030254 | 3300005563 | Bacteria | 6476 |
| 85 | Ga0068855_100049876 | 3300005563 | Unclassified | 4935 |
| 86 | Ga0068855_100071035 | 3300005563 | Unclassified | 4049 |
| 87 | Ga0068855_100073803 | 3300005563 | Bacteria | 3963 |
| 88 | Ga0068855_100108307 | 3300005563 | Unclassified | 3191 |
| 89 | Ga0068855_100233467 | 3300005563 | Bacteria | 2058 |
| 90 | Ga0068855_100379160 | 3300005563 | Bacteria | 1553 |
| 91 | Ga0068855_100395018 | 3300005563 | Unclassified | 1516 |
| 92 | Ga0070664_100128728 | 3300005564 | Bacteria | 2223 |
| 93 | Ga0070664_100186276 | 3300005564 | Bacteria | 1847 |
| 94 | Ga0068854_100000112 | 3300005578 | Bacteria | 55846 |
| 95 | Ga0068854_100025724 | 3300005578 | Bacteria | 4038 |
| 96 | Ga0068856_100005948 | 3300005614 | Bacteria | 12010 |
| 97 | Ga0068856_100044192 | 3300005614 | Bacteria | 4383 |
| 98 | Ga0068856_100044567 | 3300005614 | Bacteria | 4365 |
| 99 | Ga0068856_100088400 | 3300005614 | Bacteria | 3081 |
| 100 | Ga0068856_100098852 | 3300005614 | Unclassified | 2909 |
| 101 | Ga0068856_100304275 | 3300005614 | Unclassified | 1612 |
| 102 | Ga0068856_100402823 | 3300005614 | Bacteria | 1388 |
| 103 | Ga0068856_100539710 | 3300005614 | Bacteria | 1187 |
| 104 | Ga0068852_100010407 | 3300005616 | Bacteria | 6950 |
| 105 | Ga0068852_100035525 | 3300005616 | Bacteria | 4159 |
| 106 | Ga0068852_100044224 | 3300005616 | Bacteria | 3781 |
| 107 | Ga0068852_100150258 | 3300005616 | Bacteria | 2165 |
| 108 | Ga0068852_100314761 | 3300005616 | Bacteria | 1518 |
| 109 | Ga0068852_100579674 | 3300005616 | Bacteria | 1124 |
| 110 | Ga0068859_100007115 | 3300005617 | Bacteria | 11354 |
| 111 | Ga0068859_100548710 | 3300005617 | Unclassified | 1250 |
| 112 | Ga0068864_100036984 | 3300005618 | Bacteria | 4163 |
| 113 | Ga0068851_10015278 | 3300005834 | Bacteria | 3656 |
| 114 | Ga0068851_10098089 | 3300005834 | Bacteria | 1551 |
| 115 | Ga0068863_100022576 | 3300005841 | Bacteria | 6009 |
| 116 | Ga0068858_100028907 | 3300005842 | Bacteria | 5147 |
| 117 | Ga0070717_10233441 | 3300006028 | Bacteria | 1620 |
| 118 | Ga0070717_10339193 | 3300006028 | Bacteria | 1342 |
| 119 | Ga0070716_100086332 | 3300006173 | Unclassified | 1887 |
| 120 | Ga0070712_100383769 | 3300006175 | Bacteria | 1157 |
| 121 | Ga0070712_100500562 | 3300006175 | Bacteria | 1018 |
| 122 | Ga0097621_100364288 | 3300006237 | Bacteria | 1288 |
| 123 | Ga0068871_100009837 | 3300006358 | Bacteria | 6942 |
| 124 | Ga0068871_100028225 | 3300006358 | Bacteria | 4398 |
| 125 | Ga0068871_100271703 | 3300006358 | Unclassified | 1481 |
| 126 | Ga0075428_100064805 | 3300006844 | Unclassified | 4001 |
| 127 | Ga0075434_100542503 | 3300006871 | Unclassified | 1183 |
| 128 | Ga0068865_100053935 | 3300006881 | Bacteria | 2791 |
| 129 | Ga0075436_100001482 | 3300006914 | Bacteria | 15994 |
| 130 | Ga0097620_100007115 | 3300006931 | Bacteria | 11354 |
| 131 | Ga0097620_100548682 | 3300006931 | Unclassified | 1250 |
| 132 | Ga0075435_100099904 | 3300007076 | Bacteria | 2403 |
| 133 | Ga0105240_10000426 | 3300009093 | Bacteria | 78171 |
| 134 | Ga0105240_10001139 | 3300009093 | Bacteria | 46550 |
| 135 | Ga0105240_10003685 | 3300009093 | Bacteria | 23694 |
| 136 | Ga0105240_10004479 | 3300009093 | Bacteria | 21260 |
| 137 | Ga0105240_10007741 | 3300009093 | Bacteria | 15542 |
| 138 | Ga0105240_10013870 | 3300009093 | Bacteria | 11037 |
| 139 | Ga0105240_10024750 | 3300009093 | Bacteria | 7907 |
| 140 | Ga0105240_10038829 | 3300009093 | Bacteria | 6104 |
| 141 | Ga0105240_10106509 | 3300009093 | Bacteria | 3400 |
| 142 | Ga0105240_10142952 | 3300009093 | Bacteria | 2859 |
| 143 | Ga0105240_10169634 | 3300009093 | Bacteria | 2586 |
| 144 | Ga0105240_10216878 | 3300009093 | Unclassified | 2232 |
| 145 | Ga0105240_10235591 | 3300009093 | Bacteria | 2124 |
| 146 | Ga0105240_10282880 | 3300009093 | Bacteria | 1905 |
| 147 | Ga0105240_10364076 | 3300009093 | Bacteria | 1637 |
| 148 | Ga0111539_10312335 | 3300009094 | Unclassified | 1829 |
| 149 | Ga0105245_10000276 | 3300009098 | Bacteria | 48573 |
| 150 | Ga0105245_10017542 | 3300009098 | Bacteria | 6248 |
| 151 | Ga0105245_10052678 | 3300009098 | Bacteria | 3650 |
| 152 | Ga0105245_10225473 | 3300009098 | Bacteria | 1810 |
| 153 | Ga0105243_10061964 | 3300009148 | Bacteria | 2993 |
| 154 | Ga0105241_10000455 | 3300009174 | Bacteria | 30779 |
| 155 | Ga0105241_10009122 | 3300009174 | Bacteria | 7301 |
| 156 | Ga0105241_10081245 | 3300009174 | Bacteria | 2538 |
| 157 | Ga0105241_10100040 | 3300009174 | Unclassified | 2304 |
| 158 | Ga0105242_11089306 | 3300009176 | Unclassified | 812 |
| 159 | Ga0105248_10017782 | 3300009177 | Bacteria | 7844 |
| 160 | Ga0105248_10039490 | 3300009177 | Bacteria | 5287 |
| 161 | Ga0105248_10050900 | 3300009177 | Unclassified | 4647 |
| 162 | Ga0105248_10072386 | 3300009177 | Unclassified | 3874 |
| 163 | Ga0105248_10138358 | 3300009177 | Bacteria | 2747 |
| 164 | Ga0105248_10149782 | 3300009177 | Unclassified | 2632 |
| 165 | Ga0105248_10487559 | 3300009177 | Bacteria | 1389 |
| 166 | Ga0105237_10000181 | 3300009545 | Bacteria | 89347 |
| 167 | Ga0105237_10002694 | 3300009545 | Bacteria | 21737 |
| 168 | Ga0105237_10003286 | 3300009545 | Bacteria | 19307 |
| 169 | Ga0105237_10003996 | 3300009545 | Bacteria | 17244 |
| 170 | Ga0105237_10020792 | 3300009545 | Bacteria | 6760 |
| 171 | Ga0105237_10023960 | 3300009545 | Bacteria | 6246 |
| 172 | Ga0105237_10024604 | 3300009545 | Bacteria | 6157 |
| 173 | Ga0105237_10062867 | 3300009545 | Bacteria | 3711 |
| 174 | Ga0105237_10068693 | 3300009545 | Bacteria | 3537 |
| 175 | Ga0105237_10293622 | 3300009545 | Bacteria | 1628 |
| 176 | Ga0105237_10337076 | 3300009545 | Unclassified | 1512 |
| 177 | Ga0105237_10498452 | 3300009545 | Unclassified | 1224 |
| 178 | Ga0105238_10001544 | 3300009551 | Bacteria | 23076 |
| 179 | Ga0105238_10006064 | 3300009551 | Bacteria | 11992 |
| 180 | Ga0105238_10015760 | 3300009551 | Bacteria | 7653 |
| 181 | Ga0105238_10054504 | 3300009551 | Unclassified | 4015 |
| 182 | Ga0105238_10068947 | 3300009551 | Unclassified | 3537 |
| 183 | Ga0105238_10070620 | 3300009551 | Bacteria | 3491 |
| 184 | Ga0105238_10131756 | 3300009551 | Unclassified | 2478 |
| 185 | Ga0105238_10434601 | 3300009551 | Bacteria | 1308 |
| 186 | Ga0105238_10648543 | 3300009551 | Unclassified | 1066 |
| 187 | Ga0105249_10002424 | 3300009553 | Bacteria | 16182 |
| 188 | Ga0105249_10010763 | 3300009553 | Bacteria | 8038 |
| 189 | Ga0105249_10047332 | 3300009553 | Unclassified | 3918 |
| 190 | Ga0105249_10709422 | 3300009553 | Unclassified | 1066 |
| 191 | Ga0105249_10755410 | 3300009553 | Unclassified | 1035 |
| 192 | Ga0105239_10001170 | 3300010375 | Bacteria | 36090 |
| 193 | Ga0105239_10003547 | 3300010375 | Bacteria | 19077 |
| 194 | Ga0105239_10011736 | 3300010375 | Bacteria | 9779 |
| 195 | Ga0105239_10017742 | 3300010375 | Bacteria | 7874 |
| 196 | Ga0105239_10034783 | 3300010375 | Bacteria | 5534 |
| 197 | Ga0105239_10113648 | 3300010375 | Bacteria | 3003 |
| 198 | Ga0105239_10323977 | 3300010375 | Bacteria | 1738 |
| 199 | Ga0157373_10244393 | 3300013100 | Archaea | 1269 |
| 200 | Ga0157371_10207770 | 3300013102 | Unclassified | 1404 |
| 201 | Ga0157370_10012818 | 3300013104 | Bacteria | 8666 |
| 202 | Ga0157370_10014789 | 3300013104 | Bacteria | 7964 |
| 203 | Ga0157370_10017698 | 3300013104 | Bacteria | 7184 |
| 204 | Ga0157370_10037647 | 3300013104 | Bacteria | 4688 |
| 205 | Ga0157370_10051684 | 3300013104 | Bacteria | 3925 |
| 206 | Ga0157370_10066405 | 3300013104 | Bacteria | 3412 |
| 207 | Ga0157370_10081279 | 3300013104 | Unclassified | 3049 |
| 208 | Ga0157370_10103408 | 3300013104 | Unclassified | 2666 |
| 209 | Ga0157370_10180853 | 3300013104 | Bacteria | 1959 |
| 210 | Ga0157370_10264134 | 3300013104 | Unclassified | 1590 |
| 211 | Ga0157369_10002552 | 3300013105 | Bacteria | 21794 |
| 212 | Ga0157369_10004465 | 3300013105 | Bacteria | 16478 |
| 213 | Ga0157369_10006067 | 3300013105 | Bacteria | 14021 |
| 214 | Ga0157369_10006390 | 3300013105 | Bacteria | 13663 |
| 215 | Ga0157369_10011358 | 3300013105 | Bacteria | 10115 |
| 216 | Ga0157369_10015568 | 3300013105 | Bacteria | 8571 |
| 217 | Ga0157369_10027595 | 3300013105 | Bacteria | 6290 |
| 218 | Ga0157369_10038304 | 3300013105 | Bacteria | 5243 |
| 219 | Ga0157369_10047122 | 3300013105 | Bacteria | 4683 |
| 220 | Ga0157369_10060453 | 3300013105 | Unclassified | 4086 |
| 221 | Ga0157369_10072859 | 3300013105 | Unclassified | 3686 |
| 222 | Ga0157369_10105026 | 3300013105 | Bacteria | 3007 |
| 223 | Ga0157369_10152156 | 3300013105 | Bacteria | 2445 |
| 224 | Ga0157369_10154171 | 3300013105 | Bacteria | 2427 |
| 225 | Ga0157369_10297673 | 3300013105 | Bacteria | 1679 |
| 226 | Ga0157374_10004877 | 3300013296 | Bacteria | 11254 |
| 227 | Ga0157374_10009651 | 3300013296 | Bacteria | 8289 |
| 228 | Ga0157374_10015514 | 3300013296 | Bacteria | 6683 |
| 229 | Ga0157374_10024704 | 3300013296 | Bacteria | 5387 |
| 230 | Ga0157374_10125431 | 3300013296 | Bacteria | 2481 |
| 231 | Ga0157374_10147371 | 3300013296 | Bacteria | 2287 |
| 232 | Ga0157374_10163510 | 3300013296 | Bacteria | 2169 |
| 233 | Ga0157374_10174818 | 3300013296 | Unclassified | 2096 |
| 234 | Ga0157374_10192092 | 3300013296 | Bacteria | 1997 |
| 235 | Ga0157378_10040828 | 3300013297 | Bacteria | 4116 |
| 236 | Ga0157378_10181180 | 3300013297 | Bacteria | 1982 |
| 237 | Ga0157378_10237808 | 3300013297 | Unclassified | 1739 |
| 238 | Ga0157378_10431732 | 3300013297 | Bacteria | 1304 |
| 239 | Ga0163162_10005738 | 3300013306 | Bacteria | 12002 |
| 240 | Ga0157372_10002499 | 3300013307 | Bacteria | 19946 |
| 241 | Ga0157372_10003567 | 3300013307 | Bacteria | 16747 |
| 242 | Ga0157372_10011675 | 3300013307 | Bacteria | 9352 |
| 243 | Ga0157372_10025751 | 3300013307 | Bacteria | 6399 |
| 244 | Ga0157372_10028782 | 3300013307 | Bacteria | 6064 |
| 245 | Ga0157372_10046119 | 3300013307 | Bacteria | 4837 |
| 246 | Ga0157372_10062711 | 3300013307 | Unclassified | 4165 |
| 247 | Ga0157372_10151063 | 3300013307 | Unclassified | 2681 |
| 248 | Ga0157372_10166570 | 3300013307 | Bacteria | 2549 |
| 249 | Ga0157372_10203578 | 3300013307 | Bacteria | 2293 |
| 250 | Ga0157372_10240456 | 3300013307 | Unclassified | 2101 |
| 251 | Ga0157372_10248512 | 3300013307 | Bacteria | 2064 |
| 252 | Ga0157372_10354560 | 3300013307 | Bacteria | 1709 |
| 253 | Ga0157372_10376582 | 3300013307 | Bacteria | 1654 |
| 254 | Ga0157372_10578105 | 3300013307 | Bacteria | 1309 |
| 255 | Ga0157375_10001484 | 3300013308 | Bacteria | 20136 |
| 256 | Ga0157375_10039400 | 3300013308 | Bacteria | 4548 |
| 257 | Ga0157375_10195048 | 3300013308 | Bacteria | 2180 |
| 258 | Ga0163163_10247666 | 3300014325 | Unclassified | 1832 |
| 259 | Ga0163163_10393642 | 3300014325 | Bacteria | 1444 |
| 260 | Ga0157379_10085917 | 3300014968 | Unclassified | 2820 |
| 261 | Ga0157379_10457345 | 3300014968 | Bacteria | 1179 |
| 262 | Ga0157376_10007057 | 3300014969 | Bacteria | 7974 |
| 263 | Ga0157376_10042098 | 3300014969 | Bacteria | 3743 |
| 264 | Ga0157376_10130543 | 3300014969 | Bacteria | 2241 |
| 265 | Ga0157376_10171068 | 3300014969 | Unclassified | 1978 |
| 266 | Ga0154015_1542044 | 3300020610 | Bacteria | 1986 |
| 267 | Ga0213872_10002246 | 3300021361 | Bacteria | 11545 |
| 268 | Ga0213876_10003129 | 3300021384 | Bacteria | 9550 |
| 269 | Ga0213875_10008535 | 3300021388 | Bacteria | 5240 |
| 270 | Ga0213875_10029546 | 3300021388 | Unclassified | 2600 |
| 271 | Ga0224572_1000488 | 3300024225 | Bacteria | 4727 |
| 272 | Ga0228598_1000225 | 3300024227 | Bacteria | 10703 |
| 273 | Ga0207647_10005304 | 3300025904 | Bacteria | 9474 |
| 274 | Ga0207647_10035737 | 3300025904 | Bacteria | 3164 |
| 275 | Ga0207647_10038718 | 3300025904 | Unclassified | 3013 |
| 276 | Ga0207647_10195247 | 3300025904 | Bacteria | 1172 |
| 277 | Ga0207705_10000021 | 3300025909 | Bacteria | 309436 |
| 278 | Ga0207705_10029663 | 3300025909 | Bacteria | 3899 |
| 279 | Ga0207705_10059083 | 3300025909 | Unclassified | 2766 |
| 280 | Ga0207705_10082153 | 3300025909 | Bacteria | 2349 |
| 281 | Ga0207705_10151503 | 3300025909 | Unclassified | 1738 |
| 282 | Ga0207705_10260604 | 3300025909 | Unclassified | 1324 |
| 283 | Ga0207684_10082627 | 3300025910 | Bacteria | 2736 |
| 284 | Ga0207654_10050925 | 3300025911 | Bacteria | 2381 |
| 285 | Ga0207707_10017982 | 3300025912 | Bacteria | 6162 |
| 286 | Ga0207707_10120018 | 3300025912 | Bacteria | 2298 |
| 287 | Ga0207707_10254842 | 3300025912 | Bacteria | 1524 |
| 288 | Ga0207707_10271119 | 3300025912 | Bacteria | 1471 |
| 289 | Ga0207695_10000398 | 3300025913 | Bacteria | 97114 |
| 290 | Ga0207695_10001534 | 3300025913 | Bacteria | 38140 |
| 291 | Ga0207695_10002219 | 3300025913 | Bacteria | 29206 |
| 292 | Ga0207695_10006033 | 3300025913 | Bacteria | 15832 |
| 293 | Ga0207695_10029131 | 3300025913 | Bacteria | 6108 |
| 294 | Ga0207695_10029320 | 3300025913 | Bacteria | 6083 |
| 295 | Ga0207695_10056987 | 3300025913 | Bacteria | 4063 |
| 296 | Ga0207695_10063593 | 3300025913 | Unclassified | 3804 |
| 297 | Ga0207695_10118346 | 3300025913 | Bacteria | 2620 |
| 298 | Ga0207671_10000310 | 3300025914 | Bacteria | 72022 |
| 299 | Ga0207671_10005637 | 3300025914 | Bacteria | 11473 |
| 300 | Ga0207671_10013270 | 3300025914 | Bacteria | 6570 |
| 301 | Ga0207671_10016685 | 3300025914 | Bacteria | 5699 |
| 302 | Ga0207671_10031572 | 3300025914 | Unclassified | 3946 |
| 303 | Ga0207671_10037523 | 3300025914 | Bacteria | 3593 |
| 304 | Ga0207671_10227273 | 3300025914 | Bacteria | 1463 |
| 305 | Ga0207693_10422028 | 3300025915 | Unclassified | 1043 |
| 306 | Ga0207663_10103709 | 3300025916 | Unclassified | 1916 |
| 307 | Ga0207660_10032168 | 3300025917 | Bacteria | 3619 |
| 308 | Ga0207660_10072544 | 3300025917 | Bacteria | 2507 |
| 309 | Ga0207657_10002287 | 3300025919 | Bacteria | 20761 |
| 310 | Ga0207657_10018850 | 3300025919 | Bacteria | 6571 |
| 311 | Ga0207657_10020231 | 3300025919 | Bacteria | 6296 |
| 312 | Ga0207657_10020596 | 3300025919 | Bacteria | 6228 |
| 313 | Ga0207657_10248558 | 3300025919 | Bacteria | 1418 |
| 314 | Ga0207649_10024409 | 3300025920 | Unclassified | 3513 |
| 315 | Ga0207649_10082987 | 3300025920 | Bacteria | 2079 |
| 316 | Ga0207652_10042645 | 3300025921 | Bacteria | 3863 |
| 317 | Ga0207652_10045002 | 3300025921 | Unclassified | 3762 |
| 318 | Ga0207652_10117114 | 3300025921 | Bacteria | 2367 |
| 319 | Ga0207652_10213227 | 3300025921 | Unclassified | 1739 |
| 320 | Ga0207652_10508225 | 3300025921 | Bacteria | 1084 |
| 321 | Ga0207646_10032064 | 3300025922 | Unclassified | 4755 |
| 322 | Ga0207694_10008290 | 3300025924 | Bacteria | 7855 |
| 323 | Ga0207694_10031888 | 3300025924 | Unclassified | 4029 |
| 324 | Ga0207694_10051814 | 3300025924 | Bacteria | 3181 |
| 325 | Ga0207694_10093867 | 3300025924 | Unclassified | 2370 |
| 326 | Ga0207694_10132030 | 3300025924 | Bacteria | 2002 |
| 327 | Ga0207694_10185470 | 3300025924 | Bacteria | 1688 |
| 328 | Ga0207687_10001368 | 3300025927 | Bacteria | 16690 |
| 329 | Ga0207687_10021899 | 3300025927 | Unclassified | 4249 |
| 330 | Ga0207700_10067507 | 3300025928 | Unclassified | 2738 |
| 331 | Ga0207664_10042284 | 3300025929 | Unclassified | 3556 |
| 332 | Ga0207664_10056763 | 3300025929 | Unclassified | 3111 |
| 333 | Ga0207664_10142147 | 3300025929 | Bacteria | 2031 |
| 334 | Ga0207664_10156496 | 3300025929 | Bacteria | 1941 |
| 335 | Ga0207644_10137522 | 3300025931 | Bacteria | 1877 |
| 336 | Ga0207690_10011403 | 3300025932 | Bacteria | 5315 |
| 337 | Ga0207690_10031718 | 3300025932 | Bacteria | 3384 |
| 338 | Ga0207690_10200068 | 3300025932 | Bacteria | 1517 |
| 339 | Ga0207709_10152360 | 3300025935 | Unclassified | 1603 |
| 340 | Ga0207704_10043246 | 3300025938 | Bacteria | 2658 |
| 341 | Ga0207711_10014360 | 3300025941 | Bacteria | 6577 |
| 342 | Ga0207711_10056770 | 3300025941 | Bacteria | 3364 |
| 343 | Ga0207661_10010726 | 3300025944 | Bacteria | 6604 |
| 344 | Ga0207661_10012503 | 3300025944 | Bacteria | 6169 |
| 345 | Ga0207661_10119180 | 3300025944 | Bacteria | 2244 |
| 346 | Ga0207661_10218469 | 3300025944 | Bacteria | 1684 |
| 347 | Ga0207661_10464670 | 3300025944 | Unclassified | 1154 |
| 348 | Ga0207679_10111304 | 3300025945 | Unclassified | 2162 |
| 349 | Ga0207679_10341302 | 3300025945 | Bacteria | 1303 |
| 350 | Ga0207667_10001927 | 3300025949 | Bacteria | 26034 |
| 351 | Ga0207667_10006256 | 3300025949 | Bacteria | 14451 |
| 352 | Ga0207667_10007397 | 3300025949 | Bacteria | 13210 |
| 353 | Ga0207667_10035103 | 3300025949 | Bacteria | 5381 |
| 354 | Ga0207667_10073378 | 3300025949 | Unclassified | 3556 |
| 355 | Ga0207667_10146197 | 3300025949 | Bacteria | 2433 |
| 356 | Ga0207667_10245090 | 3300025949 | Bacteria | 1834 |
| 357 | Ga0207667_10310943 | 3300025949 | Bacteria | 1609 |
| 358 | Ga0207667_10639479 | 3300025949 | Bacteria | 1070 |
| 359 | Ga0207667_10736269 | 3300025949 | Archaea | 986 |
| 360 | Ga0207712_10013884 | 3300025961 | Bacteria | 5165 |
| 361 | Ga0207712_10035307 | 3300025961 | Unclassified | 3396 |
| 362 | Ga0207712_10047546 | 3300025961 | Unclassified | 2979 |
| 363 | Ga0207640_10000001 | 3300025981 | Bacteria | 628778 |
| 364 | Ga0207640_10027307 | 3300025981 | Bacteria | 3476 |
| 365 | Ga0207640_10033916 | 3300025981 | Unclassified | 3181 |
| 366 | Ga0207703_10021166 | 3300026035 | Bacteria | 5090 |
| 367 | Ga0207703_10317156 | 3300026035 | Bacteria | 1426 |
| 368 | Ga0207639_10000023 | 3300026041 | Bacteria | 215340 |
| 369 | Ga0207639_10020931 | 3300026041 | Unclassified | 4692 |
| 370 | Ga0207678_10017810 | 3300026067 | Bacteria | 6237 |
| 371 | Ga0207678_10105135 | 3300026067 | Unclassified | 2409 |
| 372 | Ga0207678_10113242 | 3300026067 | Unclassified | 2314 |
| 373 | Ga0207678_10429615 | 3300026067 | Bacteria | 1146 |
| 374 | Ga0207702_10047120 | 3300026078 | Bacteria | 3631 |
| 375 | Ga0207702_10090850 | 3300026078 | Unclassified | 2673 |
| 376 | Ga0207702_10210079 | 3300026078 | Bacteria | 1809 |
| 377 | Ga0207702_10223773 | 3300026078 | Bacteria | 1755 |
| 378 | Ga0207641_10027193 | 3300026088 | Bacteria | 4724 |
| 379 | Ga0207676_10071060 | 3300026095 | Bacteria | 2793 |
| 380 | Ga0207674_10010982 | 3300026116 | Bacteria | 10191 |
| 381 | Ga0207674_10425411 | 3300026116 | Bacteria | 1283 |
| 382 | Ga0207698_10015765 | 3300026142 | Bacteria | 5075 |
| 383 | Ga0207698_10094500 | 3300026142 | Bacteria | 2458 |
| 384 | Ga0207698_10281496 | 3300026142 | Bacteria | 1538 |
| 385 | Ga0207698_10341745 | 3300026142 | Unclassified | 1410 |
| 386 | Ga0268266_10005687 | 3300028379 | Bacteria | 11558 |
| 387 | Ga0268266_10010073 | 3300028379 | Bacteria | 8287 |
| 388 | Ga0268266_10166203 | 3300028379 | Unclassified | 1999 |
| 389 | Ga0268266_10589343 | 3300028379 | Bacteria | 1067 |
| 390 | Ga0265334_10058197 | 3300028573 | Unclassified | 1463 |
| 391 | Ga0265318_10026081 | 3300028577 | Bacteria | 2304 |
| 392 | Ga0265318_10038742 | 3300028577 | Unclassified | 1821 |
| 393 | Ga0265336_10002766 | 3300028666 | Bacteria | 7087 |
| 394 | Ga0265338_10001701 | 3300028800 | Bacteria | 34933 |
| 395 | Ga0265338_10002509 | 3300028800 | Bacteria | 27326 |
| 396 | Ga0265338_10069404 | 3300028800 | Bacteria | 3028 |
| 397 | Ga0265338_10156936 | 3300028800 | Unclassified | 1761 |
| 398 | Ga0265762_1009530 | 3300030760 | Bacteria | 1732 |
| 399 | Ga0265762_1013155 | 3300030760 | Bacteria | 1489 |
| 400 | Ga0265766_1000712 | 3300030863 | Bacteria | 1491 |
| 401 | Ga0265760_10014148 | 3300031090 | Bacteria | 2283 |
| 402 | Ga0265330_10000200 | 3300031235 | Bacteria | 46237 |
| 403 | Ga0265330_10118791 | 3300031235 | Bacteria | 1127 |
| 404 | Ga0265328_10016616 | 3300031239 | Unclassified | 2859 |
| 405 | Ga0265328_10018487 | 3300031239 | Unclassified | 2687 |
| 406 | Ga0265328_10059690 | 3300031239 | Unclassified | 1400 |
| 407 | Ga0265320_10116297 | 3300031240 | Unclassified | 1222 |
| 408 | Ga0265325_10000441 | 3300031241 | Bacteria | 29835 |
| 409 | Ga0265325_10006121 | 3300031241 | Bacteria | 7347 |
| 410 | Ga0265325_10019496 | 3300031241 | Unclassified | 3748 |
| 411 | Ga0265325_10045613 | 3300031241 | Unclassified | 2277 |
| 412 | Ga0265329_10051121 | 3300031242 | Unclassified | 1316 |
| 413 | Ga0265340_10008974 | 3300031247 | Bacteria | 5387 |
| 414 | Ga0265340_10016910 | 3300031247 | Bacteria | 3774 |
| 415 | Ga0265340_10047973 | 3300031247 | Bacteria | 2077 |
| 416 | Ga0265340_10062685 | 3300031247 | Bacteria | 1775 |
| 417 | Ga0265340_10124065 | 3300031247 | Unclassified | 1187 |
| 418 | Ga0265339_10000558 | 3300031249 | Bacteria | 29113 |
| 419 | Ga0265339_10000720 | 3300031249 | Bacteria | 25691 |
| 420 | Ga0265339_10003347 | 3300031249 | Bacteria | 11226 |
| 421 | Ga0265339_10021000 | 3300031249 | Unclassified | 3807 |
| 422 | Ga0265339_10031251 | 3300031249 | Unclassified | 3010 |
| 423 | Ga0265339_10139690 | 3300031249 | Bacteria | 1233 |
| 424 | Ga0265331_10017733 | 3300031250 | Bacteria | 3708 |
| 425 | Ga0265316_10003984 | 3300031344 | Bacteria | 14789 |
| 426 | Ga0265316_10004243 | 3300031344 | Bacteria | 14322 |
| 427 | Ga0265316_10008375 | 3300031344 | Bacteria | 9602 |
| 428 | Ga0265316_10011761 | 3300031344 | Bacteria | 7873 |
| 429 | Ga0265316_10017900 | 3300031344 | Bacteria | 6108 |
| 430 | Ga0265316_10028573 | 3300031344 | Bacteria | 4598 |
| 431 | Ga0265316_10029077 | 3300031344 | Bacteria | 4549 |
| 432 | Ga0265316_10039698 | 3300031344 | Bacteria | 3779 |
| 433 | Ga0265316_10072569 | 3300031344 | Bacteria | 2651 |
| 434 | Ga0265316_10167940 | 3300031344 | Unclassified | 1638 |
| 435 | Ga0265316_10173057 | 3300031344 | Bacteria | 1610 |
| 436 | Ga0265313_10004177 | 3300031595 | Bacteria | 11217 |
| 437 | Ga0265313_10012203 | 3300031595 | Bacteria | 5269 |
| 438 | Ga0265313_10016298 | 3300031595 | Unclassified | 4279 |
| 439 | Ga0265314_10000025 | 3300031711 | Bacteria | 292548 |
| 440 | Ga0265314_10002510 | 3300031711 | Bacteria | 18722 |
| 441 | Ga0265314_10009633 | 3300031711 | Bacteria | 8135 |
| 442 | Ga0265314_10137813 | 3300031711 | Bacteria | 1513 |
| 443 | Ga0265314_10218376 | 3300031711 | Bacteria | 1114 |
| 444 | Ga0265342_10000635 | 3300031712 | Bacteria | 36796 |
| 445 | Ga0265342_10002963 | 3300031712 | Bacteria | 14275 |
| 446 | Ga0265342_10009570 | 3300031712 | Bacteria | 6810 |
| 447 | Ga0265342_10009667 | 3300031712 | Bacteria | 6763 |
| 448 | Ga0265342_10011792 | 3300031712 | Bacteria | 5957 |
| 449 | Ga0265342_10022880 | 3300031712 | Bacteria | 3965 |
| 450 | Ga0265342_10166943 | 3300031712 | Unclassified | 1213 |
| 451 | Ga0316583_10033826 | 3300032133 | Unclassified | 1815 |
| 452 | Ga0373923_0132238 | 3300035111 | Unclassified | 1122 |
| 453 | Ga0373953_0124876 | 3300035117 | Unclassified | 1095 |
| 454 | Ga0373954_0135026 | 3300035118 | Bacteria | 1202 |
| 455 | Ga0373956_0047212 | 3300035119 | Unclassified | 1926 |
| 456 | Ga0373955_0025863 | 3300035172 | Bacteria | 3018 |
| 457 | Ga0373935_0018562 | 3300035692 | Bacteria | 4233 |
| 458 | Ga0373927_0109080 | 3300035695 | Bacteria | 1803 |
| 459 | Ga0373927_0336249 | 3300035695 | Bacteria | 995 |
| 460 | Ga0373947_0064982 | 3300035725 | Bacteria | 2225 |
| 461 | Ga0373937_0028137 | 3300036401 | Bacteria | 5086 |
| 462 | Ga0373937_0076758 | 3300036401 | Unclassified | 3086 |
| 463 | Ga0373937_0108315 | 3300036401 | Bacteria | 2584 |
| 464 | Ga0373937_0305862 | 3300036401 | Bacteria | 1503 |
| 465 | Ga0373925_0042822 | 3300037068 | Bacteria | 3359 |
| 466 | Ga0395900_0228543 | 3300037418 | Bacteria | 1872 |
| 467 | Ga0395900_0273254 | 3300037418 | Bacteria | 1684 |
| 468 | Ga0395898_0099022 | 3300037466 | Bacteria | 2799 |
| 469 | Ga0395898_0276579 | 3300037466 | Unclassified | 1601 |
| 470 | Ga0395898_0451629 | 3300037466 | Archaea | 1224 |
| 471 | Ga0395905_0077965 | 3300037471 | Bacteria | 3105 |
| 472 | Ga0436364_0013135 | 3300037853 | Bacteria | 7364 |
| 473 | Ga0436364_0193292 | 3300037853 | Bacteria | 2077 |
| 474 | Ga0436364_0324260 | 3300037853 | Unclassified | 1382 |
| 475 | Ga0436364_0366372 | 3300037853 | Bacteria | 231753 |
| 476 | Ga0436364_0637038 | 3300037853 | Bacteria | 6508 |
| 477 | Ga0436364_0816548 | 3300037853 | Bacteria | 1917 |
| 478 | Ga0436364_1091631 | 3300037853 | Bacteria | 18124 |
| 479 | Ga0436364_1322559 | 3300037853 | Bacteria | 11118 |
| 480 | Ga0436364_1333021 | 3300037853 | Bacteria | 5502 |
| 481 | Ga0436364_1472691 | 3300037853 | Bacteria | 1355 |
| 482 | Ga0436364_1538256 | 3300037853 | Bacteria | 7382 |
| 483 | Ga0395901_0837552 | 3300038443 | Unclassified | 906 |
| 484 | Ga0436365_1240177 | 3300039437 | Unclassified | 3474 |
| 485 | Ga0436365_1558821 | 3300039437 | Unclassified | 4433 |
| 486 | Ga0436365_1690851 | 3300039437 | Bacteria | 3573 |
| 487 | Ga0436361_0335407 | 3300039447 | Bacteria | 151349 |
| 488 | Ga0436363_1284651 | 3300039450 | Bacteria | 2839 |
| 489 | Ga0436363_1481145 | 3300039450 | Unclassified | 2562 |
| 490 | Ga0466966_0051680 | 3300044684 | Bacteria | 2612 |
| 491 | Ga0466966_0070403 | 3300044684 | Bacteria | 2193 |
| 492 | Ga0466971_0146868 | 3300044719 | Unclassified | 1100 |
| 493 | Ga0466959_0132561 | 3300045049 | Unclassified | 1766 |
| 494 | Ga0451576_0403573 | 3300045051 | Bacteria | 1433 |
| 495 | Ga0466967_0028649 | 3300045976 | Bacteria | 4653 |
| 496 | Ga0466967_0775795 | 3300045976 | Unclassified | 951 |
| 497 | Ga0495629_0024905 | 3300046459 | Bacteria | 4257 |
| 498 | Ga0495651_0051064 | 3300046462 | Bacteria | 3189 |
| 499 | Ga0495653_0037330 | 3300046463 | Bacteria | 3818 |
| 500 | Ga0495580_0044832 | 3300046472 | Bacteria | 3144 |
| 501 | Ga0495580_0065217 | 3300046472 | Bacteria | 2551 |
| 502 | Ga0495580_0070907 | 3300046472 | Unclassified | 2434 |
| 503 | Ga0495580_0102141 | 3300046472 | Bacteria | 1994 |
| 504 | Ga0495580_0385668 | 3300046472 | Unclassified | 946 |
| 505 | Ga0495582_0003327 | 3300046473 | Bacteria | 9037 |
| 506 | Ga0495662_0008082 | 3300046476 | Bacteria | 5184 |
| 507 | Ga0495585_0209639 | 3300046492 | Unclassified | 988 |
| 508 | Ga0495594_0001072 | 3300046499 | Bacteria | 14263 |
| 509 | Ga0495594_0008646 | 3300046499 | Bacteria | 5247 |
| 510 | Ga0495596_0040838 | 3300046500 | Unclassified | 1830 |
| 511 | Ga0495583_0017597 | 3300046506 | Unclassified | 3789 |
| 512 | Ga0495608_0107435 | 3300046511 | Bacteria | 1796 |
| 513 | Ga0495628_0054324 | 3300046516 | Bacteria | 3158 |
| 514 | Ga0495630_0035109 | 3300046517 | Bacteria | 3747 |
| 515 | Ga0495630_0550952 | 3300046517 | Bacteria | 884 |
| 516 | Ga0495632_0086562 | 3300046519 | Bacteria | 1490 |
| 517 | Ga0495644_0000941 | 3300046523 | Bacteria | 12046 |
| 518 | Ga0495666_0008973 | 3300046526 | Bacteria | 5003 |
| 519 | Ga0495652_0008324 | 3300046529 | Bacteria | 9476 |
| 520 | Ga0495665_0015459 | 3300046531 | Bacteria | 4109 |
| 521 | Ga0495665_0030995 | 3300046531 | Bacteria | 2862 |
| 522 | Ga0495640_0018251 | 3300046533 | Bacteria | 5209 |
| 523 | Ga0495586_0044888 | 3300046535 | Bacteria | 2381 |
| 524 | Ga0495609_0018045 | 3300046538 | Unclassified | 3273 |
| 525 | Ga0495645_0033993 | 3300046543 | Bacteria | 3720 |
| 526 | Ga0495645_0082252 | 3300046543 | Bacteria | 2309 |
| 527 | Ga0495667_0052097 | 3300046559 | Bacteria | 2698 |
| 528 | Ga0495668_0071687 | 3300046616 | Bacteria | 1904 |
| 529 | Ga0495634_0002868 | 3300046642 | Bacteria | 14135 |
| 530 | Ga0495611_0037980 | 3300046648 | Unclassified | 2141 |
| 531 | Ga0495625_0021906 | 3300046660 | Bacteria | 4908 |
| 532 | Ga0495635_0010650 | 3300046663 | Bacteria | 6438 |
| 533 | Ga0495661_0086119 | 3300046665 | Unclassified | 1799 |
| 534 | Ga0495588_0153788 | 3300046674 | Bacteria | 1216 |
| 535 | Ga0495599_0028583 | 3300046678 | Bacteria | 3495 |
| 536 | Ga0495658_0108139 | 3300046683 | Bacteria | 1669 |
| 537 | Ga0495669_0004175 | 3300046684 | Bacteria | 5943 |
| 538 | Ga0495613_0053279 | 3300046689 | Bacteria | 2977 |
| 539 | Ga0495613_0146041 | 3300046689 | Bacteria | 1688 |
| 540 | Ga0495624_0003543 | 3300046690 | Bacteria | 11568 |
| 541 | Ga0495670_0039993 | 3300046691 | Unclassified | 2339 |
| 542 | Ga0495649_0024191 | 3300046694 | Bacteria | 3388 |
| 543 | Ga0495600_0000838 | 3300046809 | Bacteria | 16387 |
| 544 | Ga0495604_0020659 | 3300047317 | Bacteria | 5257 |
| 545 | Ga0495604_0201060 | 3300047317 | Bacteria | 1382 |
| 546 | Ga0495674_0005547 | 3300047319 | Bacteria | 12098 |
| 547 | Ga0495674_0152207 | 3300047319 | Unclassified | 1939 |
| 548 | Ga0495676_0004046 | 3300047321 | Bacteria | 13349 |
| 549 | Ga0495680_0015208 | 3300047322 | Bacteria | 6644 |
| 550 | Ga0495687_029324 | 3300047443 | Bacteria | 2549 |
| 551 | Ga0495675_0002219 | 3300047444 | Bacteria | 11590 |
| 552 | Ga0495684_0098839 | 3300047471 | Bacteria | 2206 |
| 553 | Ga0495614_0004534 | 3300048089 | Bacteria | 6263 |
| 554 | Ga0496100_0034886 | 3300048903 | Unclassified | 3161 |
| 555 | Ga0496104_0112657 | 3300048907 | Bacteria | 2609 |
| 556 | Ga0496105_0097479 | 3300048908 | Unclassified | 2428 |
| 557 | Ga0496108_0107949 | 3300048911 | Bacteria | 2377 |
| 558 | Ga0496109_0021477 | 3300048912 | Bacteria | 5709 |
| 559 | Ga0496110_0039331 | 3300048913 | Bacteria | 4118 |
| 560 | Ga0496112_0043420 | 3300048915 | Unclassified | 4401 |
| 561 | Ga0496112_0134407 | 3300048915 | Bacteria | 2444 |
| 562 | Ga0496114_0170222 | 3300048917 | Unclassified | 1898 |
| 563 | Ga0496115_0155217 | 3300048918 | Bacteria | 1891 |
| 564 | Ga0496115_0199979 | 3300048918 | Unclassified | 1651 |
| 565 | Ga0496115_0218264 | 3300048918 | Bacteria | 1574 |
| 566 | Ga0496115_0242268 | 3300048918 | Bacteria | 1486 |
| 567 | Ga0496126_0000942 | 3300048929 | Bacteria | 50132 |
| 568 | Ga0496126_0142336 | 3300048929 | Bacteria | 2063 |
| 569 | Ga0501031_0003673 | 3300049568 | Bacteria | 9873 |
| 570 | Ga0501032_0012410 | 3300049569 | Bacteria | 6089 |
| 571 | Ga0501033_0014279 | 3300049570 | Bacteria | 6035 |
| 572 | Ga0501034_0021395 | 3300049571 | Bacteria | 6592 |
| 573 | Ga0501036_0006079 | 3300049572 | Bacteria | 9793 |
| 574 | Ga0501037_0001348 | 3300049573 | Bacteria | 18045 |
| 575 | Ga0501043_0005930 | 3300049579 | Bacteria | 9825 |
| 576 | Ga0501046_0004398 | 3300049580 | Bacteria | 12802 |
| 577 | Ga0501047_0010726 | 3300049581 | Bacteria | 8661 |
| 578 | Ga0501067_0035669 | 3300049583 | Bacteria | 2761 |
| 579 | Ga0501068_0000078 | 3300049584 | Bacteria | 39422 |
| 580 | Ga0501069_0002303 | 3300049585 | Bacteria | 9636 |
| 581 | Ga0501070_0010972 | 3300049586 | Bacteria | 7648 |
| 582 | Ga0501072_0004621 | 3300049588 | Bacteria | 10486 |
| 583 | Ga0501073_0000509 | 3300049589 | Bacteria | 27250 |
| 584 | Ga0501074_0006160 | 3300049590 | Bacteria | 8661 |
| 585 | Ga0501076_0085590 | 3300049592 | Bacteria | 2533 |
| 586 | Ga0501077_0002702 | 3300049593 | Bacteria | 10636 |
| 587 | Ga0501079_0000321 | 3300049741 | Bacteria | 30186 |
| 588 | Ga0501080_0000442 | 3300049742 | Bacteria | 32157 |
| 589 | Ga0501083_0006004 | 3300049744 | Bacteria | 8603 |
| 590 | Ga0501035_0008312 | 3300049822 | Bacteria | 9665 |
| 591 | Ga0501044_0006187 | 3300049823 | Bacteria | 13227 |
| 592 | Ga0501044_0008328 | 3300049823 | Bacteria | 11361 |
| 593 | nmdc:mga0n895_510094_c1 | 3300050512 | Unclassified | 1211 |
| 594 | Ga0500595_000039 | 3300053119 | Bacteria | 100396 |
| 595 | Ga0500595_010581 | 3300053119 | Bacteria | 3659 |
| 596 | Ga0500595_021626 | 3300053119 | Bacteria | 2292 |
| 597 | Ga0501084_0001079 | 3300054114 | Bacteria | 21235 |
| 598 | Ga0501082_0000756 | 3300060353 | Bacteria | 28367 |
| 599 | Ga0157369_10019527 | |||
| 600 | Ga0070658_10019622 | |||
| 601 | Ga0070658_10039888 | |||
| 602 | Ga0070658_10045940 | |||
| 603 | Ga0070658_10096997 | |||
| 604 | Ga0070658_10112987 | |||
| 605 | Ga0070658_10212442 | |||
| 606 | Ga0070658_10272018 | |||
| 607 | Ga0070683_100005597 | |||
| 608 | Ga0070683_100029641 | |||
| 609 | Ga0070683_100039974 | |||
| 610 | Ga0070666_10066592 | |||
| 611 | Ga0070666_10402405 | |||
| 612 | Ga0070680_100010431 | |||
| 613 | Ga0070680_100019766 | |||
| 614 | Ga0070680_100038657 | |||
| 615 | Ga0068868_100025061 | |||
| 616 | Ga0070660_100004375 | |||
| 617 | Ga0070660_100011208 | |||
| 618 | Ga0070660_100020089 | |||
| 619 | Ga0070660_100076414 | |||
| 620 | Ga0070661_100017359 | |||
| 621 | Ga0070661_100098720 | |||
| 622 | Ga0070659_100001030 | |||
| 623 | Ga0070659_100006418 | |||
| 624 | Ga0070659_100024110 | |||
| 625 | Ga0070667_100109707 | |||
| 626 | Ga0070709_10124773 | |||
| 627 | Ga0070714_100012180 | |||
| 628 | Ga0070714_100024092 | |||
| 629 | Ga0070714_100033898 | |||
| 630 | Ga0070714_100509025 | |||
| 631 | Ga0070713_100034320 | |||
| 632 | Ga0070713_100320998 | |||
| 633 | Ga0070711_100022375 | |||
| 634 | Ga0070705_100040530 | |||
| 635 | Ga0070708_100223354 | |||
| 636 | Ga0070708_100384281 | |||
| 637 | Ga0070663_100063068 | |||
| 638 | Ga0070663_100253340 | |||
| 639 | Ga0070663_100305239 | |||
| 640 | Ga0070681_10001139 | |||
| 641 | Ga0070681_10028431 | |||
| 642 | Ga0070681_10045407 | |||
| 643 | Ga0070681_10089116 | |||
| 644 | Ga0070681_10090312 | |||
| 645 | Ga0070681_10124204 | |||
| 646 | Ga0070681_10160873 | |||
| 647 | Ga0070681_10439535 | |||
| 648 | Ga0070706_100236314 | |||
| 649 | Ga0070707_100084484 | |||
| 650 | Ga0070698_100011088 | |||
| 651 | Ga0070699_100111207 | |||
| 652 | Ga0070679_100019100 | |||
| 653 | Ga0070679_100029891 | |||
| 654 | Ga0070679_100038448 | |||
| 655 | Ga0070679_100147518 | |||
| 656 | Ga0070679_100178141 | |||
| 657 | Ga0070684_100027609 | |||
| 658 | Ga0070684_100051516 | |||
| 659 | Ga0070684_100132702 | |||
| 660 | Ga0070684_100134480 | |||
| 661 | Ga0070684_100153062 | |||
| 662 | Ga0070684_100172588 | |||
| 663 | Ga0070684_100709816 | |||
| 664 | Ga0070697_100105357 | |||
| 665 | Ga0070697_100486388 | |||
| 666 | Ga0068853_100000020 | |||
| 667 | Ga0068853_100009335 | |||
| 668 | Ga0068853_100078007 | |||
| 669 | Ga0068853_100117054 | |||
| 670 | Ga0068853_100202000 | |||
| 671 | Ga0070695_100032759 | |||
| 672 | Ga0070696_100004115 | |||
| 673 | Ga0070696_100026877 | |||
| 674 | Ga0070665_100076995 | |||
| 675 | Ga0070665_100300762 | |||
| 676 | Ga0070665_100312440 | |||
| 677 | Ga0070665_100382137 | |||
| 678 | Ga0068855_100000760 | |||
| 679 | Ga0068855_100010159 | |||
| 680 | Ga0068855_100020516 | |||
| 681 | Ga0068855_100030070 | |||
| 682 | Ga0068855_100030254 | |||
| 683 | Ga0068855_100049876 | |||
| 684 | Ga0068855_100071035 | |||
| 685 | Ga0068855_100073803 | |||
| 686 | Ga0068855_100108307 | |||
| 687 | Ga0068855_100233467 | |||
| 688 | Ga0068855_100379160 | |||
| 689 | Ga0068855_100395018 | |||
| 690 | Ga0070664_100128728 | |||
| 691 | Ga0070664_100186276 | |||
| 692 | Ga0068854_100000112 | |||
| 693 | Ga0068854_100025724 | |||
| 694 | Ga0068856_100005948 | |||
| 695 | Ga0068856_100044192 | |||
| 696 | Ga0068856_100044567 | |||
| 697 | Ga0068856_100088400 | |||
| 698 | Ga0068856_100098852 | |||
| 699 | Ga0068856_100304275 | |||
| 700 | Ga0068856_100402823 | |||
| 701 | Ga0068856_100539710 | |||
| 702 | Ga0068852_100010407 | |||
| 703 | Ga0068852_100035525 | |||
| 704 | Ga0068852_100044224 | |||
| 705 | Ga0068852_100150258 | |||
| 706 | Ga0068852_100314761 | |||
| 707 | Ga0068852_100579674 | |||
| 708 | Ga0068859_100007115 | |||
| 709 | Ga0068859_100548710 | |||
| 710 | Ga0068864_100036984 | |||
| 711 | Ga0068851_10015278 | |||
| 712 | Ga0068851_10098089 | |||
| 713 | Ga0068863_100022576 | |||
| 714 | Ga0068858_100028907 | |||
| 715 | Ga0070717_10233441 | |||
| 716 | Ga0070717_10339193 | |||
| 717 | Ga0070716_100086332 | |||
| 718 | Ga0070712_100383769 | |||
| 719 | Ga0070712_100500562 | |||
| 720 | Ga0097621_100364288 | |||
| 721 | Ga0068871_100009837 | |||
| 722 | Ga0068871_100028225 | |||
| 723 | Ga0068871_100271703 | |||
| 724 | Ga0075428_100064805 | |||
| 725 | Ga0075434_100542503 | |||
| 726 | Ga0068865_100053935 | |||
| 727 | Ga0075436_100001482 | |||
| 728 | Ga0097620_100007115 | |||
| 729 | Ga0097620_100548682 | |||
| 730 | Ga0075435_100099904 | |||
| 731 | Ga0105240_10000426 | |||
| 732 | Ga0105240_10001139 | |||
| 733 | Ga0105240_10003685 | |||
| 734 | Ga0105240_10004479 | |||
| 735 | Ga0105240_10007741 | |||
| 736 | Ga0105240_10013870 | |||
| 737 | Ga0105240_10024750 | |||
| 738 | Ga0105240_10038829 | |||
| 739 | Ga0105240_10106509 | |||
| 740 | Ga0105240_10142952 | |||
| 741 | Ga0105240_10169634 | |||
| 742 | Ga0105240_10216878 | |||
| 743 | Ga0105240_10235591 | |||
| 744 | Ga0105240_10282880 | |||
| 745 | Ga0105240_10364076 | |||
| 746 | Ga0111539_10312335 | |||
| 747 | Ga0105245_10000276 | |||
| 748 | Ga0105245_10017542 | |||
| 749 | Ga0105245_10052678 | |||
| 750 | Ga0105245_10225473 | |||
| 751 | Ga0105243_10061964 | |||
| 752 | Ga0105241_10000455 | |||
| 753 | Ga0105241_10009122 | |||
| 754 | Ga0105241_10081245 | |||
| 755 | Ga0105241_10100040 | |||
| 756 | Ga0105242_11089306 | |||
| 757 | Ga0105248_10017782 | |||
| 758 | Ga0105248_10039490 | |||
| 759 | Ga0105248_10050900 | |||
| 760 | Ga0105248_10072386 | |||
| 761 | Ga0105248_10138358 | |||
| 762 | Ga0105248_10149782 | |||
| 763 | Ga0105248_10487559 | |||
| 764 | Ga0105237_10000181 | |||
| 765 | Ga0105237_10002694 | |||
| 766 | Ga0105237_10003286 | |||
| 767 | Ga0105237_10003996 | |||
| 768 | Ga0105237_10020792 | |||
| 769 | Ga0105237_10023960 | |||
| 770 | Ga0105237_10024604 | |||
| 771 | Ga0105237_10062867 | |||
| 772 | Ga0105237_10068693 | |||
| 773 | Ga0105237_10293622 | |||
| 774 | Ga0105237_10337076 | |||
| 775 | Ga0105237_10498452 | |||
| 776 | Ga0105238_10001544 | |||
| 777 | Ga0105238_10006064 | |||
| 778 | Ga0105238_10015760 | |||
| 779 | Ga0105238_10054504 | |||
| 780 | Ga0105238_10068947 | |||
| 781 | Ga0105238_10070620 | |||
| 782 | Ga0105238_10131756 | |||
| 783 | Ga0105238_10434601 | |||
| 784 | Ga0105238_10648543 | |||
| 785 | Ga0105249_10002424 | |||
| 786 | Ga0105249_10010763 | |||
| 787 | Ga0105249_10047332 | |||
| 788 | Ga0105249_10709422 | |||
| 789 | Ga0105249_10755410 | |||
| 790 | Ga0105239_10001170 | |||
| 791 | Ga0105239_10003547 | |||
| 792 | Ga0105239_10011736 | |||
| 793 | Ga0105239_10017742 | |||
| 794 | Ga0105239_10034783 | |||
| 795 | Ga0105239_10113648 | |||
| 796 | Ga0105239_10323977 | |||
| 797 | Ga0157373_10244393 | |||
| 798 | Ga0157371_10207770 | |||
| 799 | Ga0157370_10012818 | |||
| 800 | Ga0157370_10014789 | |||
| 801 | Ga0157370_10017698 | |||
| 802 | Ga0157370_10037647 | |||
| 803 | Ga0157370_10051684 | |||
| 804 | Ga0157370_10066405 | |||
| 805 | Ga0157370_10081279 | |||
| 806 | Ga0157370_10103408 | |||
| 807 | Ga0157370_10180853 | |||
| 808 | Ga0157370_10264134 | |||
| 809 | Ga0157369_10002552 | |||
| 810 | Ga0157369_10004465 | |||
| 811 | Ga0157369_10006067 | |||
| 812 | Ga0157369_10006390 | |||
| 813 | Ga0157369_10011358 | |||
| 814 | Ga0157369_10015568 | |||
| 815 | Ga0157369_10027595 | |||
| 816 | Ga0157369_10038304 | |||
| 817 | Ga0157369_10047122 | |||
| 818 | Ga0157369_10060453 | |||
| 819 | Ga0157369_10072859 | |||
| 820 | Ga0157369_10105026 | |||
| 821 | Ga0157369_10152156 | |||
| 822 | Ga0157369_10154171 | |||
| 823 | Ga0157369_10297673 | |||
| 824 | Ga0157374_10004877 | |||
| 825 | Ga0157374_10009651 | |||
| 826 | Ga0157374_10015514 | |||
| 827 | Ga0157374_10024704 | |||
| 828 | Ga0157374_10125431 | |||
| 829 | Ga0157374_10147371 | |||
| 830 | Ga0157374_10163510 | |||
| 831 | Ga0157374_10174818 | |||
| 832 | Ga0157374_10192092 | |||
| 833 | Ga0157378_10040828 | |||
| 834 | Ga0157378_10181180 | |||
| 835 | Ga0157378_10237808 | |||
| 836 | Ga0157378_10431732 | |||
| 837 | Ga0163162_10005738 | |||
| 838 | Ga0157372_10002499 | |||
| 839 | Ga0157372_10003567 | |||
| 840 | Ga0157372_10011675 | |||
| 841 | Ga0157372_10025751 | |||
| 842 | Ga0157372_10028782 | |||
| 843 | Ga0157372_10046119 | |||
| 844 | Ga0157372_10062711 | |||
| 845 | Ga0157372_10151063 | |||
| 846 | Ga0157372_10166570 | |||
| 847 | Ga0157372_10203578 | |||
| 848 | Ga0157372_10240456 | |||
| 849 | Ga0157372_10248512 | |||
| 850 | Ga0157372_10354560 | |||
| 851 | Ga0157372_10376582 | |||
| 852 | Ga0157372_10578105 | |||
| 853 | Ga0157375_10001484 | |||
| 854 | Ga0157375_10039400 | |||
| 855 | Ga0157375_10195048 | |||
| 856 | Ga0163163_10247666 | |||
| 857 | Ga0163163_10393642 | |||
| 858 | Ga0157379_10085917 | |||
| 859 | Ga0157379_10457345 | |||
| 860 | Ga0157376_10007057 | |||
| 861 | Ga0157376_10042098 | |||
| 862 | Ga0157376_10130543 | |||
| 863 | Ga0157376_10171068 | |||
| 864 | Ga0154015_1542044 | |||
| 865 | Ga0213872_10002246 | |||
| 866 | Ga0213876_10003129 | |||
| 867 | Ga0213875_10008535 | |||
| 868 | Ga0213875_10029546 | |||
| 869 | Ga0224572_1000488 | |||
| 870 | Ga0228598_1000225 | |||
| 871 | Ga0207647_10005304 | |||
| 872 | Ga0207647_10035737 | |||
| 873 | Ga0207647_10038718 | |||
| 874 | Ga0207647_10195247 | |||
| 875 | Ga0207705_10000021 | |||
| 876 | Ga0207705_10029663 | |||
| 877 | Ga0207705_10059083 | |||
| 878 | Ga0207705_10082153 | |||
| 879 | Ga0207705_10151503 | |||
| 880 | Ga0207705_10260604 | |||
| 881 | Ga0207684_10082627 | |||
| 882 | Ga0207654_10050925 | |||
| 883 | Ga0207707_10017982 | |||
| 884 | Ga0207707_10120018 | |||
| 885 | Ga0207707_10254842 | |||
| 886 | Ga0207707_10271119 | |||
| 887 | Ga0207695_10000398 | |||
| 888 | Ga0207695_10001534 | |||
| 889 | Ga0207695_10002219 | |||
| 890 | Ga0207695_10006033 | |||
| 891 | Ga0207695_10029131 | |||
| 892 | Ga0207695_10029320 | |||
| 893 | Ga0207695_10056987 | |||
| 894 | Ga0207695_10063593 | |||
| 895 | Ga0207695_10118346 | |||
| 896 | Ga0207671_10000310 | |||
| 897 | Ga0207671_10005637 | |||
| 898 | Ga0207671_10013270 | |||
| 899 | Ga0207671_10016685 | |||
| 900 | Ga0207671_10031572 | |||
| 901 | Ga0207671_10037523 | |||
| 902 | Ga0207671_10227273 | |||
| 903 | Ga0207693_10422028 | |||
| 904 | Ga0207663_10103709 | |||
| 905 | Ga0207660_10032168 | |||
| 906 | Ga0207660_10072544 | |||
| 907 | Ga0207657_10002287 | |||
| 908 | Ga0207657_10018850 | |||
| 909 | Ga0207657_10020231 | |||
| 910 | Ga0207657_10020596 | |||
| 911 | Ga0207657_10248558 | |||
| 912 | Ga0207649_10024409 | |||
| 913 | Ga0207649_10082987 | |||
| 914 | Ga0207652_10042645 | |||
| 915 | Ga0207652_10045002 | |||
| 916 | Ga0207652_10117114 | |||
| 917 | Ga0207652_10213227 | |||
| 918 | Ga0207652_10508225 | |||
| 919 | Ga0207646_10032064 | |||
| 920 | Ga0207694_10008290 | |||
| 921 | Ga0207694_10031888 | |||
| 922 | Ga0207694_10051814 | |||
| 923 | Ga0207694_10093867 | |||
| 924 | Ga0207694_10132030 | |||
| 925 | Ga0207694_10185470 | |||
| 926 | Ga0207687_10001368 | |||
| 927 | Ga0207687_10021899 | |||
| 928 | Ga0207700_10067507 | |||
| 929 | Ga0207664_10042284 | |||
| 930 | Ga0207664_10056763 | |||
| 931 | Ga0207664_10142147 | |||
| 932 | Ga0207664_10156496 | |||
| 933 | Ga0207644_10137522 | |||
| 934 | Ga0207690_10011403 | |||
| 935 | Ga0207690_10031718 | |||
| 936 | Ga0207690_10200068 | |||
| 937 | Ga0207709_10152360 | |||
| 938 | Ga0207704_10043246 | |||
| 939 | Ga0207711_10014360 | |||
| 940 | Ga0207711_10056770 | |||
| 941 | Ga0207661_10010726 | |||
| 942 | Ga0207661_10012503 | |||
| 943 | Ga0207661_10119180 | |||
| 944 | Ga0207661_10218469 | |||
| 945 | Ga0207661_10464670 | |||
| 946 | Ga0207679_10111304 | |||
| 947 | Ga0207679_10341302 | |||
| 948 | Ga0207667_10001927 | |||
| 949 | Ga0207667_10006256 | |||
| 950 | Ga0207667_10007397 | |||
| 951 | Ga0207667_10035103 | |||
| 952 | Ga0207667_10073378 | |||
| 953 | Ga0207667_10146197 | |||
| 954 | Ga0207667_10245090 | |||
| 955 | Ga0207667_10310943 | |||
| 956 | Ga0207667_10639479 | |||
| 957 | Ga0207667_10736269 | |||
| 958 | Ga0207712_10013884 | |||
| 959 | Ga0207712_10035307 | |||
| 960 | Ga0207712_10047546 | |||
| 961 | Ga0207640_10000001 | |||
| 962 | Ga0207640_10027307 | |||
| 963 | Ga0207640_10033916 | |||
| 964 | Ga0207703_10021166 | |||
| 965 | Ga0207703_10317156 | |||
| 966 | Ga0207639_10000023 | |||
| 967 | Ga0207639_10020931 | |||
| 968 | Ga0207678_10017810 | |||
| 969 | Ga0207678_10105135 | |||
| 970 | Ga0207678_10113242 | |||
| 971 | Ga0207678_10429615 | |||
| 972 | Ga0207702_10047120 | |||
| 973 | Ga0207702_10090850 | |||
| 974 | Ga0207702_10210079 | |||
| 975 | Ga0207702_10223773 | |||
| 976 | Ga0207641_10027193 | |||
| 977 | Ga0207676_10071060 | |||
| 978 | Ga0207674_10010982 | |||
| 979 | Ga0207674_10425411 | |||
| 980 | Ga0207698_10015765 | |||
| 981 | Ga0207698_10094500 | |||
| 982 | Ga0207698_10281496 | |||
| 983 | Ga0207698_10341745 | |||
| 984 | Ga0268266_10005687 | |||
| 985 | Ga0268266_10010073 | |||
| 986 | Ga0268266_10166203 | |||
| 987 | Ga0268266_10589343 | |||
| 988 | Ga0265334_10058197 | |||
| 989 | Ga0265318_10026081 | |||
| 990 | Ga0265318_10038742 | |||
| 991 | Ga0265336_10002766 | |||
| 992 | Ga0265338_10001701 | |||
| 993 | Ga0265338_10002509 | |||
| 994 | Ga0265338_10069404 | |||
| 995 | Ga0265338_10156936 | |||
| 996 | Ga0265762_1009530 | |||
| 997 | Ga0265762_1013155 | |||
| 998 | Ga0265766_1000712 | |||
| 999 | Ga0265760_10014148 | |||
| 1000 | Ga0265330_10000200 | |||
| 1001 | Ga0265330_10118791 | |||
| 1002 | Ga0265328_10016616 | |||
| 1003 | Ga0265328_10018487 | |||
| 1004 | Ga0265328_10059690 | |||
| 1005 | Ga0265320_10116297 | |||
| 1006 | Ga0265325_10000441 | |||
| 1007 | Ga0265325_10006121 | |||
| 1008 | Ga0265325_10019496 | |||
| 1009 | Ga0265325_10045613 | |||
| 1010 | Ga0265329_10051121 | |||
| 1011 | Ga0265340_10008974 | |||
| 1012 | Ga0265340_10016910 | |||
| 1013 | Ga0265340_10047973 | |||
| 1014 | Ga0265340_10062685 | |||
| 1015 | Ga0265340_10124065 | |||
| 1016 | Ga0265339_10000558 | |||
| 1017 | Ga0265339_10000720 | |||
| 1018 | Ga0265339_10003347 | |||
| 1019 | Ga0265339_10021000 | |||
| 1020 | Ga0265339_10031251 | |||
| 1021 | Ga0265339_10139690 | |||
| 1022 | Ga0265331_10017733 | |||
| 1023 | Ga0265316_10003984 | |||
| 1024 | Ga0265316_10004243 | |||
| 1025 | Ga0265316_10008375 | |||
| 1026 | Ga0265316_10011761 | |||
| 1027 | Ga0265316_10017900 | |||
| 1028 | Ga0265316_10028573 | |||
| 1029 | Ga0265316_10029077 | |||
| 1030 | Ga0265316_10039698 | |||
| 1031 | Ga0265316_10072569 | |||
| 1032 | Ga0265316_10167940 | |||
| 1033 | Ga0265316_10173057 | |||
| 1034 | Ga0265313_10004177 | |||
| 1035 | Ga0265313_10012203 | |||
| 1036 | Ga0265313_10016298 | |||
| 1037 | Ga0265314_10000025 | |||
| 1038 | Ga0265314_10002510 | |||
| 1039 | Ga0265314_10009633 | |||
| 1040 | Ga0265314_10137813 | |||
| 1041 | Ga0265314_10218376 | |||
| 1042 | Ga0265342_10000635 | |||
| 1043 | Ga0265342_10002963 | |||
| 1044 | Ga0265342_10009570 | |||
| 1045 | Ga0265342_10009667 | |||
| 1046 | Ga0265342_10011792 | |||
| 1047 | Ga0265342_10022880 | |||
| 1048 | Ga0265342_10166943 | |||
| 1049 | Ga0316583_10033826 | |||
| 1050 | Ga0373923_0132238 | |||
| 1051 | Ga0373953_0124876 | |||
| 1052 | Ga0373954_0135026 | |||
| 1053 | Ga0373956_0047212 | |||
| 1054 | Ga0373955_0025863 | |||
| 1055 | Ga0373935_0018562 | |||
| 1056 | Ga0373927_0109080 | |||
| 1057 | Ga0373927_0336249 | |||
| 1058 | Ga0373947_0064982 | |||
| 1059 | Ga0373937_0028137 | |||
| 1060 | Ga0373937_0076758 | |||
| 1061 | Ga0373937_0108315 | |||
| 1062 | Ga0373937_0305862 | |||
| 1063 | Ga0373925_0042822 | |||
| 1064 | Ga0395900_0228543 | |||
| 1065 | Ga0395900_0273254 | |||
| 1066 | Ga0395898_0099022 | |||
| 1067 | Ga0395898_0276579 | |||
| 1068 | Ga0395898_0451629 | |||
| 1069 | Ga0395905_0077965 | |||
| 1070 | Ga0436364_0013135 | |||
| 1071 | Ga0436364_0193292 | |||
| 1072 | Ga0436364_0324260 | |||
| 1073 | Ga0436364_0366372 | |||
| 1074 | Ga0436364_0637038 | |||
| 1075 | Ga0436364_0816548 | |||
| 1076 | Ga0436364_1091631 | |||
| 1077 | Ga0436364_1322559 | |||
| 1078 | Ga0436364_1333021 | |||
| 1079 | Ga0436364_1472691 | |||
| 1080 | Ga0436364_1538256 | |||
| 1081 | Ga0395901_0837552 | |||
| 1082 | Ga0436365_1240177 | |||
| 1083 | Ga0436365_1558821 | |||
| 1084 | Ga0436365_1690851 | |||
| 1085 | Ga0436361_0335407 | |||
| 1086 | Ga0436363_1284651 | |||
| 1087 | Ga0436363_1481145 | |||
| 1088 | Ga0466966_0051680 | |||
| 1089 | Ga0466966_0070403 | |||
| 1090 | Ga0466971_0146868 | |||
| 1091 | Ga0466959_0132561 | |||
| 1092 | Ga0451576_0403573 | |||
| 1093 | Ga0466967_0028649 | |||
| 1094 | Ga0466967_0775795 | |||
| 1095 | Ga0495629_0024905 | |||
| 1096 | Ga0495651_0051064 | |||
| 1097 | Ga0495653_0037330 | |||
| 1098 | Ga0495580_0044832 | |||
| 1099 | Ga0495580_0065217 | |||
| 1100 | Ga0495580_0070907 | |||
| 1101 | Ga0495580_0102141 | |||
| 1102 | Ga0495580_0385668 | |||
| 1103 | Ga0495582_0003327 | |||
| 1104 | Ga0495662_0008082 | |||
| 1105 | Ga0495585_0209639 | |||
| 1106 | Ga0495594_0001072 | |||
| 1107 | Ga0495594_0008646 | |||
| 1108 | Ga0495596_0040838 | |||
| 1109 | Ga0495583_0017597 | |||
| 1110 | Ga0495608_0107435 | |||
| 1111 | Ga0495628_0054324 | |||
| 1112 | Ga0495630_0035109 | |||
| 1113 | Ga0495630_0550952 | |||
| 1114 | Ga0495632_0086562 | |||
| 1115 | Ga0495644_0000941 | |||
| 1116 | Ga0495666_0008973 | |||
| 1117 | Ga0495652_0008324 | |||
| 1118 | Ga0495665_0015459 | |||
| 1119 | Ga0495665_0030995 | |||
| 1120 | Ga0495640_0018251 | |||
| 1121 | Ga0495586_0044888 | |||
| 1122 | Ga0495609_0018045 | |||
| 1123 | Ga0495645_0033993 | |||
| 1124 | Ga0495645_0082252 | |||
| 1125 | Ga0495667_0052097 | |||
| 1126 | Ga0495668_0071687 | |||
| 1127 | Ga0495634_0002868 | |||
| 1128 | Ga0495611_0037980 | |||
| 1129 | Ga0495625_0021906 | |||
| 1130 | Ga0495635_0010650 | |||
| 1131 | Ga0495661_0086119 | |||
| 1132 | Ga0495588_0153788 | |||
| 1133 | Ga0495599_0028583 | |||
| 1134 | Ga0495658_0108139 | |||
| 1135 | Ga0495669_0004175 | |||
| 1136 | Ga0495613_0053279 | |||
| 1137 | Ga0495613_0146041 | |||
| 1138 | Ga0495624_0003543 | |||
| 1139 | Ga0495670_0039993 | |||
| 1140 | Ga0495649_0024191 | |||
| 1141 | Ga0495600_0000838 | |||
| 1142 | Ga0495604_0020659 | |||
| 1143 | Ga0495604_0201060 | |||
| 1144 | Ga0495674_0005547 | |||
| 1145 | Ga0495674_0152207 | |||
| 1146 | Ga0495676_0004046 | |||
| 1147 | Ga0495680_0015208 | |||
| 1148 | Ga0495687_029324 | |||
| 1149 | Ga0495675_0002219 | |||
| 1150 | Ga0495684_0098839 | |||
| 1151 | Ga0495614_0004534 | |||
| 1152 | Ga0496100_0034886 | |||
| 1153 | Ga0496104_0112657 | |||
| 1154 | Ga0496105_0097479 | |||
| 1155 | Ga0496108_0107949 | |||
| 1156 | Ga0496109_0021477 | |||
| 1157 | Ga0496110_0039331 | |||
| 1158 | Ga0496112_0043420 | |||
| 1159 | Ga0496112_0134407 | |||
| 1160 | Ga0496114_0170222 | |||
| 1161 | Ga0496115_0155217 | |||
| 1162 | Ga0496115_0199979 | |||
| 1163 | Ga0496115_0218264 | |||
| 1164 | Ga0496115_0242268 | |||
| 1165 | Ga0496126_0000942 | |||
| 1166 | Ga0496126_0142336 | |||
| 1167 | Ga0501031_0003673 | |||
| 1168 | Ga0501032_0012410 | |||
| 1169 | Ga0501033_0014279 | |||
| 1170 | Ga0501034_0021395 | |||
| 1171 | Ga0501036_0006079 | |||
| 1172 | Ga0501037_0001348 | |||
| 1173 | Ga0501043_0005930 | |||
| 1174 | Ga0501046_0004398 | |||
| 1175 | Ga0501047_0010726 | |||
| 1176 | Ga0501067_0035669 | |||
| 1177 | Ga0501068_0000078 | |||
| 1178 | Ga0501069_0002303 | |||
| 1179 | Ga0501070_0010972 | |||
| 1180 | Ga0501072_0004621 | |||
| 1181 | Ga0501073_0000509 | |||
| 1182 | Ga0501074_0006160 | |||
| 1183 | Ga0501076_0085590 | |||
| 1184 | Ga0501077_0002702 | |||
| 1185 | Ga0501079_0000321 | |||
| 1186 | Ga0501080_0000442 | |||
| 1187 | Ga0501083_0006004 | |||
| 1188 | Ga0501035_0008312 | |||
| 1189 | Ga0501044_0006187 | |||
| 1190 | Ga0501044_0008328 | |||
| 1191 | nmdc:mga0n895_510094_c1 | |||
| 1192 | Ga0500595_000039 | |||
| 1193 | Ga0500595_010581 | |||
| 1194 | Ga0500595_021626 | |||
| 1195 | Ga0501084_0001079 | |||
| 1196 | Ga0501082_0000756 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ur4-assembly1.cif.gz_A | structure of the type iii fish antifreeze protein from zoarces viviparus zvafp13 | 0.8701 | 39 | 99 |
| 6msi-assembly1.cif.gz_A | type iii antifreeze protein isoform hplc 12 | 0.8626 | 39 | 99 |
| 8ame-assembly1.cif.gz_A | type iii antifreeze protein isoform hplc 12 n14sa16h | 0.8589 | 39 | 99 |
| 7msi-assembly1.cif.gz_A | type iii antifreeze protein isoform hplc 12 | 0.8578 | 39 | 99 |
| 9ame-assembly1.cif.gz_A | type iii antifreeze protein isoform hplc 12 s42g | 0.857 | 39 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75933_96_158_3.90.1210.10 | Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain | 0.9028 | 41 | 101 | 3.90.1210.10 |
| 3frnA02 | Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain | 0.8976 | 37 | 102 | 3.90.1210.10 |
| af_P75933_96_158_3.90.1210.10 | Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain | 0.8629 | 41 | 101 | 3.90.1210.10 |
| 3frnA02 | Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain | 0.861 | 37 | 102 | 3.90.1210.10 |
| 5xqrB00 | Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain | 0.8559 | 40 | 101 | 3.90.1210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832NFS4-F1-model_v4 | SAF domain-containing protein | 0.9401 | 38 | 99 |
|
| AF-A0A356VC12-F1-model_v4 | SAF domain-containing protein | 0.9021 | 36 | 100 |
GO:0016051
GO:0047444 GO:0070085 |
| AF-A0A2V9Z019-F1-model_v4 | Flp pilus assembly protein CpaB | 0.8855 | 109 | 226 |
|
| AF-A0A7C3HR97-F1-model_v4 | Flp pilus assembly protein CpaB | 0.88 | 1 | 132 |
|
| AF-A0A1Q8UT00-F1-model_v4 | deleted | 0.8784 | 112 | 234 |
|