F467784

General Info

Members Datasets Scaffolds Average Seq Length
598 241 1196 278

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10019527|Ga0157369_100195275
Length 317
Sequence MIPHIHRVECFGTGIANEIAESAAAERPVRIGPGMNRRLATVLFSAFVVAALCSYLVYRVIGNRLGMMQPKATQVIVAATDIKLGSVLRDVDLTTAEFVGSLPKEAILKKQDAIGRGVVSNLYQGEPVLDSRLAAVGSGGGLAATIRQGMRACAVKVDEVVGVAGFVTPGMRVDVLISGNPPGPINVAEGQKVKTLFQNVEVLSAGTDIQKDGEGKPKSVQVVNLLVTPEQAEMLSLASTQTHIQLVLRNPLDTEVAQVPGSALMNLYTDPNAKRALKPLAAPRRVTHSVPQSQLYLVEVFNGSKRSEEKFVTAEGK

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
78 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 2.17
Rhizosphere 93.81
Stem 0
Stem Tuber 0
Unclassified 24.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10019527 3300013105 Bacteria 7584
2 Ga0070658_10019622 3300005327 Bacteria 5412
3 Ga0070658_10039888 3300005327 Unclassified 3788
4 Ga0070658_10045940 3300005327 Unclassified 3533
5 Ga0070658_10096997 3300005327 Bacteria 2434
6 Ga0070658_10112987 3300005327 Bacteria 2252
7 Ga0070658_10212442 3300005327 Unclassified 1635
8 Ga0070658_10272018 3300005327 Bacteria 1441
9 Ga0070683_100005597 3300005329 Bacteria 10494
10 Ga0070683_100029641 3300005329 Unclassified 4958
11 Ga0070683_100039974 3300005329 Bacteria 4309
12 Ga0070666_10066592 3300005335 Bacteria 2444
13 Ga0070666_10402405 3300005335 Unclassified 984
14 Ga0070680_100010431 3300005336 Bacteria 7164
15 Ga0070680_100019766 3300005336 Bacteria 5340
16 Ga0070680_100038657 3300005336 Unclassified 3860
17 Ga0068868_100025061 3300005338 Bacteria 4531
18 Ga0070660_100004375 3300005339 Bacteria 9755
19 Ga0070660_100011208 3300005339 Bacteria 6362
20 Ga0070660_100020089 3300005339 Bacteria 4904
21 Ga0070660_100076414 3300005339 Bacteria 2623
22 Ga0070661_100017359 3300005344 Bacteria 5106
23 Ga0070661_100098720 3300005344 Bacteria 2169
24 Ga0070659_100001030 3300005366 Bacteria 20402
25 Ga0070659_100006418 3300005366 Bacteria 8493
26 Ga0070659_100024110 3300005366 Unclassified 4662
27 Ga0070667_100109707 3300005367 Unclassified 2392
28 Ga0070709_10124773 3300005434 Bacteria 1750
29 Ga0070714_100012180 3300005435 Bacteria 6855
30 Ga0070714_100024092 3300005435 Bacteria 5008
31 Ga0070714_100033898 3300005435 Unclassified 4274
32 Ga0070714_100509025 3300005435 Bacteria 1149
33 Ga0070713_100034320 3300005436 Unclassified 4074
34 Ga0070713_100320998 3300005436 Unclassified 1430
35 Ga0070711_100022375 3300005439 Bacteria 4097
36 Ga0070705_100040530 3300005440 Bacteria 2649
37 Ga0070708_100223354 3300005445 Unclassified 1767
38 Ga0070708_100384281 3300005445 Unclassified 1324
39 Ga0070663_100063068 3300005455 Unclassified 2674
40 Ga0070663_100253340 3300005455 Unclassified 1394
41 Ga0070663_100305239 3300005455 Bacteria 1275
42 Ga0070681_10001139 3300005458 Bacteria 22872
43 Ga0070681_10028431 3300005458 Bacteria 5621
44 Ga0070681_10045407 3300005458 Unclassified 4395
45 Ga0070681_10089116 3300005458 Bacteria 3036
46 Ga0070681_10090312 3300005458 Unclassified 3014
47 Ga0070681_10124204 3300005458 Bacteria 2514
48 Ga0070681_10160873 3300005458 Bacteria 2169
49 Ga0070681_10439535 3300005458 Bacteria 1216
50 Ga0070706_100236314 3300005467 Bacteria 1706
51 Ga0070707_100084484 3300005468 Bacteria 3067
52 Ga0070698_100011088 3300005471 Bacteria 9578
53 Ga0070699_100111207 3300005518 Bacteria 2405
54 Ga0070679_100019100 3300005530 Bacteria 6659
55 Ga0070679_100029891 3300005530 Bacteria 5376
56 Ga0070679_100038448 3300005530 Bacteria 4757
57 Ga0070679_100147518 3300005530 Bacteria 2330
58 Ga0070679_100178141 3300005530 Bacteria 2099
59 Ga0070684_100027609 3300005535 Unclassified 4793
60 Ga0070684_100051516 3300005535 Bacteria 3576
61 Ga0070684_100132702 3300005535 Bacteria 2247
62 Ga0070684_100134480 3300005535 Unclassified 2232
63 Ga0070684_100153062 3300005535 Bacteria 2090
64 Ga0070684_100172588 3300005535 Unclassified 1964
65 Ga0070684_100709816 3300005535 Bacteria 938
66 Ga0070697_100105357 3300005536 Unclassified 2346
67 Ga0070697_100486388 3300005536 Unclassified 1078
68 Ga0068853_100000020 3300005539 Bacteria 157450
69 Ga0068853_100009335 3300005539 Bacteria 7908
70 Ga0068853_100078007 3300005539 Unclassified 2894
71 Ga0068853_100117054 3300005539 Bacteria 2373
72 Ga0068853_100202000 3300005539 Bacteria 1809
73 Ga0070695_100032759 3300005545 Bacteria 3249
74 Ga0070696_100004115 3300005546 Bacteria 9697
75 Ga0070696_100026877 3300005546 Bacteria 3917
76 Ga0070665_100076995 3300005548 Unclassified 3342
77 Ga0070665_100300762 3300005548 Unclassified 1607
78 Ga0070665_100312440 3300005548 Bacteria 1575
79 Ga0070665_100382137 3300005548 Bacteria 1416
80 Ga0068855_100000760 3300005563 Bacteria 39704
81 Ga0068855_100010159 3300005563 Bacteria 11346
82 Ga0068855_100020516 3300005563 Bacteria 7923
83 Ga0068855_100030070 3300005563 Bacteria 6496
84 Ga0068855_100030254 3300005563 Bacteria 6476
85 Ga0068855_100049876 3300005563 Unclassified 4935
86 Ga0068855_100071035 3300005563 Unclassified 4049
87 Ga0068855_100073803 3300005563 Bacteria 3963
88 Ga0068855_100108307 3300005563 Unclassified 3191
89 Ga0068855_100233467 3300005563 Bacteria 2058
90 Ga0068855_100379160 3300005563 Bacteria 1553
91 Ga0068855_100395018 3300005563 Unclassified 1516
92 Ga0070664_100128728 3300005564 Bacteria 2223
93 Ga0070664_100186276 3300005564 Bacteria 1847
94 Ga0068854_100000112 3300005578 Bacteria 55846
95 Ga0068854_100025724 3300005578 Bacteria 4038
96 Ga0068856_100005948 3300005614 Bacteria 12010
97 Ga0068856_100044192 3300005614 Bacteria 4383
98 Ga0068856_100044567 3300005614 Bacteria 4365
99 Ga0068856_100088400 3300005614 Bacteria 3081
100 Ga0068856_100098852 3300005614 Unclassified 2909
101 Ga0068856_100304275 3300005614 Unclassified 1612
102 Ga0068856_100402823 3300005614 Bacteria 1388
103 Ga0068856_100539710 3300005614 Bacteria 1187
104 Ga0068852_100010407 3300005616 Bacteria 6950
105 Ga0068852_100035525 3300005616 Bacteria 4159
106 Ga0068852_100044224 3300005616 Bacteria 3781
107 Ga0068852_100150258 3300005616 Bacteria 2165
108 Ga0068852_100314761 3300005616 Bacteria 1518
109 Ga0068852_100579674 3300005616 Bacteria 1124
110 Ga0068859_100007115 3300005617 Bacteria 11354
111 Ga0068859_100548710 3300005617 Unclassified 1250
112 Ga0068864_100036984 3300005618 Bacteria 4163
113 Ga0068851_10015278 3300005834 Bacteria 3656
114 Ga0068851_10098089 3300005834 Bacteria 1551
115 Ga0068863_100022576 3300005841 Bacteria 6009
116 Ga0068858_100028907 3300005842 Bacteria 5147
117 Ga0070717_10233441 3300006028 Bacteria 1620
118 Ga0070717_10339193 3300006028 Bacteria 1342
119 Ga0070716_100086332 3300006173 Unclassified 1887
120 Ga0070712_100383769 3300006175 Bacteria 1157
121 Ga0070712_100500562 3300006175 Bacteria 1018
122 Ga0097621_100364288 3300006237 Bacteria 1288
123 Ga0068871_100009837 3300006358 Bacteria 6942
124 Ga0068871_100028225 3300006358 Bacteria 4398
125 Ga0068871_100271703 3300006358 Unclassified 1481
126 Ga0075428_100064805 3300006844 Unclassified 4001
127 Ga0075434_100542503 3300006871 Unclassified 1183
128 Ga0068865_100053935 3300006881 Bacteria 2791
129 Ga0075436_100001482 3300006914 Bacteria 15994
130 Ga0097620_100007115 3300006931 Bacteria 11354
131 Ga0097620_100548682 3300006931 Unclassified 1250
132 Ga0075435_100099904 3300007076 Bacteria 2403
133 Ga0105240_10000426 3300009093 Bacteria 78171
134 Ga0105240_10001139 3300009093 Bacteria 46550
135 Ga0105240_10003685 3300009093 Bacteria 23694
136 Ga0105240_10004479 3300009093 Bacteria 21260
137 Ga0105240_10007741 3300009093 Bacteria 15542
138 Ga0105240_10013870 3300009093 Bacteria 11037
139 Ga0105240_10024750 3300009093 Bacteria 7907
140 Ga0105240_10038829 3300009093 Bacteria 6104
141 Ga0105240_10106509 3300009093 Bacteria 3400
142 Ga0105240_10142952 3300009093 Bacteria 2859
143 Ga0105240_10169634 3300009093 Bacteria 2586
144 Ga0105240_10216878 3300009093 Unclassified 2232
145 Ga0105240_10235591 3300009093 Bacteria 2124
146 Ga0105240_10282880 3300009093 Bacteria 1905
147 Ga0105240_10364076 3300009093 Bacteria 1637
148 Ga0111539_10312335 3300009094 Unclassified 1829
149 Ga0105245_10000276 3300009098 Bacteria 48573
150 Ga0105245_10017542 3300009098 Bacteria 6248
151 Ga0105245_10052678 3300009098 Bacteria 3650
152 Ga0105245_10225473 3300009098 Bacteria 1810
153 Ga0105243_10061964 3300009148 Bacteria 2993
154 Ga0105241_10000455 3300009174 Bacteria 30779
155 Ga0105241_10009122 3300009174 Bacteria 7301
156 Ga0105241_10081245 3300009174 Bacteria 2538
157 Ga0105241_10100040 3300009174 Unclassified 2304
158 Ga0105242_11089306 3300009176 Unclassified 812
159 Ga0105248_10017782 3300009177 Bacteria 7844
160 Ga0105248_10039490 3300009177 Bacteria 5287
161 Ga0105248_10050900 3300009177 Unclassified 4647
162 Ga0105248_10072386 3300009177 Unclassified 3874
163 Ga0105248_10138358 3300009177 Bacteria 2747
164 Ga0105248_10149782 3300009177 Unclassified 2632
165 Ga0105248_10487559 3300009177 Bacteria 1389
166 Ga0105237_10000181 3300009545 Bacteria 89347
167 Ga0105237_10002694 3300009545 Bacteria 21737
168 Ga0105237_10003286 3300009545 Bacteria 19307
169 Ga0105237_10003996 3300009545 Bacteria 17244
170 Ga0105237_10020792 3300009545 Bacteria 6760
171 Ga0105237_10023960 3300009545 Bacteria 6246
172 Ga0105237_10024604 3300009545 Bacteria 6157
173 Ga0105237_10062867 3300009545 Bacteria 3711
174 Ga0105237_10068693 3300009545 Bacteria 3537
175 Ga0105237_10293622 3300009545 Bacteria 1628
176 Ga0105237_10337076 3300009545 Unclassified 1512
177 Ga0105237_10498452 3300009545 Unclassified 1224
178 Ga0105238_10001544 3300009551 Bacteria 23076
179 Ga0105238_10006064 3300009551 Bacteria 11992
180 Ga0105238_10015760 3300009551 Bacteria 7653
181 Ga0105238_10054504 3300009551 Unclassified 4015
182 Ga0105238_10068947 3300009551 Unclassified 3537
183 Ga0105238_10070620 3300009551 Bacteria 3491
184 Ga0105238_10131756 3300009551 Unclassified 2478
185 Ga0105238_10434601 3300009551 Bacteria 1308
186 Ga0105238_10648543 3300009551 Unclassified 1066
187 Ga0105249_10002424 3300009553 Bacteria 16182
188 Ga0105249_10010763 3300009553 Bacteria 8038
189 Ga0105249_10047332 3300009553 Unclassified 3918
190 Ga0105249_10709422 3300009553 Unclassified 1066
191 Ga0105249_10755410 3300009553 Unclassified 1035
192 Ga0105239_10001170 3300010375 Bacteria 36090
193 Ga0105239_10003547 3300010375 Bacteria 19077
194 Ga0105239_10011736 3300010375 Bacteria 9779
195 Ga0105239_10017742 3300010375 Bacteria 7874
196 Ga0105239_10034783 3300010375 Bacteria 5534
197 Ga0105239_10113648 3300010375 Bacteria 3003
198 Ga0105239_10323977 3300010375 Bacteria 1738
199 Ga0157373_10244393 3300013100 Archaea 1269
200 Ga0157371_10207770 3300013102 Unclassified 1404
201 Ga0157370_10012818 3300013104 Bacteria 8666
202 Ga0157370_10014789 3300013104 Bacteria 7964
203 Ga0157370_10017698 3300013104 Bacteria 7184
204 Ga0157370_10037647 3300013104 Bacteria 4688
205 Ga0157370_10051684 3300013104 Bacteria 3925
206 Ga0157370_10066405 3300013104 Bacteria 3412
207 Ga0157370_10081279 3300013104 Unclassified 3049
208 Ga0157370_10103408 3300013104 Unclassified 2666
209 Ga0157370_10180853 3300013104 Bacteria 1959
210 Ga0157370_10264134 3300013104 Unclassified 1590
211 Ga0157369_10002552 3300013105 Bacteria 21794
212 Ga0157369_10004465 3300013105 Bacteria 16478
213 Ga0157369_10006067 3300013105 Bacteria 14021
214 Ga0157369_10006390 3300013105 Bacteria 13663
215 Ga0157369_10011358 3300013105 Bacteria 10115
216 Ga0157369_10015568 3300013105 Bacteria 8571
217 Ga0157369_10027595 3300013105 Bacteria 6290
218 Ga0157369_10038304 3300013105 Bacteria 5243
219 Ga0157369_10047122 3300013105 Bacteria 4683
220 Ga0157369_10060453 3300013105 Unclassified 4086
221 Ga0157369_10072859 3300013105 Unclassified 3686
222 Ga0157369_10105026 3300013105 Bacteria 3007
223 Ga0157369_10152156 3300013105 Bacteria 2445
224 Ga0157369_10154171 3300013105 Bacteria 2427
225 Ga0157369_10297673 3300013105 Bacteria 1679
226 Ga0157374_10004877 3300013296 Bacteria 11254
227 Ga0157374_10009651 3300013296 Bacteria 8289
228 Ga0157374_10015514 3300013296 Bacteria 6683
229 Ga0157374_10024704 3300013296 Bacteria 5387
230 Ga0157374_10125431 3300013296 Bacteria 2481
231 Ga0157374_10147371 3300013296 Bacteria 2287
232 Ga0157374_10163510 3300013296 Bacteria 2169
233 Ga0157374_10174818 3300013296 Unclassified 2096
234 Ga0157374_10192092 3300013296 Bacteria 1997
235 Ga0157378_10040828 3300013297 Bacteria 4116
236 Ga0157378_10181180 3300013297 Bacteria 1982
237 Ga0157378_10237808 3300013297 Unclassified 1739
238 Ga0157378_10431732 3300013297 Bacteria 1304
239 Ga0163162_10005738 3300013306 Bacteria 12002
240 Ga0157372_10002499 3300013307 Bacteria 19946
241 Ga0157372_10003567 3300013307 Bacteria 16747
242 Ga0157372_10011675 3300013307 Bacteria 9352
243 Ga0157372_10025751 3300013307 Bacteria 6399
244 Ga0157372_10028782 3300013307 Bacteria 6064
245 Ga0157372_10046119 3300013307 Bacteria 4837
246 Ga0157372_10062711 3300013307 Unclassified 4165
247 Ga0157372_10151063 3300013307 Unclassified 2681
248 Ga0157372_10166570 3300013307 Bacteria 2549
249 Ga0157372_10203578 3300013307 Bacteria 2293
250 Ga0157372_10240456 3300013307 Unclassified 2101
251 Ga0157372_10248512 3300013307 Bacteria 2064
252 Ga0157372_10354560 3300013307 Bacteria 1709
253 Ga0157372_10376582 3300013307 Bacteria 1654
254 Ga0157372_10578105 3300013307 Bacteria 1309
255 Ga0157375_10001484 3300013308 Bacteria 20136
256 Ga0157375_10039400 3300013308 Bacteria 4548
257 Ga0157375_10195048 3300013308 Bacteria 2180
258 Ga0163163_10247666 3300014325 Unclassified 1832
259 Ga0163163_10393642 3300014325 Bacteria 1444
260 Ga0157379_10085917 3300014968 Unclassified 2820
261 Ga0157379_10457345 3300014968 Bacteria 1179
262 Ga0157376_10007057 3300014969 Bacteria 7974
263 Ga0157376_10042098 3300014969 Bacteria 3743
264 Ga0157376_10130543 3300014969 Bacteria 2241
265 Ga0157376_10171068 3300014969 Unclassified 1978
266 Ga0154015_1542044 3300020610 Bacteria 1986
267 Ga0213872_10002246 3300021361 Bacteria 11545
268 Ga0213876_10003129 3300021384 Bacteria 9550
269 Ga0213875_10008535 3300021388 Bacteria 5240
270 Ga0213875_10029546 3300021388 Unclassified 2600
271 Ga0224572_1000488 3300024225 Bacteria 4727
272 Ga0228598_1000225 3300024227 Bacteria 10703
273 Ga0207647_10005304 3300025904 Bacteria 9474
274 Ga0207647_10035737 3300025904 Bacteria 3164
275 Ga0207647_10038718 3300025904 Unclassified 3013
276 Ga0207647_10195247 3300025904 Bacteria 1172
277 Ga0207705_10000021 3300025909 Bacteria 309436
278 Ga0207705_10029663 3300025909 Bacteria 3899
279 Ga0207705_10059083 3300025909 Unclassified 2766
280 Ga0207705_10082153 3300025909 Bacteria 2349
281 Ga0207705_10151503 3300025909 Unclassified 1738
282 Ga0207705_10260604 3300025909 Unclassified 1324
283 Ga0207684_10082627 3300025910 Bacteria 2736
284 Ga0207654_10050925 3300025911 Bacteria 2381
285 Ga0207707_10017982 3300025912 Bacteria 6162
286 Ga0207707_10120018 3300025912 Bacteria 2298
287 Ga0207707_10254842 3300025912 Bacteria 1524
288 Ga0207707_10271119 3300025912 Bacteria 1471
289 Ga0207695_10000398 3300025913 Bacteria 97114
290 Ga0207695_10001534 3300025913 Bacteria 38140
291 Ga0207695_10002219 3300025913 Bacteria 29206
292 Ga0207695_10006033 3300025913 Bacteria 15832
293 Ga0207695_10029131 3300025913 Bacteria 6108
294 Ga0207695_10029320 3300025913 Bacteria 6083
295 Ga0207695_10056987 3300025913 Bacteria 4063
296 Ga0207695_10063593 3300025913 Unclassified 3804
297 Ga0207695_10118346 3300025913 Bacteria 2620
298 Ga0207671_10000310 3300025914 Bacteria 72022
299 Ga0207671_10005637 3300025914 Bacteria 11473
300 Ga0207671_10013270 3300025914 Bacteria 6570
301 Ga0207671_10016685 3300025914 Bacteria 5699
302 Ga0207671_10031572 3300025914 Unclassified 3946
303 Ga0207671_10037523 3300025914 Bacteria 3593
304 Ga0207671_10227273 3300025914 Bacteria 1463
305 Ga0207693_10422028 3300025915 Unclassified 1043
306 Ga0207663_10103709 3300025916 Unclassified 1916
307 Ga0207660_10032168 3300025917 Bacteria 3619
308 Ga0207660_10072544 3300025917 Bacteria 2507
309 Ga0207657_10002287 3300025919 Bacteria 20761
310 Ga0207657_10018850 3300025919 Bacteria 6571
311 Ga0207657_10020231 3300025919 Bacteria 6296
312 Ga0207657_10020596 3300025919 Bacteria 6228
313 Ga0207657_10248558 3300025919 Bacteria 1418
314 Ga0207649_10024409 3300025920 Unclassified 3513
315 Ga0207649_10082987 3300025920 Bacteria 2079
316 Ga0207652_10042645 3300025921 Bacteria 3863
317 Ga0207652_10045002 3300025921 Unclassified 3762
318 Ga0207652_10117114 3300025921 Bacteria 2367
319 Ga0207652_10213227 3300025921 Unclassified 1739
320 Ga0207652_10508225 3300025921 Bacteria 1084
321 Ga0207646_10032064 3300025922 Unclassified 4755
322 Ga0207694_10008290 3300025924 Bacteria 7855
323 Ga0207694_10031888 3300025924 Unclassified 4029
324 Ga0207694_10051814 3300025924 Bacteria 3181
325 Ga0207694_10093867 3300025924 Unclassified 2370
326 Ga0207694_10132030 3300025924 Bacteria 2002
327 Ga0207694_10185470 3300025924 Bacteria 1688
328 Ga0207687_10001368 3300025927 Bacteria 16690
329 Ga0207687_10021899 3300025927 Unclassified 4249
330 Ga0207700_10067507 3300025928 Unclassified 2738
331 Ga0207664_10042284 3300025929 Unclassified 3556
332 Ga0207664_10056763 3300025929 Unclassified 3111
333 Ga0207664_10142147 3300025929 Bacteria 2031
334 Ga0207664_10156496 3300025929 Bacteria 1941
335 Ga0207644_10137522 3300025931 Bacteria 1877
336 Ga0207690_10011403 3300025932 Bacteria 5315
337 Ga0207690_10031718 3300025932 Bacteria 3384
338 Ga0207690_10200068 3300025932 Bacteria 1517
339 Ga0207709_10152360 3300025935 Unclassified 1603
340 Ga0207704_10043246 3300025938 Bacteria 2658
341 Ga0207711_10014360 3300025941 Bacteria 6577
342 Ga0207711_10056770 3300025941 Bacteria 3364
343 Ga0207661_10010726 3300025944 Bacteria 6604
344 Ga0207661_10012503 3300025944 Bacteria 6169
345 Ga0207661_10119180 3300025944 Bacteria 2244
346 Ga0207661_10218469 3300025944 Bacteria 1684
347 Ga0207661_10464670 3300025944 Unclassified 1154
348 Ga0207679_10111304 3300025945 Unclassified 2162
349 Ga0207679_10341302 3300025945 Bacteria 1303
350 Ga0207667_10001927 3300025949 Bacteria 26034
351 Ga0207667_10006256 3300025949 Bacteria 14451
352 Ga0207667_10007397 3300025949 Bacteria 13210
353 Ga0207667_10035103 3300025949 Bacteria 5381
354 Ga0207667_10073378 3300025949 Unclassified 3556
355 Ga0207667_10146197 3300025949 Bacteria 2433
356 Ga0207667_10245090 3300025949 Bacteria 1834
357 Ga0207667_10310943 3300025949 Bacteria 1609
358 Ga0207667_10639479 3300025949 Bacteria 1070
359 Ga0207667_10736269 3300025949 Archaea 986
360 Ga0207712_10013884 3300025961 Bacteria 5165
361 Ga0207712_10035307 3300025961 Unclassified 3396
362 Ga0207712_10047546 3300025961 Unclassified 2979
363 Ga0207640_10000001 3300025981 Bacteria 628778
364 Ga0207640_10027307 3300025981 Bacteria 3476
365 Ga0207640_10033916 3300025981 Unclassified 3181
366 Ga0207703_10021166 3300026035 Bacteria 5090
367 Ga0207703_10317156 3300026035 Bacteria 1426
368 Ga0207639_10000023 3300026041 Bacteria 215340
369 Ga0207639_10020931 3300026041 Unclassified 4692
370 Ga0207678_10017810 3300026067 Bacteria 6237
371 Ga0207678_10105135 3300026067 Unclassified 2409
372 Ga0207678_10113242 3300026067 Unclassified 2314
373 Ga0207678_10429615 3300026067 Bacteria 1146
374 Ga0207702_10047120 3300026078 Bacteria 3631
375 Ga0207702_10090850 3300026078 Unclassified 2673
376 Ga0207702_10210079 3300026078 Bacteria 1809
377 Ga0207702_10223773 3300026078 Bacteria 1755
378 Ga0207641_10027193 3300026088 Bacteria 4724
379 Ga0207676_10071060 3300026095 Bacteria 2793
380 Ga0207674_10010982 3300026116 Bacteria 10191
381 Ga0207674_10425411 3300026116 Bacteria 1283
382 Ga0207698_10015765 3300026142 Bacteria 5075
383 Ga0207698_10094500 3300026142 Bacteria 2458
384 Ga0207698_10281496 3300026142 Bacteria 1538
385 Ga0207698_10341745 3300026142 Unclassified 1410
386 Ga0268266_10005687 3300028379 Bacteria 11558
387 Ga0268266_10010073 3300028379 Bacteria 8287
388 Ga0268266_10166203 3300028379 Unclassified 1999
389 Ga0268266_10589343 3300028379 Bacteria 1067
390 Ga0265334_10058197 3300028573 Unclassified 1463
391 Ga0265318_10026081 3300028577 Bacteria 2304
392 Ga0265318_10038742 3300028577 Unclassified 1821
393 Ga0265336_10002766 3300028666 Bacteria 7087
394 Ga0265338_10001701 3300028800 Bacteria 34933
395 Ga0265338_10002509 3300028800 Bacteria 27326
396 Ga0265338_10069404 3300028800 Bacteria 3028
397 Ga0265338_10156936 3300028800 Unclassified 1761
398 Ga0265762_1009530 3300030760 Bacteria 1732
399 Ga0265762_1013155 3300030760 Bacteria 1489
400 Ga0265766_1000712 3300030863 Bacteria 1491
401 Ga0265760_10014148 3300031090 Bacteria 2283
402 Ga0265330_10000200 3300031235 Bacteria 46237
403 Ga0265330_10118791 3300031235 Bacteria 1127
404 Ga0265328_10016616 3300031239 Unclassified 2859
405 Ga0265328_10018487 3300031239 Unclassified 2687
406 Ga0265328_10059690 3300031239 Unclassified 1400
407 Ga0265320_10116297 3300031240 Unclassified 1222
408 Ga0265325_10000441 3300031241 Bacteria 29835
409 Ga0265325_10006121 3300031241 Bacteria 7347
410 Ga0265325_10019496 3300031241 Unclassified 3748
411 Ga0265325_10045613 3300031241 Unclassified 2277
412 Ga0265329_10051121 3300031242 Unclassified 1316
413 Ga0265340_10008974 3300031247 Bacteria 5387
414 Ga0265340_10016910 3300031247 Bacteria 3774
415 Ga0265340_10047973 3300031247 Bacteria 2077
416 Ga0265340_10062685 3300031247 Bacteria 1775
417 Ga0265340_10124065 3300031247 Unclassified 1187
418 Ga0265339_10000558 3300031249 Bacteria 29113
419 Ga0265339_10000720 3300031249 Bacteria 25691
420 Ga0265339_10003347 3300031249 Bacteria 11226
421 Ga0265339_10021000 3300031249 Unclassified 3807
422 Ga0265339_10031251 3300031249 Unclassified 3010
423 Ga0265339_10139690 3300031249 Bacteria 1233
424 Ga0265331_10017733 3300031250 Bacteria 3708
425 Ga0265316_10003984 3300031344 Bacteria 14789
426 Ga0265316_10004243 3300031344 Bacteria 14322
427 Ga0265316_10008375 3300031344 Bacteria 9602
428 Ga0265316_10011761 3300031344 Bacteria 7873
429 Ga0265316_10017900 3300031344 Bacteria 6108
430 Ga0265316_10028573 3300031344 Bacteria 4598
431 Ga0265316_10029077 3300031344 Bacteria 4549
432 Ga0265316_10039698 3300031344 Bacteria 3779
433 Ga0265316_10072569 3300031344 Bacteria 2651
434 Ga0265316_10167940 3300031344 Unclassified 1638
435 Ga0265316_10173057 3300031344 Bacteria 1610
436 Ga0265313_10004177 3300031595 Bacteria 11217
437 Ga0265313_10012203 3300031595 Bacteria 5269
438 Ga0265313_10016298 3300031595 Unclassified 4279
439 Ga0265314_10000025 3300031711 Bacteria 292548
440 Ga0265314_10002510 3300031711 Bacteria 18722
441 Ga0265314_10009633 3300031711 Bacteria 8135
442 Ga0265314_10137813 3300031711 Bacteria 1513
443 Ga0265314_10218376 3300031711 Bacteria 1114
444 Ga0265342_10000635 3300031712 Bacteria 36796
445 Ga0265342_10002963 3300031712 Bacteria 14275
446 Ga0265342_10009570 3300031712 Bacteria 6810
447 Ga0265342_10009667 3300031712 Bacteria 6763
448 Ga0265342_10011792 3300031712 Bacteria 5957
449 Ga0265342_10022880 3300031712 Bacteria 3965
450 Ga0265342_10166943 3300031712 Unclassified 1213
451 Ga0316583_10033826 3300032133 Unclassified 1815
452 Ga0373923_0132238 3300035111 Unclassified 1122
453 Ga0373953_0124876 3300035117 Unclassified 1095
454 Ga0373954_0135026 3300035118 Bacteria 1202
455 Ga0373956_0047212 3300035119 Unclassified 1926
456 Ga0373955_0025863 3300035172 Bacteria 3018
457 Ga0373935_0018562 3300035692 Bacteria 4233
458 Ga0373927_0109080 3300035695 Bacteria 1803
459 Ga0373927_0336249 3300035695 Bacteria 995
460 Ga0373947_0064982 3300035725 Bacteria 2225
461 Ga0373937_0028137 3300036401 Bacteria 5086
462 Ga0373937_0076758 3300036401 Unclassified 3086
463 Ga0373937_0108315 3300036401 Bacteria 2584
464 Ga0373937_0305862 3300036401 Bacteria 1503
465 Ga0373925_0042822 3300037068 Bacteria 3359
466 Ga0395900_0228543 3300037418 Bacteria 1872
467 Ga0395900_0273254 3300037418 Bacteria 1684
468 Ga0395898_0099022 3300037466 Bacteria 2799
469 Ga0395898_0276579 3300037466 Unclassified 1601
470 Ga0395898_0451629 3300037466 Archaea 1224
471 Ga0395905_0077965 3300037471 Bacteria 3105
472 Ga0436364_0013135 3300037853 Bacteria 7364
473 Ga0436364_0193292 3300037853 Bacteria 2077
474 Ga0436364_0324260 3300037853 Unclassified 1382
475 Ga0436364_0366372 3300037853 Bacteria 231753
476 Ga0436364_0637038 3300037853 Bacteria 6508
477 Ga0436364_0816548 3300037853 Bacteria 1917
478 Ga0436364_1091631 3300037853 Bacteria 18124
479 Ga0436364_1322559 3300037853 Bacteria 11118
480 Ga0436364_1333021 3300037853 Bacteria 5502
481 Ga0436364_1472691 3300037853 Bacteria 1355
482 Ga0436364_1538256 3300037853 Bacteria 7382
483 Ga0395901_0837552 3300038443 Unclassified 906
484 Ga0436365_1240177 3300039437 Unclassified 3474
485 Ga0436365_1558821 3300039437 Unclassified 4433
486 Ga0436365_1690851 3300039437 Bacteria 3573
487 Ga0436361_0335407 3300039447 Bacteria 151349
488 Ga0436363_1284651 3300039450 Bacteria 2839
489 Ga0436363_1481145 3300039450 Unclassified 2562
490 Ga0466966_0051680 3300044684 Bacteria 2612
491 Ga0466966_0070403 3300044684 Bacteria 2193
492 Ga0466971_0146868 3300044719 Unclassified 1100
493 Ga0466959_0132561 3300045049 Unclassified 1766
494 Ga0451576_0403573 3300045051 Bacteria 1433
495 Ga0466967_0028649 3300045976 Bacteria 4653
496 Ga0466967_0775795 3300045976 Unclassified 951
497 Ga0495629_0024905 3300046459 Bacteria 4257
498 Ga0495651_0051064 3300046462 Bacteria 3189
499 Ga0495653_0037330 3300046463 Bacteria 3818
500 Ga0495580_0044832 3300046472 Bacteria 3144
501 Ga0495580_0065217 3300046472 Bacteria 2551
502 Ga0495580_0070907 3300046472 Unclassified 2434
503 Ga0495580_0102141 3300046472 Bacteria 1994
504 Ga0495580_0385668 3300046472 Unclassified 946
505 Ga0495582_0003327 3300046473 Bacteria 9037
506 Ga0495662_0008082 3300046476 Bacteria 5184
507 Ga0495585_0209639 3300046492 Unclassified 988
508 Ga0495594_0001072 3300046499 Bacteria 14263
509 Ga0495594_0008646 3300046499 Bacteria 5247
510 Ga0495596_0040838 3300046500 Unclassified 1830
511 Ga0495583_0017597 3300046506 Unclassified 3789
512 Ga0495608_0107435 3300046511 Bacteria 1796
513 Ga0495628_0054324 3300046516 Bacteria 3158
514 Ga0495630_0035109 3300046517 Bacteria 3747
515 Ga0495630_0550952 3300046517 Bacteria 884
516 Ga0495632_0086562 3300046519 Bacteria 1490
517 Ga0495644_0000941 3300046523 Bacteria 12046
518 Ga0495666_0008973 3300046526 Bacteria 5003
519 Ga0495652_0008324 3300046529 Bacteria 9476
520 Ga0495665_0015459 3300046531 Bacteria 4109
521 Ga0495665_0030995 3300046531 Bacteria 2862
522 Ga0495640_0018251 3300046533 Bacteria 5209
523 Ga0495586_0044888 3300046535 Bacteria 2381
524 Ga0495609_0018045 3300046538 Unclassified 3273
525 Ga0495645_0033993 3300046543 Bacteria 3720
526 Ga0495645_0082252 3300046543 Bacteria 2309
527 Ga0495667_0052097 3300046559 Bacteria 2698
528 Ga0495668_0071687 3300046616 Bacteria 1904
529 Ga0495634_0002868 3300046642 Bacteria 14135
530 Ga0495611_0037980 3300046648 Unclassified 2141
531 Ga0495625_0021906 3300046660 Bacteria 4908
532 Ga0495635_0010650 3300046663 Bacteria 6438
533 Ga0495661_0086119 3300046665 Unclassified 1799
534 Ga0495588_0153788 3300046674 Bacteria 1216
535 Ga0495599_0028583 3300046678 Bacteria 3495
536 Ga0495658_0108139 3300046683 Bacteria 1669
537 Ga0495669_0004175 3300046684 Bacteria 5943
538 Ga0495613_0053279 3300046689 Bacteria 2977
539 Ga0495613_0146041 3300046689 Bacteria 1688
540 Ga0495624_0003543 3300046690 Bacteria 11568
541 Ga0495670_0039993 3300046691 Unclassified 2339
542 Ga0495649_0024191 3300046694 Bacteria 3388
543 Ga0495600_0000838 3300046809 Bacteria 16387
544 Ga0495604_0020659 3300047317 Bacteria 5257
545 Ga0495604_0201060 3300047317 Bacteria 1382
546 Ga0495674_0005547 3300047319 Bacteria 12098
547 Ga0495674_0152207 3300047319 Unclassified 1939
548 Ga0495676_0004046 3300047321 Bacteria 13349
549 Ga0495680_0015208 3300047322 Bacteria 6644
550 Ga0495687_029324 3300047443 Bacteria 2549
551 Ga0495675_0002219 3300047444 Bacteria 11590
552 Ga0495684_0098839 3300047471 Bacteria 2206
553 Ga0495614_0004534 3300048089 Bacteria 6263
554 Ga0496100_0034886 3300048903 Unclassified 3161
555 Ga0496104_0112657 3300048907 Bacteria 2609
556 Ga0496105_0097479 3300048908 Unclassified 2428
557 Ga0496108_0107949 3300048911 Bacteria 2377
558 Ga0496109_0021477 3300048912 Bacteria 5709
559 Ga0496110_0039331 3300048913 Bacteria 4118
560 Ga0496112_0043420 3300048915 Unclassified 4401
561 Ga0496112_0134407 3300048915 Bacteria 2444
562 Ga0496114_0170222 3300048917 Unclassified 1898
563 Ga0496115_0155217 3300048918 Bacteria 1891
564 Ga0496115_0199979 3300048918 Unclassified 1651
565 Ga0496115_0218264 3300048918 Bacteria 1574
566 Ga0496115_0242268 3300048918 Bacteria 1486
567 Ga0496126_0000942 3300048929 Bacteria 50132
568 Ga0496126_0142336 3300048929 Bacteria 2063
569 Ga0501031_0003673 3300049568 Bacteria 9873
570 Ga0501032_0012410 3300049569 Bacteria 6089
571 Ga0501033_0014279 3300049570 Bacteria 6035
572 Ga0501034_0021395 3300049571 Bacteria 6592
573 Ga0501036_0006079 3300049572 Bacteria 9793
574 Ga0501037_0001348 3300049573 Bacteria 18045
575 Ga0501043_0005930 3300049579 Bacteria 9825
576 Ga0501046_0004398 3300049580 Bacteria 12802
577 Ga0501047_0010726 3300049581 Bacteria 8661
578 Ga0501067_0035669 3300049583 Bacteria 2761
579 Ga0501068_0000078 3300049584 Bacteria 39422
580 Ga0501069_0002303 3300049585 Bacteria 9636
581 Ga0501070_0010972 3300049586 Bacteria 7648
582 Ga0501072_0004621 3300049588 Bacteria 10486
583 Ga0501073_0000509 3300049589 Bacteria 27250
584 Ga0501074_0006160 3300049590 Bacteria 8661
585 Ga0501076_0085590 3300049592 Bacteria 2533
586 Ga0501077_0002702 3300049593 Bacteria 10636
587 Ga0501079_0000321 3300049741 Bacteria 30186
588 Ga0501080_0000442 3300049742 Bacteria 32157
589 Ga0501083_0006004 3300049744 Bacteria 8603
590 Ga0501035_0008312 3300049822 Bacteria 9665
591 Ga0501044_0006187 3300049823 Bacteria 13227
592 Ga0501044_0008328 3300049823 Bacteria 11361
593 nmdc:mga0n895_510094_c1 3300050512 Unclassified 1211
594 Ga0500595_000039 3300053119 Bacteria 100396
595 Ga0500595_010581 3300053119 Bacteria 3659
596 Ga0500595_021626 3300053119 Bacteria 2292
597 Ga0501084_0001079 3300054114 Bacteria 21235
598 Ga0501082_0000756 3300060353 Bacteria 28367
599 Ga0157369_10019527
600 Ga0070658_10019622
601 Ga0070658_10039888
602 Ga0070658_10045940
603 Ga0070658_10096997
604 Ga0070658_10112987
605 Ga0070658_10212442
606 Ga0070658_10272018
607 Ga0070683_100005597
608 Ga0070683_100029641
609 Ga0070683_100039974
610 Ga0070666_10066592
611 Ga0070666_10402405
612 Ga0070680_100010431
613 Ga0070680_100019766
614 Ga0070680_100038657
615 Ga0068868_100025061
616 Ga0070660_100004375
617 Ga0070660_100011208
618 Ga0070660_100020089
619 Ga0070660_100076414
620 Ga0070661_100017359
621 Ga0070661_100098720
622 Ga0070659_100001030
623 Ga0070659_100006418
624 Ga0070659_100024110
625 Ga0070667_100109707
626 Ga0070709_10124773
627 Ga0070714_100012180
628 Ga0070714_100024092
629 Ga0070714_100033898
630 Ga0070714_100509025
631 Ga0070713_100034320
632 Ga0070713_100320998
633 Ga0070711_100022375
634 Ga0070705_100040530
635 Ga0070708_100223354
636 Ga0070708_100384281
637 Ga0070663_100063068
638 Ga0070663_100253340
639 Ga0070663_100305239
640 Ga0070681_10001139
641 Ga0070681_10028431
642 Ga0070681_10045407
643 Ga0070681_10089116
644 Ga0070681_10090312
645 Ga0070681_10124204
646 Ga0070681_10160873
647 Ga0070681_10439535
648 Ga0070706_100236314
649 Ga0070707_100084484
650 Ga0070698_100011088
651 Ga0070699_100111207
652 Ga0070679_100019100
653 Ga0070679_100029891
654 Ga0070679_100038448
655 Ga0070679_100147518
656 Ga0070679_100178141
657 Ga0070684_100027609
658 Ga0070684_100051516
659 Ga0070684_100132702
660 Ga0070684_100134480
661 Ga0070684_100153062
662 Ga0070684_100172588
663 Ga0070684_100709816
664 Ga0070697_100105357
665 Ga0070697_100486388
666 Ga0068853_100000020
667 Ga0068853_100009335
668 Ga0068853_100078007
669 Ga0068853_100117054
670 Ga0068853_100202000
671 Ga0070695_100032759
672 Ga0070696_100004115
673 Ga0070696_100026877
674 Ga0070665_100076995
675 Ga0070665_100300762
676 Ga0070665_100312440
677 Ga0070665_100382137
678 Ga0068855_100000760
679 Ga0068855_100010159
680 Ga0068855_100020516
681 Ga0068855_100030070
682 Ga0068855_100030254
683 Ga0068855_100049876
684 Ga0068855_100071035
685 Ga0068855_100073803
686 Ga0068855_100108307
687 Ga0068855_100233467
688 Ga0068855_100379160
689 Ga0068855_100395018
690 Ga0070664_100128728
691 Ga0070664_100186276
692 Ga0068854_100000112
693 Ga0068854_100025724
694 Ga0068856_100005948
695 Ga0068856_100044192
696 Ga0068856_100044567
697 Ga0068856_100088400
698 Ga0068856_100098852
699 Ga0068856_100304275
700 Ga0068856_100402823
701 Ga0068856_100539710
702 Ga0068852_100010407
703 Ga0068852_100035525
704 Ga0068852_100044224
705 Ga0068852_100150258
706 Ga0068852_100314761
707 Ga0068852_100579674
708 Ga0068859_100007115
709 Ga0068859_100548710
710 Ga0068864_100036984
711 Ga0068851_10015278
712 Ga0068851_10098089
713 Ga0068863_100022576
714 Ga0068858_100028907
715 Ga0070717_10233441
716 Ga0070717_10339193
717 Ga0070716_100086332
718 Ga0070712_100383769
719 Ga0070712_100500562
720 Ga0097621_100364288
721 Ga0068871_100009837
722 Ga0068871_100028225
723 Ga0068871_100271703
724 Ga0075428_100064805
725 Ga0075434_100542503
726 Ga0068865_100053935
727 Ga0075436_100001482
728 Ga0097620_100007115
729 Ga0097620_100548682
730 Ga0075435_100099904
731 Ga0105240_10000426
732 Ga0105240_10001139
733 Ga0105240_10003685
734 Ga0105240_10004479
735 Ga0105240_10007741
736 Ga0105240_10013870
737 Ga0105240_10024750
738 Ga0105240_10038829
739 Ga0105240_10106509
740 Ga0105240_10142952
741 Ga0105240_10169634
742 Ga0105240_10216878
743 Ga0105240_10235591
744 Ga0105240_10282880
745 Ga0105240_10364076
746 Ga0111539_10312335
747 Ga0105245_10000276
748 Ga0105245_10017542
749 Ga0105245_10052678
750 Ga0105245_10225473
751 Ga0105243_10061964
752 Ga0105241_10000455
753 Ga0105241_10009122
754 Ga0105241_10081245
755 Ga0105241_10100040
756 Ga0105242_11089306
757 Ga0105248_10017782
758 Ga0105248_10039490
759 Ga0105248_10050900
760 Ga0105248_10072386
761 Ga0105248_10138358
762 Ga0105248_10149782
763 Ga0105248_10487559
764 Ga0105237_10000181
765 Ga0105237_10002694
766 Ga0105237_10003286
767 Ga0105237_10003996
768 Ga0105237_10020792
769 Ga0105237_10023960
770 Ga0105237_10024604
771 Ga0105237_10062867
772 Ga0105237_10068693
773 Ga0105237_10293622
774 Ga0105237_10337076
775 Ga0105237_10498452
776 Ga0105238_10001544
777 Ga0105238_10006064
778 Ga0105238_10015760
779 Ga0105238_10054504
780 Ga0105238_10068947
781 Ga0105238_10070620
782 Ga0105238_10131756
783 Ga0105238_10434601
784 Ga0105238_10648543
785 Ga0105249_10002424
786 Ga0105249_10010763
787 Ga0105249_10047332
788 Ga0105249_10709422
789 Ga0105249_10755410
790 Ga0105239_10001170
791 Ga0105239_10003547
792 Ga0105239_10011736
793 Ga0105239_10017742
794 Ga0105239_10034783
795 Ga0105239_10113648
796 Ga0105239_10323977
797 Ga0157373_10244393
798 Ga0157371_10207770
799 Ga0157370_10012818
800 Ga0157370_10014789
801 Ga0157370_10017698
802 Ga0157370_10037647
803 Ga0157370_10051684
804 Ga0157370_10066405
805 Ga0157370_10081279
806 Ga0157370_10103408
807 Ga0157370_10180853
808 Ga0157370_10264134
809 Ga0157369_10002552
810 Ga0157369_10004465
811 Ga0157369_10006067
812 Ga0157369_10006390
813 Ga0157369_10011358
814 Ga0157369_10015568
815 Ga0157369_10027595
816 Ga0157369_10038304
817 Ga0157369_10047122
818 Ga0157369_10060453
819 Ga0157369_10072859
820 Ga0157369_10105026
821 Ga0157369_10152156
822 Ga0157369_10154171
823 Ga0157369_10297673
824 Ga0157374_10004877
825 Ga0157374_10009651
826 Ga0157374_10015514
827 Ga0157374_10024704
828 Ga0157374_10125431
829 Ga0157374_10147371
830 Ga0157374_10163510
831 Ga0157374_10174818
832 Ga0157374_10192092
833 Ga0157378_10040828
834 Ga0157378_10181180
835 Ga0157378_10237808
836 Ga0157378_10431732
837 Ga0163162_10005738
838 Ga0157372_10002499
839 Ga0157372_10003567
840 Ga0157372_10011675
841 Ga0157372_10025751
842 Ga0157372_10028782
843 Ga0157372_10046119
844 Ga0157372_10062711
845 Ga0157372_10151063
846 Ga0157372_10166570
847 Ga0157372_10203578
848 Ga0157372_10240456
849 Ga0157372_10248512
850 Ga0157372_10354560
851 Ga0157372_10376582
852 Ga0157372_10578105
853 Ga0157375_10001484
854 Ga0157375_10039400
855 Ga0157375_10195048
856 Ga0163163_10247666
857 Ga0163163_10393642
858 Ga0157379_10085917
859 Ga0157379_10457345
860 Ga0157376_10007057
861 Ga0157376_10042098
862 Ga0157376_10130543
863 Ga0157376_10171068
864 Ga0154015_1542044
865 Ga0213872_10002246
866 Ga0213876_10003129
867 Ga0213875_10008535
868 Ga0213875_10029546
869 Ga0224572_1000488
870 Ga0228598_1000225
871 Ga0207647_10005304
872 Ga0207647_10035737
873 Ga0207647_10038718
874 Ga0207647_10195247
875 Ga0207705_10000021
876 Ga0207705_10029663
877 Ga0207705_10059083
878 Ga0207705_10082153
879 Ga0207705_10151503
880 Ga0207705_10260604
881 Ga0207684_10082627
882 Ga0207654_10050925
883 Ga0207707_10017982
884 Ga0207707_10120018
885 Ga0207707_10254842
886 Ga0207707_10271119
887 Ga0207695_10000398
888 Ga0207695_10001534
889 Ga0207695_10002219
890 Ga0207695_10006033
891 Ga0207695_10029131
892 Ga0207695_10029320
893 Ga0207695_10056987
894 Ga0207695_10063593
895 Ga0207695_10118346
896 Ga0207671_10000310
897 Ga0207671_10005637
898 Ga0207671_10013270
899 Ga0207671_10016685
900 Ga0207671_10031572
901 Ga0207671_10037523
902 Ga0207671_10227273
903 Ga0207693_10422028
904 Ga0207663_10103709
905 Ga0207660_10032168
906 Ga0207660_10072544
907 Ga0207657_10002287
908 Ga0207657_10018850
909 Ga0207657_10020231
910 Ga0207657_10020596
911 Ga0207657_10248558
912 Ga0207649_10024409
913 Ga0207649_10082987
914 Ga0207652_10042645
915 Ga0207652_10045002
916 Ga0207652_10117114
917 Ga0207652_10213227
918 Ga0207652_10508225
919 Ga0207646_10032064
920 Ga0207694_10008290
921 Ga0207694_10031888
922 Ga0207694_10051814
923 Ga0207694_10093867
924 Ga0207694_10132030
925 Ga0207694_10185470
926 Ga0207687_10001368
927 Ga0207687_10021899
928 Ga0207700_10067507
929 Ga0207664_10042284
930 Ga0207664_10056763
931 Ga0207664_10142147
932 Ga0207664_10156496
933 Ga0207644_10137522
934 Ga0207690_10011403
935 Ga0207690_10031718
936 Ga0207690_10200068
937 Ga0207709_10152360
938 Ga0207704_10043246
939 Ga0207711_10014360
940 Ga0207711_10056770
941 Ga0207661_10010726
942 Ga0207661_10012503
943 Ga0207661_10119180
944 Ga0207661_10218469
945 Ga0207661_10464670
946 Ga0207679_10111304
947 Ga0207679_10341302
948 Ga0207667_10001927
949 Ga0207667_10006256
950 Ga0207667_10007397
951 Ga0207667_10035103
952 Ga0207667_10073378
953 Ga0207667_10146197
954 Ga0207667_10245090
955 Ga0207667_10310943
956 Ga0207667_10639479
957 Ga0207667_10736269
958 Ga0207712_10013884
959 Ga0207712_10035307
960 Ga0207712_10047546
961 Ga0207640_10000001
962 Ga0207640_10027307
963 Ga0207640_10033916
964 Ga0207703_10021166
965 Ga0207703_10317156
966 Ga0207639_10000023
967 Ga0207639_10020931
968 Ga0207678_10017810
969 Ga0207678_10105135
970 Ga0207678_10113242
971 Ga0207678_10429615
972 Ga0207702_10047120
973 Ga0207702_10090850
974 Ga0207702_10210079
975 Ga0207702_10223773
976 Ga0207641_10027193
977 Ga0207676_10071060
978 Ga0207674_10010982
979 Ga0207674_10425411
980 Ga0207698_10015765
981 Ga0207698_10094500
982 Ga0207698_10281496
983 Ga0207698_10341745
984 Ga0268266_10005687
985 Ga0268266_10010073
986 Ga0268266_10166203
987 Ga0268266_10589343
988 Ga0265334_10058197
989 Ga0265318_10026081
990 Ga0265318_10038742
991 Ga0265336_10002766
992 Ga0265338_10001701
993 Ga0265338_10002509
994 Ga0265338_10069404
995 Ga0265338_10156936
996 Ga0265762_1009530
997 Ga0265762_1013155
998 Ga0265766_1000712
999 Ga0265760_10014148
1000 Ga0265330_10000200
1001 Ga0265330_10118791
1002 Ga0265328_10016616
1003 Ga0265328_10018487
1004 Ga0265328_10059690
1005 Ga0265320_10116297
1006 Ga0265325_10000441
1007 Ga0265325_10006121
1008 Ga0265325_10019496
1009 Ga0265325_10045613
1010 Ga0265329_10051121
1011 Ga0265340_10008974
1012 Ga0265340_10016910
1013 Ga0265340_10047973
1014 Ga0265340_10062685
1015 Ga0265340_10124065
1016 Ga0265339_10000558
1017 Ga0265339_10000720
1018 Ga0265339_10003347
1019 Ga0265339_10021000
1020 Ga0265339_10031251
1021 Ga0265339_10139690
1022 Ga0265331_10017733
1023 Ga0265316_10003984
1024 Ga0265316_10004243
1025 Ga0265316_10008375
1026 Ga0265316_10011761
1027 Ga0265316_10017900
1028 Ga0265316_10028573
1029 Ga0265316_10029077
1030 Ga0265316_10039698
1031 Ga0265316_10072569
1032 Ga0265316_10167940
1033 Ga0265316_10173057
1034 Ga0265313_10004177
1035 Ga0265313_10012203
1036 Ga0265313_10016298
1037 Ga0265314_10000025
1038 Ga0265314_10002510
1039 Ga0265314_10009633
1040 Ga0265314_10137813
1041 Ga0265314_10218376
1042 Ga0265342_10000635
1043 Ga0265342_10002963
1044 Ga0265342_10009570
1045 Ga0265342_10009667
1046 Ga0265342_10011792
1047 Ga0265342_10022880
1048 Ga0265342_10166943
1049 Ga0316583_10033826
1050 Ga0373923_0132238
1051 Ga0373953_0124876
1052 Ga0373954_0135026
1053 Ga0373956_0047212
1054 Ga0373955_0025863
1055 Ga0373935_0018562
1056 Ga0373927_0109080
1057 Ga0373927_0336249
1058 Ga0373947_0064982
1059 Ga0373937_0028137
1060 Ga0373937_0076758
1061 Ga0373937_0108315
1062 Ga0373937_0305862
1063 Ga0373925_0042822
1064 Ga0395900_0228543
1065 Ga0395900_0273254
1066 Ga0395898_0099022
1067 Ga0395898_0276579
1068 Ga0395898_0451629
1069 Ga0395905_0077965
1070 Ga0436364_0013135
1071 Ga0436364_0193292
1072 Ga0436364_0324260
1073 Ga0436364_0366372
1074 Ga0436364_0637038
1075 Ga0436364_0816548
1076 Ga0436364_1091631
1077 Ga0436364_1322559
1078 Ga0436364_1333021
1079 Ga0436364_1472691
1080 Ga0436364_1538256
1081 Ga0395901_0837552
1082 Ga0436365_1240177
1083 Ga0436365_1558821
1084 Ga0436365_1690851
1085 Ga0436361_0335407
1086 Ga0436363_1284651
1087 Ga0436363_1481145
1088 Ga0466966_0051680
1089 Ga0466966_0070403
1090 Ga0466971_0146868
1091 Ga0466959_0132561
1092 Ga0451576_0403573
1093 Ga0466967_0028649
1094 Ga0466967_0775795
1095 Ga0495629_0024905
1096 Ga0495651_0051064
1097 Ga0495653_0037330
1098 Ga0495580_0044832
1099 Ga0495580_0065217
1100 Ga0495580_0070907
1101 Ga0495580_0102141
1102 Ga0495580_0385668
1103 Ga0495582_0003327
1104 Ga0495662_0008082
1105 Ga0495585_0209639
1106 Ga0495594_0001072
1107 Ga0495594_0008646
1108 Ga0495596_0040838
1109 Ga0495583_0017597
1110 Ga0495608_0107435
1111 Ga0495628_0054324
1112 Ga0495630_0035109
1113 Ga0495630_0550952
1114 Ga0495632_0086562
1115 Ga0495644_0000941
1116 Ga0495666_0008973
1117 Ga0495652_0008324
1118 Ga0495665_0015459
1119 Ga0495665_0030995
1120 Ga0495640_0018251
1121 Ga0495586_0044888
1122 Ga0495609_0018045
1123 Ga0495645_0033993
1124 Ga0495645_0082252
1125 Ga0495667_0052097
1126 Ga0495668_0071687
1127 Ga0495634_0002868
1128 Ga0495611_0037980
1129 Ga0495625_0021906
1130 Ga0495635_0010650
1131 Ga0495661_0086119
1132 Ga0495588_0153788
1133 Ga0495599_0028583
1134 Ga0495658_0108139
1135 Ga0495669_0004175
1136 Ga0495613_0053279
1137 Ga0495613_0146041
1138 Ga0495624_0003543
1139 Ga0495670_0039993
1140 Ga0495649_0024191
1141 Ga0495600_0000838
1142 Ga0495604_0020659
1143 Ga0495604_0201060
1144 Ga0495674_0005547
1145 Ga0495674_0152207
1146 Ga0495676_0004046
1147 Ga0495680_0015208
1148 Ga0495687_029324
1149 Ga0495675_0002219
1150 Ga0495684_0098839
1151 Ga0495614_0004534
1152 Ga0496100_0034886
1153 Ga0496104_0112657
1154 Ga0496105_0097479
1155 Ga0496108_0107949
1156 Ga0496109_0021477
1157 Ga0496110_0039331
1158 Ga0496112_0043420
1159 Ga0496112_0134407
1160 Ga0496114_0170222
1161 Ga0496115_0155217
1162 Ga0496115_0199979
1163 Ga0496115_0218264
1164 Ga0496115_0242268
1165 Ga0496126_0000942
1166 Ga0496126_0142336
1167 Ga0501031_0003673
1168 Ga0501032_0012410
1169 Ga0501033_0014279
1170 Ga0501034_0021395
1171 Ga0501036_0006079
1172 Ga0501037_0001348
1173 Ga0501043_0005930
1174 Ga0501046_0004398
1175 Ga0501047_0010726
1176 Ga0501067_0035669
1177 Ga0501068_0000078
1178 Ga0501069_0002303
1179 Ga0501070_0010972
1180 Ga0501072_0004621
1181 Ga0501073_0000509
1182 Ga0501074_0006160
1183 Ga0501076_0085590
1184 Ga0501077_0002702
1185 Ga0501079_0000321
1186 Ga0501080_0000442
1187 Ga0501083_0006004
1188 Ga0501035_0008312
1189 Ga0501044_0006187
1190 Ga0501044_0008328
1191 nmdc:mga0n895_510094_c1
1192 Ga0500595_000039
1193 Ga0500595_010581
1194 Ga0500595_021626
1195 Ga0501084_0001079
1196 Ga0501082_0000756

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16976

RcpC

Flp pilus assembly protein RcpC/CpaB

140

249

0.95

PF08666

SAF

SAF domain

73

134

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ur4-assembly1.cif.gz_A structure of the type iii fish antifreeze protein from zoarces viviparus zvafp13 0.8701 39 99
6msi-assembly1.cif.gz_A type iii antifreeze protein isoform hplc 12 0.8626 39 99
8ame-assembly1.cif.gz_A type iii antifreeze protein isoform hplc 12 n14sa16h 0.8589 39 99
7msi-assembly1.cif.gz_A type iii antifreeze protein isoform hplc 12 0.8578 39 99
9ame-assembly1.cif.gz_A type iii antifreeze protein isoform hplc 12 s42g 0.857 39 99
ID Description Score Start End Superfamily
af_P75933_96_158_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.9028 41 101 3.90.1210.10
3frnA02 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8976 37 102 3.90.1210.10
af_P75933_96_158_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8629 41 101 3.90.1210.10
3frnA02 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.861 37 102 3.90.1210.10
5xqrB00 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8559 40 101 3.90.1210.10
ID Description Score Start End GO Terms
AF-A0A832NFS4-F1-model_v4 SAF domain-containing protein 0.9401 38 99
AF-A0A356VC12-F1-model_v4 SAF domain-containing protein 0.9021 36 100 GO:0016051
GO:0047444
GO:0070085
AF-A0A2V9Z019-F1-model_v4 Flp pilus assembly protein CpaB 0.8855 109 226
AF-A0A7C3HR97-F1-model_v4 Flp pilus assembly protein CpaB 0.88 1 132
AF-A0A1Q8UT00-F1-model_v4 deleted 0.8784 112 234

Map