F467786
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 598 | 337 | 1196 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10000119|Ga0182008_1000011911 |
| Length | 285 |
| Sequence | MDFSDATLSIQFSLLLMTHSPEHALSVLAVPAFADNYLWLIHDGRHAAVVDPGDAMAILDALQAHQLTLSAILLTHHHADHTGGVPELLQHFAVPVFGPRNEAITAITEPLAEGDVAYVAELGLQMTVIDVPGHTKGHIAYVRQRDERSGAPWLFSGDTLFAGGCGRLFEGTPGQMADSLGKLAALPDDTEVFCAHEYTLSNLRFANAVEPGNVALQERIAIDTEKRQQGLSTVPSTIALEKATNPFLRYREPAILTSLKVEGKLASDASPVEAFAALRMWKNNF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 179 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 180 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 192 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 193 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 197 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 260 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 261 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 262 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 263 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 264 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 265 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 266 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 274 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 277 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 283 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 284 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 286 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 287 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 288 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 289 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 290 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 291 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 292 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 293 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 294 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 295 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 296 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 297 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 298 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 299 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 300 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 301 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 302 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 303 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 304 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 305 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 306 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 307 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 308 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 309 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 310 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 311 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 312 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 313 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 314 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 315 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 316 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 317 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 318 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 319 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 320 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 321 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 322 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 323 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 324 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 325 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 326 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 327 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 328 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 329 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 330 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 331 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 332 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 333 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 334 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 335 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 336 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 337 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.47 |
| Metatranscriptomes | 0.84 |
| Isolates | 8.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.38 |
| Nodule | 0.84 |
| Rhizoplane | 1.67 |
| Rhizosphere | 68.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10000119 | 3300014497 | Bacteria | 59427 |
| 2 | JGI24736J21556_1000622 | 3300001904 | Bacteria | 6514 |
| 3 | JGI24741J21665_1001939 | 3300001915 | Bacteria | 5578 |
| 4 | JGI24740J21852_10002530 | 3300001979 | Bacteria | 8255 |
| 5 | JGI25155J39150_1000132 | 3300002704 | Bacteria | 35559 |
| 6 | JGI25155J39150_1000204 | 3300002704 | Bacteria | 24399 |
| 7 | JGI25156J39149_1000154 | 3300002705 | Bacteria | 50528 |
| 8 | JGI25154J39366_1000401 | 3300002738 | Bacteria | 23593 |
| 9 | JGI25154J39366_1000462 | 3300002738 | Bacteria | 21234 |
| 10 | JGI25154J39366_1000584 | 3300002738 | Bacteria | 17690 |
| 11 | JGI25158J39367_1001697 | 3300002739 | Bacteria | 3773 |
| 12 | JGI25157J39369_1000169 | 3300002741 | Bacteria | 55047 |
| 13 | JGI25152J39213_1000071 | 3300002773 | Bacteria | 66888 |
| 14 | JGI25152J39213_1008174 | 3300002773 | Bacteria | 2622 |
| 15 | JGI25150J39212_1001132 | 3300002774 | Bacteria | 8025 |
| 16 | JGI25150J39212_1004210 | 3300002774 | Bacteria | 3237 |
| 17 | JGI25150J39212_1023915 | 3300002774 | Bacteria | 904 |
| 18 | JGI25159J45721_1001513 | 3300002987 | Bacteria | 9529 |
| 19 | rootH1_10030757 | 3300003316 | Bacteria | 6605 |
| 20 | rootL2_10035620 | 3300003322 | Bacteria | 2417 |
| 21 | rootL2_10035621 | 3300003322 | Bacteria | 1331 |
| 22 | JGI25161J50226_1002030 | 3300003374 | Bacteria | 5508 |
| 23 | Ga0055538_1000070 | 3300003751 | Bacteria | 93518 |
| 24 | Ga0055539_1000105 | 3300003752 | Bacteria | 93518 |
| 25 | Ga0055533_1000113 | 3300003756 | Bacteria | 93518 |
| 26 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 27 | Ga0055525_1000153 | 3300003759 | Bacteria | 93518 |
| 28 | Ga0055529_1000836 | 3300003763 | Bacteria | 18140 |
| 29 | Ga0055526_1000023 | 3300003771 | Bacteria | 163444 |
| 30 | Ga0055526_1000093 | 3300003771 | Bacteria | 81432 |
| 31 | Ga0055526_1014758 | 3300003771 | Bacteria | 3186 |
| 32 | Ga0055526_1015012 | 3300003771 | Bacteria | 3138 |
| 33 | Ga0055537_1000129 | 3300003773 | Bacteria | 57643 |
| 34 | Ga0055537_1014279 | 3300003773 | Bacteria | 1449 |
| 35 | Ga0055524_1001524 | 3300003775 | Bacteria | 13106 |
| 36 | Ga0055524_1002022 | 3300003775 | Bacteria | 10819 |
| 37 | Ga0055524_1006163 | 3300003775 | Bacteria | 5237 |
| 38 | Ga0055524_1012128 | 3300003775 | Bacteria | 3326 |
| 39 | Ga0055534_1000594 | 3300003784 | Bacteria | 18790 |
| 40 | Ga0055534_1000965 | 3300003784 | Bacteria | 12758 |
| 41 | Ga0055534_1006448 | 3300003784 | Bacteria | 2950 |
| 42 | Ga0055528_1000013 | 3300003790 | Bacteria | 176239 |
| 43 | Ga0055530_10008006 | 3300003791 | Bacteria | 4317 |
| 44 | Ga0055531_10007685 | 3300003794 | Bacteria | 5825 |
| 45 | Ga0055541_1000071 | 3300003841 | Bacteria | 93518 |
| 46 | Ga0055543_1000257 | 3300004625 | Bacteria | 39860 |
| 47 | Ga0065165_1000296 | 3300005262 | Bacteria | 83947 |
| 48 | Ga0070658_10015291 | 3300005327 | Bacteria | 6141 |
| 49 | Ga0070676_10002125 | 3300005328 | Bacteria | 10088 |
| 50 | Ga0070683_100013472 | 3300005329 | Bacteria | 7133 |
| 51 | Ga0070670_100034164 | 3300005331 | Bacteria | 4377 |
| 52 | Ga0070670_100146878 | 3300005331 | Bacteria | 2040 |
| 53 | Ga0070677_10000503 | 3300005333 | Bacteria | 13490 |
| 54 | Ga0070680_100014045 | 3300005336 | Bacteria | 6253 |
| 55 | Ga0070680_100014372 | 3300005336 | Bacteria | 6186 |
| 56 | Ga0070682_100006613 | 3300005337 | Bacteria | 6502 |
| 57 | Ga0070682_100037177 | 3300005337 | Bacteria | 2979 |
| 58 | Ga0068868_100082159 | 3300005338 | Bacteria | 2584 |
| 59 | Ga0070660_100008001 | 3300005339 | Bacteria | 7385 |
| 60 | Ga0070691_10003585 | 3300005341 | Bacteria | 7009 |
| 61 | Ga0070661_100007333 | 3300005344 | Bacteria | 7608 |
| 62 | Ga0070692_10001511 | 3300005345 | Bacteria | 8515 |
| 63 | Ga0070668_100004906 | 3300005347 | Bacteria | 9911 |
| 64 | Ga0070675_100003996 | 3300005354 | Bacteria | 11193 |
| 65 | Ga0070671_100001515 | 3300005355 | Bacteria | 17419 |
| 66 | Ga0070674_100000820 | 3300005356 | Bacteria | 16057 |
| 67 | Ga0070673_100000942 | 3300005364 | Bacteria | 16474 |
| 68 | Ga0070659_100016131 | 3300005366 | Bacteria | 5606 |
| 69 | Ga0070667_100004180 | 3300005367 | Bacteria | 12191 |
| 70 | Ga0070701_10211897 | 3300005438 | Bacteria | 1151 |
| 71 | Ga0070663_100007817 | 3300005455 | Bacteria | 6536 |
| 72 | Ga0070663_100403543 | 3300005455 | Bacteria | 1118 |
| 73 | Ga0070662_100322386 | 3300005457 | Bacteria | 1260 |
| 74 | Ga0070681_10007131 | 3300005458 | Bacteria | 10890 |
| 75 | Ga0070681_10054098 | 3300005458 | Bacteria | 3999 |
| 76 | Ga0068867_100006618 | 3300005459 | Bacteria | 8191 |
| 77 | Ga0070685_10035025 | 3300005466 | Bacteria | 2831 |
| 78 | Ga0070679_100005054 | 3300005530 | Bacteria | 12176 |
| 79 | Ga0070679_100020024 | 3300005530 | Bacteria | 6519 |
| 80 | Ga0070684_100007023 | 3300005535 | Bacteria | 8750 |
| 81 | Ga0068853_100003222 | 3300005539 | Bacteria | 12479 |
| 82 | Ga0068853_100007747 | 3300005539 | Bacteria | 8610 |
| 83 | Ga0068853_100022204 | 3300005539 | Bacteria | 5298 |
| 84 | Ga0070672_100002351 | 3300005543 | Bacteria | 11958 |
| 85 | Ga0070665_100007171 | 3300005548 | Bacteria | 11334 |
| 86 | Ga0068855_100000645 | 3300005563 | Bacteria | 42677 |
| 87 | Ga0068855_100039144 | 3300005563 | Bacteria | 5628 |
| 88 | Ga0068857_100010439 | 3300005577 | Bacteria | 8072 |
| 89 | Ga0068857_100120115 | 3300005577 | Bacteria | 2366 |
| 90 | Ga0068857_100569558 | 3300005577 | Bacteria | 1068 |
| 91 | Ga0068854_100007809 | 3300005578 | Bacteria | 6844 |
| 92 | Ga0068854_100018764 | 3300005578 | Bacteria | 4649 |
| 93 | Ga0068856_100034723 | 3300005614 | Bacteria | 4940 |
| 94 | Ga0068852_100008844 | 3300005616 | Bacteria | 7450 |
| 95 | Ga0068852_100009587 | 3300005616 | Bacteria | 7195 |
| 96 | Ga0068864_100009648 | 3300005618 | Bacteria | 7964 |
| 97 | Ga0068861_100508504 | 3300005719 | Bacteria | 1090 |
| 98 | Ga0068851_10000337 | 3300005834 | Bacteria | 21233 |
| 99 | Ga0068870_10002201 | 3300005840 | Bacteria | 8075 |
| 100 | Ga0068863_100159200 | 3300005841 | Bacteria | 2163 |
| 101 | Ga0068858_100188609 | 3300005842 | Bacteria | 1948 |
| 102 | Ga0068860_100016807 | 3300005843 | Bacteria | 7133 |
| 103 | Ga0081455_10109804 | 3300005937 | Bacteria | 2194 |
| 104 | Ga0070717_10343075 | 3300006028 | Bacteria | 1334 |
| 105 | Ga0070712_100010843 | 3300006175 | Bacteria | 5764 |
| 106 | Ga0075366_10021765 | 3300006195 | Bacteria | 3728 |
| 107 | Ga0097621_100142077 | 3300006237 | Bacteria | 2052 |
| 108 | Ga0068871_100019557 | 3300006358 | Bacteria | 5172 |
| 109 | Ga0068865_100046168 | 3300006881 | Bacteria | 2988 |
| 110 | Ga0079104_1011794 | 3300006946 | Bacteria | 2787 |
| 111 | Ga0105251_10012847 | 3300009011 | Bacteria | 4715 |
| 112 | Ga0105244_10004545 | 3300009036 | Bacteria | 9507 |
| 113 | Ga0105244_10004656 | 3300009036 | Bacteria | 9362 |
| 114 | Ga0105240_10008095 | 3300009093 | Bacteria | 15097 |
| 115 | Ga0105240_10028762 | 3300009093 | Bacteria | 7250 |
| 116 | Ga0105240_10031188 | 3300009093 | Bacteria | 6916 |
| 117 | Ga0105240_10143049 | 3300009093 | Bacteria | 2858 |
| 118 | Ga0105242_10271703 | 3300009176 | Bacteria | 1536 |
| 119 | Ga0105238_10000213 | 3300009551 | Bacteria | 64398 |
| 120 | Ga0105239_10010698 | 3300010375 | Bacteria | 10254 |
| 121 | Ga0105239_10745024 | 3300010375 | Bacteria | 1121 |
| 122 | Ga0157373_10012705 | 3300013100 | Bacteria | 6188 |
| 123 | Ga0157373_10022750 | 3300013100 | Bacteria | 4546 |
| 124 | Ga0157371_10012336 | 3300013102 | Bacteria | 6539 |
| 125 | Ga0157370_10035175 | 3300013104 | Bacteria | 4871 |
| 126 | Ga0157369_10017641 | 3300013105 | Bacteria | 8021 |
| 127 | Ga0163162_10092537 | 3300013306 | Bacteria | 3107 |
| 128 | Ga0157372_10015387 | 3300013307 | Bacteria | 8198 |
| 129 | Ga0157375_10014562 | 3300013308 | Bacteria | 7020 |
| 130 | Ga0157375_10015014 | 3300013308 | Bacteria | 6927 |
| 131 | Ga0157376_10059642 | 3300014969 | Bacteria | 3200 |
| 132 | Ga0182006_1000008 | 3300015261 | Bacteria | 449652 |
| 133 | Ga0182006_1000067 | 3300015261 | Bacteria | 147932 |
| 134 | Ga0182006_1005802 | 3300015261 | Bacteria | 5819 |
| 135 | Ga0182007_10001506 | 3300015262 | Bacteria | 12429 |
| 136 | Ga0182007_10011770 | 3300015262 | Bacteria | 3392 |
| 137 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 138 | Ga0182005_1000008 | 3300015265 | Bacteria | 471394 |
| 139 | Ga0163161_10093305 | 3300017792 | Bacteria | 2230 |
| 140 | Ga0163161_10100826 | 3300017792 | Bacteria | 2149 |
| 141 | Ga0197907_10920354 | 3300020069 | Bacteria | 3355 |
| 142 | Ga0206356_11707524 | 3300020070 | Bacteria | 7322 |
| 143 | Ga0206354_10831098 | 3300020081 | Bacteria | 13528 |
| 144 | Ga0206353_10297193 | 3300020082 | Bacteria | 5105 |
| 145 | Ga0154015_1003343 | 3300020610 | Bacteria | 4307 |
| 146 | Ga0213872_10000148 | 3300021361 | Bacteria | 64199 |
| 147 | Ga0213872_10000952 | 3300021361 | Bacteria | 20247 |
| 148 | Ga0213872_10010316 | 3300021361 | Bacteria | 4450 |
| 149 | Ga0213872_10012846 | 3300021361 | Bacteria | 3929 |
| 150 | Ga0213872_10077561 | 3300021361 | Bacteria | 1493 |
| 151 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 152 | Ga0209435_100162 | 3300025206 | Bacteria | 21364 |
| 153 | Ga0209436_100030 | 3300025208 | Bacteria | 83718 |
| 154 | Ga0209436_105529 | 3300025208 | Bacteria | 2894 |
| 155 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 156 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 157 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 158 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 159 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 160 | Ga0209437_100045 | 3300025233 | Bacteria | 429809 |
| 161 | Ga0209258_100226 | 3300025242 | Bacteria | 106588 |
| 162 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 163 | Ga0207425_1000048 | 3300025245 | Bacteria | 188748 |
| 164 | Ga0207425_1001395 | 3300025245 | Bacteria | 10198 |
| 165 | Ga0207425_1008583 | 3300025245 | Bacteria | 2603 |
| 166 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 167 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 168 | Ga0209646_1000252 | 3300025246 | Bacteria | 53546 |
| 169 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 170 | Ga0209026_1004555 | 3300025250 | Bacteria | 4075 |
| 171 | Ga0209026_1011731 | 3300025250 | Bacteria | 1559 |
| 172 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 173 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 174 | Ga0209759_1000809 | 3300025256 | Bacteria | 25105 |
| 175 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 176 | Ga0209129_1005240 | 3300025258 | Bacteria | 4689 |
| 177 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 178 | Ga0209565_1003876 | 3300025263 | Bacteria | 4705 |
| 179 | Ga0209565_1005148 | 3300025263 | Bacteria | 3846 |
| 180 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 181 | Ga0209455_1002265 | 3300025272 | Bacteria | 7569 |
| 182 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 183 | Ga0209130_1000194 | 3300025284 | Bacteria | 83960 |
| 184 | Ga0209130_1003496 | 3300025284 | Bacteria | 6603 |
| 185 | Ga0209130_1011501 | 3300025284 | Bacteria | 2366 |
| 186 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 187 | Ga0209675_1008241 | 3300025291 | Bacteria | 3862 |
| 188 | Ga0209675_1010068 | 3300025291 | Bacteria | 3266 |
| 189 | Ga0209025_1009622 | 3300025294 | Bacteria | 6699 |
| 190 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 191 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 192 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 193 | Ga0209564_1000199 | 3300025295 | Bacteria | 138027 |
| 194 | Ga0209564_1011504 | 3300025295 | Bacteria | 3958 |
| 195 | Ga0209564_1014810 | 3300025295 | Bacteria | 3215 |
| 196 | Ga0209758_1000041 | 3300025297 | Bacteria | 410328 |
| 197 | Ga0209758_1000679 | 3300025297 | Bacteria | 50729 |
| 198 | Ga0209050_1000089 | 3300025298 | Bacteria | 256212 |
| 199 | Ga0209050_1006473 | 3300025298 | Bacteria | 6920 |
| 200 | Ga0209050_1032512 | 3300025298 | Bacteria | 1603 |
| 201 | Ga0209256_1000112 | 3300025299 | Bacteria | 178432 |
| 202 | Ga0209256_1000163 | 3300025299 | Bacteria | 136008 |
| 203 | Ga0209256_1000334 | 3300025299 | Bacteria | 78875 |
| 204 | Ga0209256_1008572 | 3300025299 | Bacteria | 4705 |
| 205 | Ga0207426_1019542 | 3300025302 | Bacteria | 2366 |
| 206 | Ga0209051_1035726 | 3300025303 | Bacteria | 1844 |
| 207 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 208 | Ga0207697_10025189 | 3300025315 | Bacteria | 2432 |
| 209 | Ga0207655_1009232 | 3300025728 | Bacteria | 6152 |
| 210 | Ga0207655_1019524 | 3300025728 | Bacteria | 3536 |
| 211 | Ga0207682_10000941 | 3300025893 | Bacteria | 13487 |
| 212 | Ga0207680_10016018 | 3300025903 | Bacteria | 3927 |
| 213 | Ga0207647_10011731 | 3300025904 | Bacteria | 6130 |
| 214 | Ga0207645_10000645 | 3300025907 | Bacteria | 28969 |
| 215 | Ga0207643_10006063 | 3300025908 | Bacteria | 6460 |
| 216 | Ga0207705_10000968 | 3300025909 | Bacteria | 23502 |
| 217 | Ga0207707_10001282 | 3300025912 | Bacteria | 23438 |
| 218 | Ga0207707_10002882 | 3300025912 | Bacteria | 15354 |
| 219 | Ga0207695_10001039 | 3300025913 | Bacteria | 48767 |
| 220 | Ga0207695_10004188 | 3300025913 | Bacteria | 19822 |
| 221 | Ga0207695_10006509 | 3300025913 | Bacteria | 15128 |
| 222 | Ga0207695_10040809 | 3300025913 | Bacteria | 4971 |
| 223 | Ga0207693_10072058 | 3300025915 | Bacteria | 2705 |
| 224 | Ga0207660_10001117 | 3300025917 | Bacteria | 17933 |
| 225 | Ga0207660_10009834 | 3300025917 | Bacteria | 6192 |
| 226 | Ga0207662_10421753 | 3300025918 | Bacteria | 908 |
| 227 | Ga0207657_10008022 | 3300025919 | Bacteria | 10767 |
| 228 | Ga0207649_10005238 | 3300025920 | Bacteria | 7006 |
| 229 | Ga0207652_10001658 | 3300025921 | Bacteria | 19533 |
| 230 | Ga0207652_10004611 | 3300025921 | Bacteria | 11168 |
| 231 | Ga0207694_10001111 | 3300025924 | Bacteria | 23273 |
| 232 | Ga0207650_10042756 | 3300025925 | Bacteria | 3324 |
| 233 | Ga0207650_10173087 | 3300025925 | Bacteria | 1717 |
| 234 | Ga0207659_10023547 | 3300025926 | Bacteria | 4111 |
| 235 | Ga0207644_10011870 | 3300025931 | Bacteria | 5773 |
| 236 | Ga0207690_10007706 | 3300025932 | Bacteria | 6390 |
| 237 | Ga0207670_10381074 | 3300025936 | Bacteria | 1123 |
| 238 | Ga0207669_10000959 | 3300025937 | Bacteria | 12219 |
| 239 | Ga0207691_10000226 | 3300025940 | Bacteria | 54997 |
| 240 | Ga0207711_10172967 | 3300025941 | Bacteria | 1961 |
| 241 | Ga0207689_10068442 | 3300025942 | Bacteria | 2918 |
| 242 | Ga0207661_10010699 | 3300025944 | Bacteria | 6611 |
| 243 | Ga0207667_10000191 | 3300025949 | Bacteria | 89641 |
| 244 | Ga0207667_10001277 | 3300025949 | Bacteria | 31581 |
| 245 | Ga0207667_10174926 | 3300025949 | Bacteria | 2206 |
| 246 | Ga0207651_10003124 | 3300025960 | Bacteria | 8061 |
| 247 | Ga0207668_10047536 | 3300025972 | Bacteria | 2938 |
| 248 | Ga0207640_10005025 | 3300025981 | Bacteria | 7194 |
| 249 | Ga0207703_10287725 | 3300026035 | Bacteria | 1495 |
| 250 | Ga0207639_10008090 | 3300026041 | Bacteria | 7190 |
| 251 | Ga0207678_10018407 | 3300026067 | Bacteria | 6133 |
| 252 | Ga0207702_10000474 | 3300026078 | Bacteria | 45055 |
| 253 | Ga0207641_10006327 | 3300026088 | Bacteria | 10007 |
| 254 | Ga0207641_10491517 | 3300026088 | Bacteria | 1191 |
| 255 | Ga0207648_10012020 | 3300026089 | Bacteria | 8122 |
| 256 | Ga0207674_10031021 | 3300026116 | Bacteria | 5617 |
| 257 | Ga0207674_10053930 | 3300026116 | Bacteria | 4095 |
| 258 | Ga0207683_10000022 | 3300026121 | Bacteria | 116671 |
| 259 | Ga0207698_10000276 | 3300026142 | Bacteria | 31255 |
| 260 | Ga0207698_10009589 | 3300026142 | Bacteria | 6182 |
| 261 | Ga0209281_1004582 | 3300027111 | Bacteria | 4101 |
| 262 | Ga0268266_10005048 | 3300028379 | Bacteria | 12458 |
| 263 | Ga0268264_10043371 | 3300028381 | Bacteria | 3727 |
| 264 | Ga0265338_10048239 | 3300028800 | Bacteria | 3877 |
| 265 | Ga0316177_1204095 | 3300030731 | Bacteria | 2821 |
| 266 | Ga0316180_1144385 | 3300030736 | Bacteria | 4147 |
| 267 | Ga0316182_1094945 | 3300030745 | Bacteria | 1139 |
| 268 | Ga0265331_10017318 | 3300031250 | Bacteria | 3763 |
| 269 | Ga0307408_100000123 | 3300031548 | Bacteria | 85710 |
| 270 | Ga0307408_100000405 | 3300031548 | Bacteria | 38760 |
| 271 | Ga0307408_100002117 | 3300031548 | Bacteria | 14261 |
| 272 | Ga0307408_100159019 | 3300031548 | Bacteria | 1792 |
| 273 | Ga0307408_100185853 | 3300031548 | Bacteria | 1670 |
| 274 | Ga0307408_100305928 | 3300031548 | Bacteria | 1333 |
| 275 | Ga0307406_10005922 | 3300031901 | Bacteria | 6707 |
| 276 | Ga0307414_10028934 | 3300032004 | Bacteria | 3600 |
| 277 | Ga0395899_0125026 | 3300037312 | Bacteria | 1839 |
| 278 | Ga0395899_0258722 | 3300037312 | Bacteria | 1191 |
| 279 | Ga0395899_0455075 | 3300037312 | Bacteria | 837 |
| 280 | Ga0395900_0022865 | 3300037418 | Bacteria | 6397 |
| 281 | Ga0395900_0153100 | 3300037418 | Bacteria | 2355 |
| 282 | Ga0395900_0218651 | 3300037418 | Bacteria | 1921 |
| 283 | Ga0395898_0009320 | 3300037466 | Bacteria | 10318 |
| 284 | Ga0395905_0091347 | 3300037471 | Bacteria | 2854 |
| 285 | Ga0395901_0000852 | 3300038443 | Bacteria | 33536 |
| 286 | Ga0395901_0070309 | 3300038443 | Bacteria | 3646 |
| 287 | Ga0436361_0061503 | 3300039447 | Bacteria | 127805 |
| 288 | Ga0436361_0066267 | 3300039447 | Bacteria | 1324 |
| 289 | Ga0436361_0208984 | 3300039447 | Bacteria | 5394 |
| 290 | Ga0436361_0249401 | 3300039447 | Bacteria | 41096 |
| 291 | Ga0436361_0355761 | 3300039447 | Bacteria | 5104 |
| 292 | Ga0436361_0582882 | 3300039447 | Bacteria | 967 |
| 293 | Ga0436361_1127900 | 3300039447 | Bacteria | 4656 |
| 294 | Ga0436361_1137694 | 3300039447 | Bacteria | 1155 |
| 295 | Ga0450891_001876 | 3300042129 | Unclassified | 2155 |
| 296 | Ga0466969_0074686 | 3300044656 | Bacteria | 1626 |
| 297 | Ga0466972_0000201 | 3300044658 | Bacteria | 43791 |
| 298 | Ga0466972_0012055 | 3300044658 | Bacteria | 4344 |
| 299 | Ga0466972_0100758 | 3300044658 | Bacteria | 1367 |
| 300 | Ga0466965_0001752 | 3300044683 | Bacteria | 8962 |
| 301 | Ga0466965_0143202 | 3300044683 | Bacteria | 1246 |
| 302 | Ga0466966_0011912 | 3300044684 | Bacteria | 5764 |
| 303 | Ga0466964_0008546 | 3300044706 | Bacteria | 3848 |
| 304 | Ga0466964_0030771 | 3300044706 | Bacteria | 2125 |
| 305 | Ga0466968_0020841 | 3300044735 | Bacteria | 2650 |
| 306 | Ga0466968_0035277 | 3300044735 | Bacteria | 2092 |
| 307 | Ga0466968_0135202 | 3300044735 | Bacteria | 1124 |
| 308 | Ga0466970_0076094 | 3300044765 | Bacteria | 1808 |
| 309 | Ga0466957_0083551 | 3300044842 | Bacteria | 1992 |
| 310 | Ga0495617_000013 | 3300046452 | Bacteria | 290031 |
| 311 | Ga0495617_003301 | 3300046452 | Bacteria | 6111 |
| 312 | Ga0495617_005003 | 3300046452 | Bacteria | 4761 |
| 313 | Ga0495617_018999 | 3300046452 | Bacteria | 2324 |
| 314 | Ga0495617_055804 | 3300046452 | Bacteria | 1310 |
| 315 | Ga0495627_000001 | 3300046453 | Bacteria | 1104709 |
| 316 | Ga0495590_0000016 | 3300046457 | Bacteria | 225874 |
| 317 | Ga0495590_0022671 | 3300046457 | Bacteria | 2220 |
| 318 | Ga0495638_0000057 | 3300046460 | Bacteria | 193690 |
| 319 | Ga0495638_0004128 | 3300046460 | Bacteria | 11108 |
| 320 | Ga0495638_0056530 | 3300046460 | Bacteria | 2435 |
| 321 | Ga0495653_0000025 | 3300046463 | Bacteria | 160471 |
| 322 | Ga0495650_0000129 | 3300046471 | Bacteria | 177255 |
| 323 | Ga0495650_0000226 | 3300046471 | Bacteria | 115930 |
| 324 | Ga0495650_0000246 | 3300046471 | Bacteria | 107109 |
| 325 | Ga0495650_0000289 | 3300046471 | Bacteria | 93255 |
| 326 | Ga0495650_0000348 | 3300046471 | Bacteria | 82107 |
| 327 | Ga0495650_0044851 | 3300046471 | Bacteria | 1865 |
| 328 | Ga0495605_0000139 | 3300046474 | Bacteria | 93710 |
| 329 | Ga0495605_0001875 | 3300046474 | Bacteria | 13444 |
| 330 | Ga0495605_0042384 | 3300046474 | Bacteria | 2263 |
| 331 | Ga0495639_0017786 | 3300046475 | Bacteria | 3089 |
| 332 | Ga0495584_0000249 | 3300046491 | Bacteria | 38940 |
| 333 | Ga0495584_0090556 | 3300046491 | Bacteria | 1542 |
| 334 | Ga0495585_0019035 | 3300046492 | Bacteria | 3962 |
| 335 | Ga0495585_0030455 | 3300046492 | Bacteria | 3068 |
| 336 | Ga0495585_0058745 | 3300046492 | Bacteria | 2121 |
| 337 | Ga0495585_0092983 | 3300046492 | Bacteria | 1622 |
| 338 | Ga0495585_0140606 | 3300046492 | Bacteria | 1264 |
| 339 | Ga0495596_0006652 | 3300046500 | Bacteria | 5293 |
| 340 | Ga0495607_0014033 | 3300046501 | Bacteria | 5230 |
| 341 | Ga0495607_0020177 | 3300046501 | Bacteria | 4218 |
| 342 | Ga0495607_0026933 | 3300046501 | Bacteria | 3561 |
| 343 | Ga0495607_0036570 | 3300046501 | Bacteria | 2956 |
| 344 | Ga0495607_0047634 | 3300046501 | Bacteria | 2510 |
| 345 | Ga0495607_0172959 | 3300046501 | Bacteria | 1089 |
| 346 | Ga0495583_0000009 | 3300046506 | Bacteria | 372527 |
| 347 | Ga0495583_0000396 | 3300046506 | Bacteria | 66329 |
| 348 | Ga0495583_0000688 | 3300046506 | Bacteria | 43737 |
| 349 | Ga0495606_0000087 | 3300046507 | Bacteria | 156407 |
| 350 | Ga0495606_0000137 | 3300046507 | Bacteria | 124670 |
| 351 | Ga0495606_0000197 | 3300046507 | Bacteria | 105038 |
| 352 | Ga0495606_0000573 | 3300046507 | Bacteria | 58366 |
| 353 | Ga0495606_0001754 | 3300046507 | Bacteria | 27852 |
| 354 | Ga0495606_0001765 | 3300046507 | Bacteria | 27716 |
| 355 | Ga0495606_0007194 | 3300046507 | Bacteria | 10039 |
| 356 | Ga0495606_0007396 | 3300046507 | Bacteria | 9849 |
| 357 | Ga0495606_0021465 | 3300046507 | Bacteria | 4729 |
| 358 | Ga0495606_0039610 | 3300046507 | Bacteria | 3173 |
| 359 | Ga0495606_0088226 | 3300046507 | Bacteria | 1913 |
| 360 | Ga0495606_0171458 | 3300046507 | Bacteria | 1258 |
| 361 | Ga0495610_0000008 | 3300046512 | Bacteria | 622732 |
| 362 | Ga0495610_0003847 | 3300046512 | Bacteria | 11408 |
| 363 | Ga0495610_0004964 | 3300046512 | Bacteria | 9635 |
| 364 | Ga0495610_0005455 | 3300046512 | Bacteria | 9030 |
| 365 | Ga0495610_0052378 | 3300046512 | Bacteria | 1981 |
| 366 | Ga0495610_0088120 | 3300046512 | Bacteria | 1411 |
| 367 | Ga0495616_0000761 | 3300046513 | Bacteria | 23546 |
| 368 | Ga0495616_0018907 | 3300046513 | Bacteria | 3767 |
| 369 | Ga0495637_0000404 | 3300046520 | Bacteria | 31974 |
| 370 | Ga0495637_0023363 | 3300046520 | Bacteria | 2812 |
| 371 | Ga0495637_0096718 | 3300046520 | Bacteria | 1158 |
| 372 | Ga0495643_0000236 | 3300046522 | Bacteria | 83225 |
| 373 | Ga0495643_0000289 | 3300046522 | Bacteria | 71822 |
| 374 | Ga0495643_0177305 | 3300046522 | Bacteria | 1038 |
| 375 | Ga0495644_0000527 | 3300046523 | Bacteria | 16268 |
| 376 | Ga0495644_0006564 | 3300046523 | Bacteria | 4504 |
| 377 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 378 | Ga0495648_0002256 | 3300046524 | Bacteria | 18028 |
| 379 | Ga0495648_0005244 | 3300046524 | Bacteria | 10831 |
| 380 | Ga0495648_0011919 | 3300046524 | Bacteria | 6521 |
| 381 | Ga0495648_0050843 | 3300046524 | Bacteria | 2529 |
| 382 | Ga0495648_0096262 | 3300046524 | Bacteria | 1645 |
| 383 | Ga0495642_0003770 | 3300046528 | Bacteria | 5935 |
| 384 | Ga0495642_0008063 | 3300046528 | Bacteria | 4029 |
| 385 | Ga0495642_0084904 | 3300046528 | Bacteria | 1336 |
| 386 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 387 | Ga0495654_0031792 | 3300046530 | Bacteria | 2678 |
| 388 | Ga0495654_0063659 | 3300046530 | Bacteria | 1765 |
| 389 | Ga0495598_0043435 | 3300046537 | Bacteria | 1324 |
| 390 | Ga0495609_0000541 | 3300046538 | Bacteria | 29926 |
| 391 | Ga0495609_0009695 | 3300046538 | Bacteria | 4646 |
| 392 | Ga0495609_0010811 | 3300046538 | Bacteria | 4364 |
| 393 | Ga0495609_0013838 | 3300046538 | Bacteria | 3803 |
| 394 | Ga0495609_0025559 | 3300046538 | Bacteria | 2707 |
| 395 | Ga0495609_0041227 | 3300046538 | Bacteria | 2075 |
| 396 | Ga0495609_0052280 | 3300046538 | Bacteria | 1818 |
| 397 | Ga0495621_0003018 | 3300046539 | Bacteria | 4592 |
| 398 | Ga0495621_0098186 | 3300046539 | Bacteria | 1111 |
| 399 | Ga0495597_0000025 | 3300046542 | Bacteria | 142649 |
| 400 | Ga0495597_0000848 | 3300046542 | Bacteria | 24046 |
| 401 | Ga0495597_0041028 | 3300046542 | Bacteria | 2068 |
| 402 | Ga0495597_0094603 | 3300046542 | Bacteria | 1265 |
| 403 | Ga0495622_0000023 | 3300046557 | Bacteria | 155188 |
| 404 | Ga0495622_0000816 | 3300046557 | Bacteria | 17235 |
| 405 | Ga0495622_0046998 | 3300046557 | Bacteria | 2006 |
| 406 | Ga0495633_0000073 | 3300046558 | Bacteria | 130286 |
| 407 | Ga0495633_0000399 | 3300046558 | Bacteria | 45392 |
| 408 | Ga0495633_0007655 | 3300046558 | Bacteria | 6184 |
| 409 | Ga0495633_0008319 | 3300046558 | Bacteria | 5859 |
| 410 | Ga0495633_0011430 | 3300046558 | Bacteria | 4788 |
| 411 | Ga0495633_0023761 | 3300046558 | Bacteria | 3034 |
| 412 | Ga0495633_0026360 | 3300046558 | Bacteria | 2853 |
| 413 | Ga0495633_0033544 | 3300046558 | Bacteria | 2475 |
| 414 | Ga0495656_0040260 | 3300046615 | Bacteria | 1946 |
| 415 | Ga0495656_0073187 | 3300046615 | Bacteria | 1527 |
| 416 | Ga0495668_0000083 | 3300046616 | Bacteria | 153471 |
| 417 | Ga0495668_0000132 | 3300046616 | Bacteria | 112674 |
| 418 | Ga0495668_0001954 | 3300046616 | Bacteria | 18283 |
| 419 | Ga0495668_0002007 | 3300046616 | Bacteria | 17796 |
| 420 | Ga0495611_0030469 | 3300046648 | Bacteria | 2372 |
| 421 | Ga0495611_0046148 | 3300046648 | Bacteria | 1952 |
| 422 | Ga0495611_0072547 | 3300046648 | Bacteria | 1575 |
| 423 | Ga0495625_0000177 | 3300046660 | Bacteria | 98918 |
| 424 | Ga0495625_0000482 | 3300046660 | Bacteria | 59590 |
| 425 | Ga0495625_0002519 | 3300046660 | Bacteria | 19715 |
| 426 | Ga0495625_0083052 | 3300046660 | Bacteria | 2227 |
| 427 | Ga0495625_0088411 | 3300046660 | Bacteria | 2146 |
| 428 | Ga0495625_0093541 | 3300046660 | Bacteria | 2075 |
| 429 | Ga0495625_0162209 | 3300046660 | Bacteria | 1497 |
| 430 | Ga0495625_0174033 | 3300046660 | Bacteria | 1435 |
| 431 | Ga0495625_0290901 | 3300046660 | Bacteria | 1048 |
| 432 | Ga0495659_0000154 | 3300046664 | Bacteria | 30383 |
| 433 | Ga0495659_0000394 | 3300046664 | Bacteria | 16709 |
| 434 | Ga0495661_0121846 | 3300046665 | Bacteria | 1439 |
| 435 | Ga0495623_0069440 | 3300046679 | Bacteria | 2196 |
| 436 | Ga0495670_0000099 | 3300046691 | Bacteria | 37893 |
| 437 | Ga0495670_0011768 | 3300046691 | Bacteria | 4306 |
| 438 | Ga0495670_0034938 | 3300046691 | Bacteria | 2504 |
| 439 | Ga0495670_0214037 | 3300046691 | Bacteria | 1023 |
| 440 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 441 | Ga0495671_0000282 | 3300046692 | Bacteria | 42563 |
| 442 | Ga0495671_0050074 | 3300046692 | Bacteria | 2081 |
| 443 | Ga0495671_0051125 | 3300046692 | Bacteria | 2056 |
| 444 | Ga0495671_0052657 | 3300046692 | Bacteria | 2022 |
| 445 | Ga0495649_0011278 | 3300046694 | Bacteria | 5248 |
| 446 | Ga0495649_0203111 | 3300046694 | Bacteria | 1028 |
| 447 | Ga0495660_0000473 | 3300046810 | Bacteria | 33431 |
| 448 | Ga0495660_0001536 | 3300046810 | Bacteria | 15558 |
| 449 | Ga0495660_0002502 | 3300046810 | Bacteria | 11723 |
| 450 | Ga0495660_0042988 | 3300046810 | Bacteria | 2494 |
| 451 | Ga0495660_0067640 | 3300046810 | Bacteria | 1902 |
| 452 | Ga0495660_0092871 | 3300046810 | Bacteria | 1565 |
| 453 | Ga0495636_0004129 | 3300047318 | Bacteria | 5689 |
| 454 | Ga0495672_0000063 | 3300047320 | Bacteria | 201893 |
| 455 | Ga0495672_0000291 | 3300047320 | Bacteria | 69062 |
| 456 | Ga0495672_0001774 | 3300047320 | Bacteria | 20729 |
| 457 | Ga0495672_0022462 | 3300047320 | Bacteria | 4099 |
| 458 | Ga0495672_0029323 | 3300047320 | Bacteria | 3467 |
| 459 | Ga0495672_0032420 | 3300047320 | Bacteria | 3250 |
| 460 | Ga0495683_0002242 | 3300047323 | Bacteria | 11820 |
| 461 | Ga0495683_0041964 | 3300047323 | Bacteria | 2307 |
| 462 | Ga0495687_000587 | 3300047443 | Bacteria | 42438 |
| 463 | Ga0495687_009668 | 3300047443 | Bacteria | 5366 |
| 464 | Ga0495687_039151 | 3300047443 | Bacteria | 2099 |
| 465 | Ga0495677_0013618 | 3300047445 | Bacteria | 2960 |
| 466 | Ga0495677_0018818 | 3300047445 | Bacteria | 2504 |
| 467 | Ga0495677_0031843 | 3300047445 | Bacteria | 1919 |
| 468 | Ga0495677_0043624 | 3300047445 | Bacteria | 1644 |
| 469 | Ga0495679_052687 | 3300047446 | Bacteria | 1216 |
| 470 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 471 | Ga0495673_0000015 | 3300047469 | Bacteria | 598766 |
| 472 | Ga0495673_0000044 | 3300047469 | Bacteria | 283033 |
| 473 | Ga0495673_0014024 | 3300047469 | Bacteria | 4183 |
| 474 | Ga0495673_0044141 | 3300047469 | Bacteria | 1990 |
| 475 | Ga0495686_0000488 | 3300047472 | Bacteria | 58473 |
| 476 | Ga0495686_0094774 | 3300047472 | Bacteria | 1808 |
| 477 | Ga0495686_0215834 | 3300047472 | Bacteria | 1093 |
| 478 | Ga0495614_0047091 | 3300048089 | Bacteria | 1849 |
| 479 | Ga0495626_0073030 | 3300048091 | Bacteria | 1537 |
| 480 | Ga0496101_0046587 | 3300048904 | Bacteria | 3110 |
| 481 | Ga0496103_0005164 | 3300048906 | Bacteria | 7856 |
| 482 | Ga0496103_0141188 | 3300048906 | Bacteria | 1540 |
| 483 | Ga0496105_0105836 | 3300048908 | Bacteria | 2322 |
| 484 | Ga0496108_0009055 | 3300048911 | Bacteria | 8064 |
| 485 | Ga0496109_0025459 | 3300048912 | Bacteria | 5274 |
| 486 | Ga0496110_0093715 | 3300048913 | Bacteria | 2688 |
| 487 | Ga0496111_0120771 | 3300048914 | Bacteria | 1935 |
| 488 | Ga0496111_0148680 | 3300048914 | Bacteria | 1737 |
| 489 | Ga0496116_0039707 | 3300048919 | Bacteria | 3249 |
| 490 | Ga0496116_0044254 | 3300048919 | Bacteria | 3026 |
| 491 | Ga0496116_0049011 | 3300048919 | Bacteria | 2829 |
| 492 | Ga0496116_0126328 | 3300048919 | Bacteria | 1468 |
| 493 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 494 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 495 | Ga0496118_0114516 | 3300048921 | Bacteria | 1777 |
| 496 | Ga0496118_0284831 | 3300048921 | Bacteria | 917 |
| 497 | Ga0496120_0051377 | 3300048923 | Bacteria | 2355 |
| 498 | Ga0496121_0015651 | 3300048924 | Bacteria | 7913 |
| 499 | Ga0496121_0017195 | 3300048924 | Bacteria | 7405 |
| 500 | Ga0496121_0042446 | 3300048924 | Bacteria | 3956 |
| 501 | Ga0496121_0094298 | 3300048924 | Bacteria | 2329 |
| 502 | Ga0496121_0159233 | 3300048924 | Bacteria | 1653 |
| 503 | Ga0496121_0164068 | 3300048924 | Bacteria | 1621 |
| 504 | Ga0496121_0364605 | 3300048924 | Bacteria | 958 |
| 505 | Ga0496122_0001290 | 3300048925 | Bacteria | 41594 |
| 506 | Ga0496122_0198352 | 3300048925 | Bacteria | 1176 |
| 507 | Ga0496123_0001053 | 3300048926 | Bacteria | 41720 |
| 508 | Ga0496123_0011598 | 3300048926 | Bacteria | 7619 |
| 509 | Ga0496123_0077795 | 3300048926 | Bacteria | 2035 |
| 510 | Ga0496124_0093882 | 3300048927 | Bacteria | 2441 |
| 511 | Ga0496124_0114180 | 3300048927 | Bacteria | 2169 |
| 512 | Ga0496124_0165936 | 3300048927 | Bacteria | 1716 |
| 513 | Ga0496124_0234525 | 3300048927 | Bacteria | 1369 |
| 514 | Ga0496124_0515965 | 3300048927 | Bacteria | 797 |
| 515 | Ga0496125_0070939 | 3300048928 | Bacteria | 2724 |
| 516 | Ga0496125_0164246 | 3300048928 | Bacteria | 1503 |
| 517 | Ga0496125_0183358 | 3300048928 | Bacteria | 1391 |
| 518 | Ga0496126_0002465 | 3300048929 | Bacteria | 24936 |
| 519 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 520 | Ga0495678_000069 | 3300049459 | Bacteria | 131739 |
| 521 | Ga0495678_002088 | 3300049459 | Bacteria | 14198 |
| 522 | Ga0495682_0000522 | 3300049460 | Bacteria | 26585 |
| 523 | Ga0495682_0001454 | 3300049460 | Bacteria | 12754 |
| 524 | Ga0501031_0189841 | 3300049568 | Bacteria | 1342 |
| 525 | Ga0501047_0031158 | 3300049581 | Bacteria | 5143 |
| 526 | Ga0501047_0488797 | 3300049581 | Bacteria | 1058 |
| 527 | Ga0501069_0037735 | 3300049585 | Bacteria | 2666 |
| 528 | Ga0501070_0003058 | 3300049586 | Bacteria | 14565 |
| 529 | Ga0501070_0018741 | 3300049586 | Bacteria | 5806 |
| 530 | Ga0501070_0129833 | 3300049586 | Bacteria | 2082 |
| 531 | Ga0501074_0001678 | 3300049590 | Bacteria | 15070 |
| 532 | Ga0501222_001905 | 3300049662 | Bacteria | 2891 |
| 533 | Ga0501227_016453 | 3300049665 | Bacteria | 1662 |
| 534 | Ga0501080_0173204 | 3300049742 | Bacteria | 1989 |
| 535 | Ga0501269_000028 | 3300049766 | Bacteria | 47862 |
| 536 | Ga0501279_001113 | 3300049775 | Bacteria | 3535 |
| 537 | Ga0501035_0006572 | 3300049822 | Bacteria | 10894 |
| 538 | Ga0501035_0047104 | 3300049822 | Bacteria | 3872 |
| 539 | Ga0501044_0016102 | 3300049823 | Bacteria | 8038 |
| 540 | nmdc:mga05p37_394950_c1 | 3300050507 | Bacteria | 1616 |
| 541 | nmdc:mga0n895_399776_c1 | 3300050512 | Bacteria | 1389 |
| 542 | Ga0500557_082127 | 3300053105 | Bacteria | 1065 |
| 543 | Ga0500594_0036043 | 3300053118 | Bacteria | 1329 |
| 544 | Ga0500618_000044 | 3300053125 | Bacteria | 110159 |
| 545 | Ga0500618_001190 | 3300053125 | Bacteria | 12512 |
| 546 | Ga0500637_0032236 | 3300053178 | Bacteria | 2921 |
| 547 | 2511250094 | 2511231003 | Bacteria | 5606035 |
| 548 | 2521559374 | 2521172590 | Bacteria | 5047645 |
| 549 | 2550693618 | 2548876994 | Bacteria | 4904866 |
| 550 | 2553007294 | 2551306416 | Bacteria | 6152985 |
| 551 | 2601668171 | 2600255292 | Bacteria | 6300551 |
| 552 | 2643792368 | 2643221554 | Bacteria | 6603920 |
| 553 | 2644027564 | 2643221603 | Bacteria | 6147767 |
| 554 | 2644212142 | 2643221638 | Bacteria | 6579467 |
| 555 | 2644251004 | 2643221645 | Bacteria | 7207331 |
| 556 | 2644354814 | 2643221664 | Bacteria | 7272945 |
| 557 | 2738715374 | 2738541276 | Bacteria | 4690596 |
| 558 | 2738739754 | 2738541280 | Bacteria | 6630198 |
| 559 | 2738828139 | 2738541297 | Bacteria | 6549566 |
| 560 | 2738842245 | 2738541300 | Bacteria | 6675882 |
| 561 | 2739151935 | 2738541357 | Bacteria | 6549408 |
| 562 | 2739194044 | 2738543003 | Bacteria | 6549560 |
| 563 | 2739273946 | 2738543018 | Bacteria | 6718814 |
| 564 | 2739320331 | 2738543026 | Bacteria | 6549408 |
| 565 | 2739338761 | 2738543029 | Bacteria | 6549249 |
| 566 | 2739342990 | 2738543030 | Bacteria | 6719714 |
| 567 | 2765570624 | 2765235838 | Bacteria | 5445269 |
| 568 | 2808983437 | 2808606386 | Bacteria | 4471946 |
| 569 | 2809128664 | 2808606415 | Bacteria | 4576710 |
| 570 | 2809148285 | 2808606419 | Bacteria | 4576925 |
| 571 | 2819592073 | 2818991445 | Bacteria | 4955017 |
| 572 | 2819615904 | 2818991449 | Bacteria | 5518009 |
| 573 | 2821132590 | 2821131069 | Bacteria | 6108407 |
| 574 | 2839098170 | 2839094727 | Bacteria | 5534556 |
| 575 | 2842716557 | 2842711865 | Bacteria | 7155354 |
| 576 | 2852620293 | 2852618963 | Bacteria | 4577824 |
| 577 | 2857550405 | 2857547612 | Bacteria | 6179999 |
| 578 | 2857557281 | 2857553236 | Bacteria | 6166726 |
| 579 | 2857560154 | 2857558681 | Bacteria | 6617694 |
| 580 | 2857566662 | 2857564685 | Bacteria | 6290584 |
| 581 | 2884816934 | 2884811622 | Bacteria | 5552861 |
| 582 | 2884840509 | 2884836552 | Bacteria | 5219991 |
| 583 | 2884855766 | 2884852848 | Bacteria | 5221161 |
| 584 | 2885085279 | 2885080285 | Bacteria | 6355622 |
| 585 | 2896157309 | 2896154374 | Bacteria | 5221518 |
| 586 | 2904424405 | 2904424332 | Bacteria | 7633521 |
| 587 | 2904443788 | 2904439833 | Bacteria | 5931679 |
| 588 | 2904532687 | 2904530477 | Bacteria | 5876334 |
| 589 | 2904585181 | 2904584206 | Bacteria | 6028872 |
| 590 | 2904593530 | 2904589729 | Bacteria | 6113573 |
| 591 | 2904605713 | 2904601388 | Bacteria | 5884906 |
| 592 | 2919048016 | 2919046199 | Bacteria | 5567169 |
| 593 | 2919081506 | 2919079590 | Bacteria | 5946433 |
| 594 | 2919477908 | 2919476304 | Bacteria | 5888696 |
| 595 | 2923513042 | 2923510766 | Bacteria | 5926163 |
| 596 | 2928133878 | 2928130867 | Bacteria | 5467269 |
| 597 | 2932411879 | 2932410948 | Bacteria | 6312192 |
| 598 | 2932418554 | 2932416698 | Bacteria | 6315112 |
| 599 | Ga0182008_10000119 | |||
| 600 | JGI24736J21556_1000622 | |||
| 601 | JGI24741J21665_1001939 | |||
| 602 | JGI24740J21852_10002530 | |||
| 603 | JGI25155J39150_1000132 | |||
| 604 | JGI25155J39150_1000204 | |||
| 605 | JGI25156J39149_1000154 | |||
| 606 | JGI25154J39366_1000401 | |||
| 607 | JGI25154J39366_1000462 | |||
| 608 | JGI25154J39366_1000584 | |||
| 609 | JGI25158J39367_1001697 | |||
| 610 | JGI25157J39369_1000169 | |||
| 611 | JGI25152J39213_1000071 | |||
| 612 | JGI25152J39213_1008174 | |||
| 613 | JGI25150J39212_1001132 | |||
| 614 | JGI25150J39212_1004210 | |||
| 615 | JGI25150J39212_1023915 | |||
| 616 | JGI25159J45721_1001513 | |||
| 617 | rootH1_10030757 | |||
| 618 | rootL2_10035620 | |||
| 619 | rootL2_10035621 | |||
| 620 | JGI25161J50226_1002030 | |||
| 621 | Ga0055538_1000070 | |||
| 622 | Ga0055539_1000105 | |||
| 623 | Ga0055533_1000113 | |||
| 624 | Ga0055532_1000017 | |||
| 625 | Ga0055525_1000153 | |||
| 626 | Ga0055529_1000836 | |||
| 627 | Ga0055526_1000023 | |||
| 628 | Ga0055526_1000093 | |||
| 629 | Ga0055526_1014758 | |||
| 630 | Ga0055526_1015012 | |||
| 631 | Ga0055537_1000129 | |||
| 632 | Ga0055537_1014279 | |||
| 633 | Ga0055524_1001524 | |||
| 634 | Ga0055524_1002022 | |||
| 635 | Ga0055524_1006163 | |||
| 636 | Ga0055524_1012128 | |||
| 637 | Ga0055534_1000594 | |||
| 638 | Ga0055534_1000965 | |||
| 639 | Ga0055534_1006448 | |||
| 640 | Ga0055528_1000013 | |||
| 641 | Ga0055530_10008006 | |||
| 642 | Ga0055531_10007685 | |||
| 643 | Ga0055541_1000071 | |||
| 644 | Ga0055543_1000257 | |||
| 645 | Ga0065165_1000296 | |||
| 646 | Ga0070658_10015291 | |||
| 647 | Ga0070676_10002125 | |||
| 648 | Ga0070683_100013472 | |||
| 649 | Ga0070670_100034164 | |||
| 650 | Ga0070670_100146878 | |||
| 651 | Ga0070677_10000503 | |||
| 652 | Ga0070680_100014045 | |||
| 653 | Ga0070680_100014372 | |||
| 654 | Ga0070682_100006613 | |||
| 655 | Ga0070682_100037177 | |||
| 656 | Ga0068868_100082159 | |||
| 657 | Ga0070660_100008001 | |||
| 658 | Ga0070691_10003585 | |||
| 659 | Ga0070661_100007333 | |||
| 660 | Ga0070692_10001511 | |||
| 661 | Ga0070668_100004906 | |||
| 662 | Ga0070675_100003996 | |||
| 663 | Ga0070671_100001515 | |||
| 664 | Ga0070674_100000820 | |||
| 665 | Ga0070673_100000942 | |||
| 666 | Ga0070659_100016131 | |||
| 667 | Ga0070667_100004180 | |||
| 668 | Ga0070701_10211897 | |||
| 669 | Ga0070663_100007817 | |||
| 670 | Ga0070663_100403543 | |||
| 671 | Ga0070662_100322386 | |||
| 672 | Ga0070681_10007131 | |||
| 673 | Ga0070681_10054098 | |||
| 674 | Ga0068867_100006618 | |||
| 675 | Ga0070685_10035025 | |||
| 676 | Ga0070679_100005054 | |||
| 677 | Ga0070679_100020024 | |||
| 678 | Ga0070684_100007023 | |||
| 679 | Ga0068853_100003222 | |||
| 680 | Ga0068853_100007747 | |||
| 681 | Ga0068853_100022204 | |||
| 682 | Ga0070672_100002351 | |||
| 683 | Ga0070665_100007171 | |||
| 684 | Ga0068855_100000645 | |||
| 685 | Ga0068855_100039144 | |||
| 686 | Ga0068857_100010439 | |||
| 687 | Ga0068857_100120115 | |||
| 688 | Ga0068857_100569558 | |||
| 689 | Ga0068854_100007809 | |||
| 690 | Ga0068854_100018764 | |||
| 691 | Ga0068856_100034723 | |||
| 692 | Ga0068852_100008844 | |||
| 693 | Ga0068852_100009587 | |||
| 694 | Ga0068864_100009648 | |||
| 695 | Ga0068861_100508504 | |||
| 696 | Ga0068851_10000337 | |||
| 697 | Ga0068870_10002201 | |||
| 698 | Ga0068863_100159200 | |||
| 699 | Ga0068858_100188609 | |||
| 700 | Ga0068860_100016807 | |||
| 701 | Ga0081455_10109804 | |||
| 702 | Ga0070717_10343075 | |||
| 703 | Ga0070712_100010843 | |||
| 704 | Ga0075366_10021765 | |||
| 705 | Ga0097621_100142077 | |||
| 706 | Ga0068871_100019557 | |||
| 707 | Ga0068865_100046168 | |||
| 708 | Ga0079104_1011794 | |||
| 709 | Ga0105251_10012847 | |||
| 710 | Ga0105244_10004545 | |||
| 711 | Ga0105244_10004656 | |||
| 712 | Ga0105240_10008095 | |||
| 713 | Ga0105240_10028762 | |||
| 714 | Ga0105240_10031188 | |||
| 715 | Ga0105240_10143049 | |||
| 716 | Ga0105242_10271703 | |||
| 717 | Ga0105238_10000213 | |||
| 718 | Ga0105239_10010698 | |||
| 719 | Ga0105239_10745024 | |||
| 720 | Ga0157373_10012705 | |||
| 721 | Ga0157373_10022750 | |||
| 722 | Ga0157371_10012336 | |||
| 723 | Ga0157370_10035175 | |||
| 724 | Ga0157369_10017641 | |||
| 725 | Ga0163162_10092537 | |||
| 726 | Ga0157372_10015387 | |||
| 727 | Ga0157375_10014562 | |||
| 728 | Ga0157375_10015014 | |||
| 729 | Ga0157376_10059642 | |||
| 730 | Ga0182006_1000008 | |||
| 731 | Ga0182006_1000067 | |||
| 732 | Ga0182006_1005802 | |||
| 733 | Ga0182007_10001506 | |||
| 734 | Ga0182007_10011770 | |||
| 735 | Ga0182005_1000002 | |||
| 736 | Ga0182005_1000008 | |||
| 737 | Ga0163161_10093305 | |||
| 738 | Ga0163161_10100826 | |||
| 739 | Ga0197907_10920354 | |||
| 740 | Ga0206356_11707524 | |||
| 741 | Ga0206354_10831098 | |||
| 742 | Ga0206353_10297193 | |||
| 743 | Ga0154015_1003343 | |||
| 744 | Ga0213872_10000148 | |||
| 745 | Ga0213872_10000952 | |||
| 746 | Ga0213872_10010316 | |||
| 747 | Ga0213872_10012846 | |||
| 748 | Ga0213872_10077561 | |||
| 749 | Ga0209435_100015 | |||
| 750 | Ga0209435_100162 | |||
| 751 | Ga0209436_100030 | |||
| 752 | Ga0209436_105529 | |||
| 753 | Ga0209784_100009 | |||
| 754 | Ga0209566_100007 | |||
| 755 | Ga0209674_100018 | |||
| 756 | Ga0209147_100004 | |||
| 757 | Ga0209563_100020 | |||
| 758 | Ga0209437_100045 | |||
| 759 | Ga0209258_100226 | |||
| 760 | Ga0207425_1000001 | |||
| 761 | Ga0207425_1000048 | |||
| 762 | Ga0207425_1001395 | |||
| 763 | Ga0207425_1008583 | |||
| 764 | Ga0209646_1000020 | |||
| 765 | Ga0209646_1000040 | |||
| 766 | Ga0209646_1000252 | |||
| 767 | Ga0209026_1000034 | |||
| 768 | Ga0209026_1004555 | |||
| 769 | Ga0209026_1011731 | |||
| 770 | Ga0209677_100010 | |||
| 771 | Ga0209759_1000049 | |||
| 772 | Ga0209759_1000809 | |||
| 773 | Ga0209129_1000003 | |||
| 774 | Ga0209129_1005240 | |||
| 775 | Ga0209565_1000003 | |||
| 776 | Ga0209565_1003876 | |||
| 777 | Ga0209565_1005148 | |||
| 778 | Ga0209455_1000026 | |||
| 779 | Ga0209455_1002265 | |||
| 780 | Ga0209673_1000003 | |||
| 781 | Ga0209130_1000194 | |||
| 782 | Ga0209130_1003496 | |||
| 783 | Ga0209130_1011501 | |||
| 784 | Ga0209675_1000003 | |||
| 785 | Ga0209675_1008241 | |||
| 786 | Ga0209675_1010068 | |||
| 787 | Ga0209025_1009622 | |||
| 788 | Ga0209564_1000002 | |||
| 789 | Ga0209564_1000007 | |||
| 790 | Ga0209564_1000012 | |||
| 791 | Ga0209564_1000199 | |||
| 792 | Ga0209564_1011504 | |||
| 793 | Ga0209564_1014810 | |||
| 794 | Ga0209758_1000041 | |||
| 795 | Ga0209758_1000679 | |||
| 796 | Ga0209050_1000089 | |||
| 797 | Ga0209050_1006473 | |||
| 798 | Ga0209050_1032512 | |||
| 799 | Ga0209256_1000112 | |||
| 800 | Ga0209256_1000163 | |||
| 801 | Ga0209256_1000334 | |||
| 802 | Ga0209256_1008572 | |||
| 803 | Ga0207426_1019542 | |||
| 804 | Ga0209051_1035726 | |||
| 805 | Ga0209257_1000003 | |||
| 806 | Ga0207697_10025189 | |||
| 807 | Ga0207655_1009232 | |||
| 808 | Ga0207655_1019524 | |||
| 809 | Ga0207682_10000941 | |||
| 810 | Ga0207680_10016018 | |||
| 811 | Ga0207647_10011731 | |||
| 812 | Ga0207645_10000645 | |||
| 813 | Ga0207643_10006063 | |||
| 814 | Ga0207705_10000968 | |||
| 815 | Ga0207707_10001282 | |||
| 816 | Ga0207707_10002882 | |||
| 817 | Ga0207695_10001039 | |||
| 818 | Ga0207695_10004188 | |||
| 819 | Ga0207695_10006509 | |||
| 820 | Ga0207695_10040809 | |||
| 821 | Ga0207693_10072058 | |||
| 822 | Ga0207660_10001117 | |||
| 823 | Ga0207660_10009834 | |||
| 824 | Ga0207662_10421753 | |||
| 825 | Ga0207657_10008022 | |||
| 826 | Ga0207649_10005238 | |||
| 827 | Ga0207652_10001658 | |||
| 828 | Ga0207652_10004611 | |||
| 829 | Ga0207694_10001111 | |||
| 830 | Ga0207650_10042756 | |||
| 831 | Ga0207650_10173087 | |||
| 832 | Ga0207659_10023547 | |||
| 833 | Ga0207644_10011870 | |||
| 834 | Ga0207690_10007706 | |||
| 835 | Ga0207670_10381074 | |||
| 836 | Ga0207669_10000959 | |||
| 837 | Ga0207691_10000226 | |||
| 838 | Ga0207711_10172967 | |||
| 839 | Ga0207689_10068442 | |||
| 840 | Ga0207661_10010699 | |||
| 841 | Ga0207667_10000191 | |||
| 842 | Ga0207667_10001277 | |||
| 843 | Ga0207667_10174926 | |||
| 844 | Ga0207651_10003124 | |||
| 845 | Ga0207668_10047536 | |||
| 846 | Ga0207640_10005025 | |||
| 847 | Ga0207703_10287725 | |||
| 848 | Ga0207639_10008090 | |||
| 849 | Ga0207678_10018407 | |||
| 850 | Ga0207702_10000474 | |||
| 851 | Ga0207641_10006327 | |||
| 852 | Ga0207641_10491517 | |||
| 853 | Ga0207648_10012020 | |||
| 854 | Ga0207674_10031021 | |||
| 855 | Ga0207674_10053930 | |||
| 856 | Ga0207683_10000022 | |||
| 857 | Ga0207698_10000276 | |||
| 858 | Ga0207698_10009589 | |||
| 859 | Ga0209281_1004582 | |||
| 860 | Ga0268266_10005048 | |||
| 861 | Ga0268264_10043371 | |||
| 862 | Ga0265338_10048239 | |||
| 863 | Ga0316177_1204095 | |||
| 864 | Ga0316180_1144385 | |||
| 865 | Ga0316182_1094945 | |||
| 866 | Ga0265331_10017318 | |||
| 867 | Ga0307408_100000123 | |||
| 868 | Ga0307408_100000405 | |||
| 869 | Ga0307408_100002117 | |||
| 870 | Ga0307408_100159019 | |||
| 871 | Ga0307408_100185853 | |||
| 872 | Ga0307408_100305928 | |||
| 873 | Ga0307406_10005922 | |||
| 874 | Ga0307414_10028934 | |||
| 875 | Ga0395899_0125026 | |||
| 876 | Ga0395899_0258722 | |||
| 877 | Ga0395899_0455075 | |||
| 878 | Ga0395900_0022865 | |||
| 879 | Ga0395900_0153100 | |||
| 880 | Ga0395900_0218651 | |||
| 881 | Ga0395898_0009320 | |||
| 882 | Ga0395905_0091347 | |||
| 883 | Ga0395901_0000852 | |||
| 884 | Ga0395901_0070309 | |||
| 885 | Ga0436361_0061503 | |||
| 886 | Ga0436361_0066267 | |||
| 887 | Ga0436361_0208984 | |||
| 888 | Ga0436361_0249401 | |||
| 889 | Ga0436361_0355761 | |||
| 890 | Ga0436361_0582882 | |||
| 891 | Ga0436361_1127900 | |||
| 892 | Ga0436361_1137694 | |||
| 893 | Ga0450891_001876 | |||
| 894 | Ga0466969_0074686 | |||
| 895 | Ga0466972_0000201 | |||
| 896 | Ga0466972_0012055 | |||
| 897 | Ga0466972_0100758 | |||
| 898 | Ga0466965_0001752 | |||
| 899 | Ga0466965_0143202 | |||
| 900 | Ga0466966_0011912 | |||
| 901 | Ga0466964_0008546 | |||
| 902 | Ga0466964_0030771 | |||
| 903 | Ga0466968_0020841 | |||
| 904 | Ga0466968_0035277 | |||
| 905 | Ga0466968_0135202 | |||
| 906 | Ga0466970_0076094 | |||
| 907 | Ga0466957_0083551 | |||
| 908 | Ga0495617_000013 | |||
| 909 | Ga0495617_003301 | |||
| 910 | Ga0495617_005003 | |||
| 911 | Ga0495617_018999 | |||
| 912 | Ga0495617_055804 | |||
| 913 | Ga0495627_000001 | |||
| 914 | Ga0495590_0000016 | |||
| 915 | Ga0495590_0022671 | |||
| 916 | Ga0495638_0000057 | |||
| 917 | Ga0495638_0004128 | |||
| 918 | Ga0495638_0056530 | |||
| 919 | Ga0495653_0000025 | |||
| 920 | Ga0495650_0000129 | |||
| 921 | Ga0495650_0000226 | |||
| 922 | Ga0495650_0000246 | |||
| 923 | Ga0495650_0000289 | |||
| 924 | Ga0495650_0000348 | |||
| 925 | Ga0495650_0044851 | |||
| 926 | Ga0495605_0000139 | |||
| 927 | Ga0495605_0001875 | |||
| 928 | Ga0495605_0042384 | |||
| 929 | Ga0495639_0017786 | |||
| 930 | Ga0495584_0000249 | |||
| 931 | Ga0495584_0090556 | |||
| 932 | Ga0495585_0019035 | |||
| 933 | Ga0495585_0030455 | |||
| 934 | Ga0495585_0058745 | |||
| 935 | Ga0495585_0092983 | |||
| 936 | Ga0495585_0140606 | |||
| 937 | Ga0495596_0006652 | |||
| 938 | Ga0495607_0014033 | |||
| 939 | Ga0495607_0020177 | |||
| 940 | Ga0495607_0026933 | |||
| 941 | Ga0495607_0036570 | |||
| 942 | Ga0495607_0047634 | |||
| 943 | Ga0495607_0172959 | |||
| 944 | Ga0495583_0000009 | |||
| 945 | Ga0495583_0000396 | |||
| 946 | Ga0495583_0000688 | |||
| 947 | Ga0495606_0000087 | |||
| 948 | Ga0495606_0000137 | |||
| 949 | Ga0495606_0000197 | |||
| 950 | Ga0495606_0000573 | |||
| 951 | Ga0495606_0001754 | |||
| 952 | Ga0495606_0001765 | |||
| 953 | Ga0495606_0007194 | |||
| 954 | Ga0495606_0007396 | |||
| 955 | Ga0495606_0021465 | |||
| 956 | Ga0495606_0039610 | |||
| 957 | Ga0495606_0088226 | |||
| 958 | Ga0495606_0171458 | |||
| 959 | Ga0495610_0000008 | |||
| 960 | Ga0495610_0003847 | |||
| 961 | Ga0495610_0004964 | |||
| 962 | Ga0495610_0005455 | |||
| 963 | Ga0495610_0052378 | |||
| 964 | Ga0495610_0088120 | |||
| 965 | Ga0495616_0000761 | |||
| 966 | Ga0495616_0018907 | |||
| 967 | Ga0495637_0000404 | |||
| 968 | Ga0495637_0023363 | |||
| 969 | Ga0495637_0096718 | |||
| 970 | Ga0495643_0000236 | |||
| 971 | Ga0495643_0000289 | |||
| 972 | Ga0495643_0177305 | |||
| 973 | Ga0495644_0000527 | |||
| 974 | Ga0495644_0006564 | |||
| 975 | Ga0495648_0000002 | |||
| 976 | Ga0495648_0002256 | |||
| 977 | Ga0495648_0005244 | |||
| 978 | Ga0495648_0011919 | |||
| 979 | Ga0495648_0050843 | |||
| 980 | Ga0495648_0096262 | |||
| 981 | Ga0495642_0003770 | |||
| 982 | Ga0495642_0008063 | |||
| 983 | Ga0495642_0084904 | |||
| 984 | Ga0495654_0000002 | |||
| 985 | Ga0495654_0031792 | |||
| 986 | Ga0495654_0063659 | |||
| 987 | Ga0495598_0043435 | |||
| 988 | Ga0495609_0000541 | |||
| 989 | Ga0495609_0009695 | |||
| 990 | Ga0495609_0010811 | |||
| 991 | Ga0495609_0013838 | |||
| 992 | Ga0495609_0025559 | |||
| 993 | Ga0495609_0041227 | |||
| 994 | Ga0495609_0052280 | |||
| 995 | Ga0495621_0003018 | |||
| 996 | Ga0495621_0098186 | |||
| 997 | Ga0495597_0000025 | |||
| 998 | Ga0495597_0000848 | |||
| 999 | Ga0495597_0041028 | |||
| 1000 | Ga0495597_0094603 | |||
| 1001 | Ga0495622_0000023 | |||
| 1002 | Ga0495622_0000816 | |||
| 1003 | Ga0495622_0046998 | |||
| 1004 | Ga0495633_0000073 | |||
| 1005 | Ga0495633_0000399 | |||
| 1006 | Ga0495633_0007655 | |||
| 1007 | Ga0495633_0008319 | |||
| 1008 | Ga0495633_0011430 | |||
| 1009 | Ga0495633_0023761 | |||
| 1010 | Ga0495633_0026360 | |||
| 1011 | Ga0495633_0033544 | |||
| 1012 | Ga0495656_0040260 | |||
| 1013 | Ga0495656_0073187 | |||
| 1014 | Ga0495668_0000083 | |||
| 1015 | Ga0495668_0000132 | |||
| 1016 | Ga0495668_0001954 | |||
| 1017 | Ga0495668_0002007 | |||
| 1018 | Ga0495611_0030469 | |||
| 1019 | Ga0495611_0046148 | |||
| 1020 | Ga0495611_0072547 | |||
| 1021 | Ga0495625_0000177 | |||
| 1022 | Ga0495625_0000482 | |||
| 1023 | Ga0495625_0002519 | |||
| 1024 | Ga0495625_0083052 | |||
| 1025 | Ga0495625_0088411 | |||
| 1026 | Ga0495625_0093541 | |||
| 1027 | Ga0495625_0162209 | |||
| 1028 | Ga0495625_0174033 | |||
| 1029 | Ga0495625_0290901 | |||
| 1030 | Ga0495659_0000154 | |||
| 1031 | Ga0495659_0000394 | |||
| 1032 | Ga0495661_0121846 | |||
| 1033 | Ga0495623_0069440 | |||
| 1034 | Ga0495670_0000099 | |||
| 1035 | Ga0495670_0011768 | |||
| 1036 | Ga0495670_0034938 | |||
| 1037 | Ga0495670_0214037 | |||
| 1038 | Ga0495671_0000002 | |||
| 1039 | Ga0495671_0000282 | |||
| 1040 | Ga0495671_0050074 | |||
| 1041 | Ga0495671_0051125 | |||
| 1042 | Ga0495671_0052657 | |||
| 1043 | Ga0495649_0011278 | |||
| 1044 | Ga0495649_0203111 | |||
| 1045 | Ga0495660_0000473 | |||
| 1046 | Ga0495660_0001536 | |||
| 1047 | Ga0495660_0002502 | |||
| 1048 | Ga0495660_0042988 | |||
| 1049 | Ga0495660_0067640 | |||
| 1050 | Ga0495660_0092871 | |||
| 1051 | Ga0495636_0004129 | |||
| 1052 | Ga0495672_0000063 | |||
| 1053 | Ga0495672_0000291 | |||
| 1054 | Ga0495672_0001774 | |||
| 1055 | Ga0495672_0022462 | |||
| 1056 | Ga0495672_0029323 | |||
| 1057 | Ga0495672_0032420 | |||
| 1058 | Ga0495683_0002242 | |||
| 1059 | Ga0495683_0041964 | |||
| 1060 | Ga0495687_000587 | |||
| 1061 | Ga0495687_009668 | |||
| 1062 | Ga0495687_039151 | |||
| 1063 | Ga0495677_0013618 | |||
| 1064 | Ga0495677_0018818 | |||
| 1065 | Ga0495677_0031843 | |||
| 1066 | Ga0495677_0043624 | |||
| 1067 | Ga0495679_052687 | |||
| 1068 | Ga0495673_0000005 | |||
| 1069 | Ga0495673_0000015 | |||
| 1070 | Ga0495673_0000044 | |||
| 1071 | Ga0495673_0014024 | |||
| 1072 | Ga0495673_0044141 | |||
| 1073 | Ga0495686_0000488 | |||
| 1074 | Ga0495686_0094774 | |||
| 1075 | Ga0495686_0215834 | |||
| 1076 | Ga0495614_0047091 | |||
| 1077 | Ga0495626_0073030 | |||
| 1078 | Ga0496101_0046587 | |||
| 1079 | Ga0496103_0005164 | |||
| 1080 | Ga0496103_0141188 | |||
| 1081 | Ga0496105_0105836 | |||
| 1082 | Ga0496108_0009055 | |||
| 1083 | Ga0496109_0025459 | |||
| 1084 | Ga0496110_0093715 | |||
| 1085 | Ga0496111_0120771 | |||
| 1086 | Ga0496111_0148680 | |||
| 1087 | Ga0496116_0039707 | |||
| 1088 | Ga0496116_0044254 | |||
| 1089 | Ga0496116_0049011 | |||
| 1090 | Ga0496116_0126328 | |||
| 1091 | Ga0496117_0000001 | |||
| 1092 | Ga0496118_0000002 | |||
| 1093 | Ga0496118_0114516 | |||
| 1094 | Ga0496118_0284831 | |||
| 1095 | Ga0496120_0051377 | |||
| 1096 | Ga0496121_0015651 | |||
| 1097 | Ga0496121_0017195 | |||
| 1098 | Ga0496121_0042446 | |||
| 1099 | Ga0496121_0094298 | |||
| 1100 | Ga0496121_0159233 | |||
| 1101 | Ga0496121_0164068 | |||
| 1102 | Ga0496121_0364605 | |||
| 1103 | Ga0496122_0001290 | |||
| 1104 | Ga0496122_0198352 | |||
| 1105 | Ga0496123_0001053 | |||
| 1106 | Ga0496123_0011598 | |||
| 1107 | Ga0496123_0077795 | |||
| 1108 | Ga0496124_0093882 | |||
| 1109 | Ga0496124_0114180 | |||
| 1110 | Ga0496124_0165936 | |||
| 1111 | Ga0496124_0234525 | |||
| 1112 | Ga0496124_0515965 | |||
| 1113 | Ga0496125_0070939 | |||
| 1114 | Ga0496125_0164246 | |||
| 1115 | Ga0496125_0183358 | |||
| 1116 | Ga0496126_0002465 | |||
| 1117 | Ga0495678_000002 | |||
| 1118 | Ga0495678_000069 | |||
| 1119 | Ga0495678_002088 | |||
| 1120 | Ga0495682_0000522 | |||
| 1121 | Ga0495682_0001454 | |||
| 1122 | Ga0501031_0189841 | |||
| 1123 | Ga0501047_0031158 | |||
| 1124 | Ga0501047_0488797 | |||
| 1125 | Ga0501069_0037735 | |||
| 1126 | Ga0501070_0003058 | |||
| 1127 | Ga0501070_0018741 | |||
| 1128 | Ga0501070_0129833 | |||
| 1129 | Ga0501074_0001678 | |||
| 1130 | Ga0501222_001905 | |||
| 1131 | Ga0501227_016453 | |||
| 1132 | Ga0501080_0173204 | |||
| 1133 | Ga0501269_000028 | |||
| 1134 | Ga0501279_001113 | |||
| 1135 | Ga0501035_0006572 | |||
| 1136 | Ga0501035_0047104 | |||
| 1137 | Ga0501044_0016102 | |||
| 1138 | nmdc:mga05p37_394950_c1 | |||
| 1139 | nmdc:mga0n895_399776_c1 | |||
| 1140 | Ga0500557_082127 | |||
| 1141 | Ga0500594_0036043 | |||
| 1142 | Ga0500618_000044 | |||
| 1143 | Ga0500618_001190 | |||
| 1144 | Ga0500637_0032236 | |||
| 1145 | 2511250094 | |||
| 1146 | 2521559374 | |||
| 1147 | 2550693618 | |||
| 1148 | 2553007294 | |||
| 1149 | 2601668171 | |||
| 1150 | 2643792368 | |||
| 1151 | 2644027564 | |||
| 1152 | 2644212142 | |||
| 1153 | 2644251004 | |||
| 1154 | 2644354814 | |||
| 1155 | 2738715374 | |||
| 1156 | 2738739754 | |||
| 1157 | 2738828139 | |||
| 1158 | 2738842245 | |||
| 1159 | 2739151935 | |||
| 1160 | 2739194044 | |||
| 1161 | 2739273946 | |||
| 1162 | 2739320331 | |||
| 1163 | 2739338761 | |||
| 1164 | 2739342990 | |||
| 1165 | 2765570624 | |||
| 1166 | 2808983437 | |||
| 1167 | 2809128664 | |||
| 1168 | 2809148285 | |||
| 1169 | 2819592073 | |||
| 1170 | 2819615904 | |||
| 1171 | 2821132590 | |||
| 1172 | 2839098170 | |||
| 1173 | 2842716557 | |||
| 1174 | 2852620293 | |||
| 1175 | 2857550405 | |||
| 1176 | 2857557281 | |||
| 1177 | 2857560154 | |||
| 1178 | 2857566662 | |||
| 1179 | 2884816934 | |||
| 1180 | 2884840509 | |||
| 1181 | 2884855766 | |||
| 1182 | 2885085279 | |||
| 1183 | 2896157309 | |||
| 1184 | 2904424405 | |||
| 1185 | 2904443788 | |||
| 1186 | 2904532687 | |||
| 1187 | 2904585181 | |||
| 1188 | 2904593530 | |||
| 1189 | 2904605713 | |||
| 1190 | 2919048016 | |||
| 1191 | 2919081506 | |||
| 1192 | 2919477908 | |||
| 1193 | 2923513042 | |||
| 1194 | 2928133878 | |||
| 1195 | 2932411879 | |||
| 1196 | 2932418554 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s0i-assembly1.cif.gz_A | crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site | 0.9517 | 3 | 257 |
| 2qed-assembly1.cif.gz_A | crystal structure of salmonella thyphimurium lt2 glyoxalase ii | 0.9453 | 1 | 257 |
| 6s0i-assembly1.cif.gz_A | crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site | 0.9444 | 3 | 257 |
| 2qed-assembly1.cif.gz_A | crystal structure of salmonella thyphimurium lt2 glyoxalase ii | 0.9417 | 1 | 257 |
| 8ewo-assembly2.cif.gz_B | crystal structure of putative glyoxylase ii from pseudomonas aeruginosa | 0.9401 | 1 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2obwA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9455 | 1 | 257 | 3.60.15.10 |
| 2obwA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9419 | 1 | 257 | 3.60.15.10 |
| af_Q8N490_119_385_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9368 | 3 | 259 | 3.60.15.10 |
| af_I1MD49_73_326_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9301 | 3 | 257 | 3.60.15.10 |
| af_K7KLP6_1_199_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9288 | 3 | 170 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522RZU3-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 0.9884 | 1 | 259 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-A0A7R8ZYR4-F1-model_v4 | hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) | 0.9815 | 1 | 222 |
GO:0004416
GO:0005261 GO:0016020 GO:0019243 GO:0031123 GO:0046872 |
| AF-A0A0R2V9S8-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 0.9796 | 12 | 257 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-A0A1T2L6A1-F1-model_v4 | Hydroxyacylglutathione hydrolase | 0.9766 | 1 | 154 |
GO:0016787
|
| AF-A0A1X1MT64-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 0.9732 | 1 | 257 |
GO:0004416
GO:0019243 GO:0046872 |