F467786

General Info

Members Datasets Scaffolds Average Seq Length
598 337 1196 265

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10000119|Ga0182008_1000011911
Length 285
Sequence MDFSDATLSIQFSLLLMTHSPEHALSVLAVPAFADNYLWLIHDGRHAAVVDPGDAMAILDALQAHQLTLSAILLTHHHADHTGGVPELLQHFAVPVFGPRNEAITAITEPLAEGDVAYVAELGLQMTVIDVPGHTKGHIAYVRQRDERSGAPWLFSGDTLFAGGCGRLFEGTPGQMADSLGKLAALPDDTEVFCAHEYTLSNLRFANAVEPGNVALQERIAIDTEKRQQGLSTVPSTIALEKATNPFLRYREPAILTSLKVEGKLASDASPVEAFAALRMWKNNF

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
107 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
179 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
180 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
201 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
202 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
244 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
274 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
277 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
283 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
284 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
285 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
286 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
287 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
288 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
289 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
290 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
291 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
292 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
293 2643221638 Duganella sp. Root336D2 Isolate Unclassified
294 2643221645 Massilia sp. Root351 Isolate Unclassified
295 2643221664 Massilia sp. Root418 Isolate Unclassified
296 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
297 2738541280 Massilia sp. GV090 Isolate Unclassified
298 2738541297 Duganella sp. GV083 Isolate Unclassified
299 2738541300 Massilia sp. GV016 Isolate Unclassified
300 2738541357 Duganella sp. GV053 Isolate Unclassified
301 2738543003 Duganella sp. GV066 Isolate Unclassified
302 2738543018 Massilia sp. GV045 Isolate Unclassified
303 2738543026 Duganella sp. GV089 Isolate Unclassified
304 2738543029 Duganella sp. GV039 Isolate Unclassified
305 2738543030 Massilia sp. GV097 Isolate Unclassified
306 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
307 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
308 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
309 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
310 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
311 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
312 2821131069 Duganella sp. 1224 Isolate Unclassified
313 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
314 2842711865 Duganella sp. R-73148 Isolate Unclassified
315 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
316 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
317 2857553236 Duganella sp. R-74557 Isolate Unclassified
318 2857558681 Duganella sp. R-74565 Isolate Unclassified
319 2857564685 Duganella sp. R-74599 Isolate Unclassified
320 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
321 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
322 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
323 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
324 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
325 2904424332 Duganella sp. 1411 Isolate Rhizosphere
326 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
327 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
328 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
329 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
330 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
331 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
332 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
333 2919476304 Duganella sp. 3397 Isolate Unclassified
334 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
335 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
336 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
337 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.47
Metatranscriptomes 0.84
Isolates 8.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.38
Nodule 0.84
Rhizoplane 1.67
Rhizosphere 68.9
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10000119 3300014497 Bacteria 59427
2 JGI24736J21556_1000622 3300001904 Bacteria 6514
3 JGI24741J21665_1001939 3300001915 Bacteria 5578
4 JGI24740J21852_10002530 3300001979 Bacteria 8255
5 JGI25155J39150_1000132 3300002704 Bacteria 35559
6 JGI25155J39150_1000204 3300002704 Bacteria 24399
7 JGI25156J39149_1000154 3300002705 Bacteria 50528
8 JGI25154J39366_1000401 3300002738 Bacteria 23593
9 JGI25154J39366_1000462 3300002738 Bacteria 21234
10 JGI25154J39366_1000584 3300002738 Bacteria 17690
11 JGI25158J39367_1001697 3300002739 Bacteria 3773
12 JGI25157J39369_1000169 3300002741 Bacteria 55047
13 JGI25152J39213_1000071 3300002773 Bacteria 66888
14 JGI25152J39213_1008174 3300002773 Bacteria 2622
15 JGI25150J39212_1001132 3300002774 Bacteria 8025
16 JGI25150J39212_1004210 3300002774 Bacteria 3237
17 JGI25150J39212_1023915 3300002774 Bacteria 904
18 JGI25159J45721_1001513 3300002987 Bacteria 9529
19 rootH1_10030757 3300003316 Bacteria 6605
20 rootL2_10035620 3300003322 Bacteria 2417
21 rootL2_10035621 3300003322 Bacteria 1331
22 JGI25161J50226_1002030 3300003374 Bacteria 5508
23 Ga0055538_1000070 3300003751 Bacteria 93518
24 Ga0055539_1000105 3300003752 Bacteria 93518
25 Ga0055533_1000113 3300003756 Bacteria 93518
26 Ga0055532_1000017 3300003758 Bacteria 306880
27 Ga0055525_1000153 3300003759 Bacteria 93518
28 Ga0055529_1000836 3300003763 Bacteria 18140
29 Ga0055526_1000023 3300003771 Bacteria 163444
30 Ga0055526_1000093 3300003771 Bacteria 81432
31 Ga0055526_1014758 3300003771 Bacteria 3186
32 Ga0055526_1015012 3300003771 Bacteria 3138
33 Ga0055537_1000129 3300003773 Bacteria 57643
34 Ga0055537_1014279 3300003773 Bacteria 1449
35 Ga0055524_1001524 3300003775 Bacteria 13106
36 Ga0055524_1002022 3300003775 Bacteria 10819
37 Ga0055524_1006163 3300003775 Bacteria 5237
38 Ga0055524_1012128 3300003775 Bacteria 3326
39 Ga0055534_1000594 3300003784 Bacteria 18790
40 Ga0055534_1000965 3300003784 Bacteria 12758
41 Ga0055534_1006448 3300003784 Bacteria 2950
42 Ga0055528_1000013 3300003790 Bacteria 176239
43 Ga0055530_10008006 3300003791 Bacteria 4317
44 Ga0055531_10007685 3300003794 Bacteria 5825
45 Ga0055541_1000071 3300003841 Bacteria 93518
46 Ga0055543_1000257 3300004625 Bacteria 39860
47 Ga0065165_1000296 3300005262 Bacteria 83947
48 Ga0070658_10015291 3300005327 Bacteria 6141
49 Ga0070676_10002125 3300005328 Bacteria 10088
50 Ga0070683_100013472 3300005329 Bacteria 7133
51 Ga0070670_100034164 3300005331 Bacteria 4377
52 Ga0070670_100146878 3300005331 Bacteria 2040
53 Ga0070677_10000503 3300005333 Bacteria 13490
54 Ga0070680_100014045 3300005336 Bacteria 6253
55 Ga0070680_100014372 3300005336 Bacteria 6186
56 Ga0070682_100006613 3300005337 Bacteria 6502
57 Ga0070682_100037177 3300005337 Bacteria 2979
58 Ga0068868_100082159 3300005338 Bacteria 2584
59 Ga0070660_100008001 3300005339 Bacteria 7385
60 Ga0070691_10003585 3300005341 Bacteria 7009
61 Ga0070661_100007333 3300005344 Bacteria 7608
62 Ga0070692_10001511 3300005345 Bacteria 8515
63 Ga0070668_100004906 3300005347 Bacteria 9911
64 Ga0070675_100003996 3300005354 Bacteria 11193
65 Ga0070671_100001515 3300005355 Bacteria 17419
66 Ga0070674_100000820 3300005356 Bacteria 16057
67 Ga0070673_100000942 3300005364 Bacteria 16474
68 Ga0070659_100016131 3300005366 Bacteria 5606
69 Ga0070667_100004180 3300005367 Bacteria 12191
70 Ga0070701_10211897 3300005438 Bacteria 1151
71 Ga0070663_100007817 3300005455 Bacteria 6536
72 Ga0070663_100403543 3300005455 Bacteria 1118
73 Ga0070662_100322386 3300005457 Bacteria 1260
74 Ga0070681_10007131 3300005458 Bacteria 10890
75 Ga0070681_10054098 3300005458 Bacteria 3999
76 Ga0068867_100006618 3300005459 Bacteria 8191
77 Ga0070685_10035025 3300005466 Bacteria 2831
78 Ga0070679_100005054 3300005530 Bacteria 12176
79 Ga0070679_100020024 3300005530 Bacteria 6519
80 Ga0070684_100007023 3300005535 Bacteria 8750
81 Ga0068853_100003222 3300005539 Bacteria 12479
82 Ga0068853_100007747 3300005539 Bacteria 8610
83 Ga0068853_100022204 3300005539 Bacteria 5298
84 Ga0070672_100002351 3300005543 Bacteria 11958
85 Ga0070665_100007171 3300005548 Bacteria 11334
86 Ga0068855_100000645 3300005563 Bacteria 42677
87 Ga0068855_100039144 3300005563 Bacteria 5628
88 Ga0068857_100010439 3300005577 Bacteria 8072
89 Ga0068857_100120115 3300005577 Bacteria 2366
90 Ga0068857_100569558 3300005577 Bacteria 1068
91 Ga0068854_100007809 3300005578 Bacteria 6844
92 Ga0068854_100018764 3300005578 Bacteria 4649
93 Ga0068856_100034723 3300005614 Bacteria 4940
94 Ga0068852_100008844 3300005616 Bacteria 7450
95 Ga0068852_100009587 3300005616 Bacteria 7195
96 Ga0068864_100009648 3300005618 Bacteria 7964
97 Ga0068861_100508504 3300005719 Bacteria 1090
98 Ga0068851_10000337 3300005834 Bacteria 21233
99 Ga0068870_10002201 3300005840 Bacteria 8075
100 Ga0068863_100159200 3300005841 Bacteria 2163
101 Ga0068858_100188609 3300005842 Bacteria 1948
102 Ga0068860_100016807 3300005843 Bacteria 7133
103 Ga0081455_10109804 3300005937 Bacteria 2194
104 Ga0070717_10343075 3300006028 Bacteria 1334
105 Ga0070712_100010843 3300006175 Bacteria 5764
106 Ga0075366_10021765 3300006195 Bacteria 3728
107 Ga0097621_100142077 3300006237 Bacteria 2052
108 Ga0068871_100019557 3300006358 Bacteria 5172
109 Ga0068865_100046168 3300006881 Bacteria 2988
110 Ga0079104_1011794 3300006946 Bacteria 2787
111 Ga0105251_10012847 3300009011 Bacteria 4715
112 Ga0105244_10004545 3300009036 Bacteria 9507
113 Ga0105244_10004656 3300009036 Bacteria 9362
114 Ga0105240_10008095 3300009093 Bacteria 15097
115 Ga0105240_10028762 3300009093 Bacteria 7250
116 Ga0105240_10031188 3300009093 Bacteria 6916
117 Ga0105240_10143049 3300009093 Bacteria 2858
118 Ga0105242_10271703 3300009176 Bacteria 1536
119 Ga0105238_10000213 3300009551 Bacteria 64398
120 Ga0105239_10010698 3300010375 Bacteria 10254
121 Ga0105239_10745024 3300010375 Bacteria 1121
122 Ga0157373_10012705 3300013100 Bacteria 6188
123 Ga0157373_10022750 3300013100 Bacteria 4546
124 Ga0157371_10012336 3300013102 Bacteria 6539
125 Ga0157370_10035175 3300013104 Bacteria 4871
126 Ga0157369_10017641 3300013105 Bacteria 8021
127 Ga0163162_10092537 3300013306 Bacteria 3107
128 Ga0157372_10015387 3300013307 Bacteria 8198
129 Ga0157375_10014562 3300013308 Bacteria 7020
130 Ga0157375_10015014 3300013308 Bacteria 6927
131 Ga0157376_10059642 3300014969 Bacteria 3200
132 Ga0182006_1000008 3300015261 Bacteria 449652
133 Ga0182006_1000067 3300015261 Bacteria 147932
134 Ga0182006_1005802 3300015261 Bacteria 5819
135 Ga0182007_10001506 3300015262 Bacteria 12429
136 Ga0182007_10011770 3300015262 Bacteria 3392
137 Ga0182005_1000002 3300015265 Bacteria 908499
138 Ga0182005_1000008 3300015265 Bacteria 471394
139 Ga0163161_10093305 3300017792 Bacteria 2230
140 Ga0163161_10100826 3300017792 Bacteria 2149
141 Ga0197907_10920354 3300020069 Bacteria 3355
142 Ga0206356_11707524 3300020070 Bacteria 7322
143 Ga0206354_10831098 3300020081 Bacteria 13528
144 Ga0206353_10297193 3300020082 Bacteria 5105
145 Ga0154015_1003343 3300020610 Bacteria 4307
146 Ga0213872_10000148 3300021361 Bacteria 64199
147 Ga0213872_10000952 3300021361 Bacteria 20247
148 Ga0213872_10010316 3300021361 Bacteria 4450
149 Ga0213872_10012846 3300021361 Bacteria 3929
150 Ga0213872_10077561 3300021361 Bacteria 1493
151 Ga0209435_100015 3300025206 Bacteria 321177
152 Ga0209435_100162 3300025206 Bacteria 21364
153 Ga0209436_100030 3300025208 Bacteria 83718
154 Ga0209436_105529 3300025208 Bacteria 2894
155 Ga0209784_100009 3300025224 Bacteria 688031
156 Ga0209566_100007 3300025225 Bacteria 688031
157 Ga0209674_100018 3300025226 Bacteria 688031
158 Ga0209147_100004 3300025229 Bacteria 1371850
159 Ga0209563_100020 3300025230 Bacteria 688031
160 Ga0209437_100045 3300025233 Bacteria 429809
161 Ga0209258_100226 3300025242 Bacteria 106588
162 Ga0207425_1000001 3300025245 Bacteria 2525432
163 Ga0207425_1000048 3300025245 Bacteria 188748
164 Ga0207425_1001395 3300025245 Bacteria 10198
165 Ga0207425_1008583 3300025245 Bacteria 2603
166 Ga0209646_1000020 3300025246 Bacteria 462204
167 Ga0209646_1000040 3300025246 Bacteria 347867
168 Ga0209646_1000252 3300025246 Bacteria 53546
169 Ga0209026_1000034 3300025250 Bacteria 306953
170 Ga0209026_1004555 3300025250 Bacteria 4075
171 Ga0209026_1011731 3300025250 Bacteria 1559
172 Ga0209677_100010 3300025253 Bacteria 688031
173 Ga0209759_1000049 3300025256 Bacteria 221692
174 Ga0209759_1000809 3300025256 Bacteria 25105
175 Ga0209129_1000003 3300025258 Bacteria 903689
176 Ga0209129_1005240 3300025258 Bacteria 4689
177 Ga0209565_1000003 3300025263 Bacteria 1099648
178 Ga0209565_1003876 3300025263 Bacteria 4705
179 Ga0209565_1005148 3300025263 Bacteria 3846
180 Ga0209455_1000026 3300025272 Bacteria 653778
181 Ga0209455_1002265 3300025272 Bacteria 7569
182 Ga0209673_1000003 3300025273 Bacteria 980859
183 Ga0209130_1000194 3300025284 Bacteria 83960
184 Ga0209130_1003496 3300025284 Bacteria 6603
185 Ga0209130_1011501 3300025284 Bacteria 2366
186 Ga0209675_1000003 3300025291 Bacteria 1003982
187 Ga0209675_1008241 3300025291 Bacteria 3862
188 Ga0209675_1010068 3300025291 Bacteria 3266
189 Ga0209025_1009622 3300025294 Bacteria 6699
190 Ga0209564_1000002 3300025295 Bacteria 1636803
191 Ga0209564_1000007 3300025295 Bacteria 1028582
192 Ga0209564_1000012 3300025295 Bacteria 792078
193 Ga0209564_1000199 3300025295 Bacteria 138027
194 Ga0209564_1011504 3300025295 Bacteria 3958
195 Ga0209564_1014810 3300025295 Bacteria 3215
196 Ga0209758_1000041 3300025297 Bacteria 410328
197 Ga0209758_1000679 3300025297 Bacteria 50729
198 Ga0209050_1000089 3300025298 Bacteria 256212
199 Ga0209050_1006473 3300025298 Bacteria 6920
200 Ga0209050_1032512 3300025298 Bacteria 1603
201 Ga0209256_1000112 3300025299 Bacteria 178432
202 Ga0209256_1000163 3300025299 Bacteria 136008
203 Ga0209256_1000334 3300025299 Bacteria 78875
204 Ga0209256_1008572 3300025299 Bacteria 4705
205 Ga0207426_1019542 3300025302 Bacteria 2366
206 Ga0209051_1035726 3300025303 Bacteria 1844
207 Ga0209257_1000003 3300025304 Bacteria 1702593
208 Ga0207697_10025189 3300025315 Bacteria 2432
209 Ga0207655_1009232 3300025728 Bacteria 6152
210 Ga0207655_1019524 3300025728 Bacteria 3536
211 Ga0207682_10000941 3300025893 Bacteria 13487
212 Ga0207680_10016018 3300025903 Bacteria 3927
213 Ga0207647_10011731 3300025904 Bacteria 6130
214 Ga0207645_10000645 3300025907 Bacteria 28969
215 Ga0207643_10006063 3300025908 Bacteria 6460
216 Ga0207705_10000968 3300025909 Bacteria 23502
217 Ga0207707_10001282 3300025912 Bacteria 23438
218 Ga0207707_10002882 3300025912 Bacteria 15354
219 Ga0207695_10001039 3300025913 Bacteria 48767
220 Ga0207695_10004188 3300025913 Bacteria 19822
221 Ga0207695_10006509 3300025913 Bacteria 15128
222 Ga0207695_10040809 3300025913 Bacteria 4971
223 Ga0207693_10072058 3300025915 Bacteria 2705
224 Ga0207660_10001117 3300025917 Bacteria 17933
225 Ga0207660_10009834 3300025917 Bacteria 6192
226 Ga0207662_10421753 3300025918 Bacteria 908
227 Ga0207657_10008022 3300025919 Bacteria 10767
228 Ga0207649_10005238 3300025920 Bacteria 7006
229 Ga0207652_10001658 3300025921 Bacteria 19533
230 Ga0207652_10004611 3300025921 Bacteria 11168
231 Ga0207694_10001111 3300025924 Bacteria 23273
232 Ga0207650_10042756 3300025925 Bacteria 3324
233 Ga0207650_10173087 3300025925 Bacteria 1717
234 Ga0207659_10023547 3300025926 Bacteria 4111
235 Ga0207644_10011870 3300025931 Bacteria 5773
236 Ga0207690_10007706 3300025932 Bacteria 6390
237 Ga0207670_10381074 3300025936 Bacteria 1123
238 Ga0207669_10000959 3300025937 Bacteria 12219
239 Ga0207691_10000226 3300025940 Bacteria 54997
240 Ga0207711_10172967 3300025941 Bacteria 1961
241 Ga0207689_10068442 3300025942 Bacteria 2918
242 Ga0207661_10010699 3300025944 Bacteria 6611
243 Ga0207667_10000191 3300025949 Bacteria 89641
244 Ga0207667_10001277 3300025949 Bacteria 31581
245 Ga0207667_10174926 3300025949 Bacteria 2206
246 Ga0207651_10003124 3300025960 Bacteria 8061
247 Ga0207668_10047536 3300025972 Bacteria 2938
248 Ga0207640_10005025 3300025981 Bacteria 7194
249 Ga0207703_10287725 3300026035 Bacteria 1495
250 Ga0207639_10008090 3300026041 Bacteria 7190
251 Ga0207678_10018407 3300026067 Bacteria 6133
252 Ga0207702_10000474 3300026078 Bacteria 45055
253 Ga0207641_10006327 3300026088 Bacteria 10007
254 Ga0207641_10491517 3300026088 Bacteria 1191
255 Ga0207648_10012020 3300026089 Bacteria 8122
256 Ga0207674_10031021 3300026116 Bacteria 5617
257 Ga0207674_10053930 3300026116 Bacteria 4095
258 Ga0207683_10000022 3300026121 Bacteria 116671
259 Ga0207698_10000276 3300026142 Bacteria 31255
260 Ga0207698_10009589 3300026142 Bacteria 6182
261 Ga0209281_1004582 3300027111 Bacteria 4101
262 Ga0268266_10005048 3300028379 Bacteria 12458
263 Ga0268264_10043371 3300028381 Bacteria 3727
264 Ga0265338_10048239 3300028800 Bacteria 3877
265 Ga0316177_1204095 3300030731 Bacteria 2821
266 Ga0316180_1144385 3300030736 Bacteria 4147
267 Ga0316182_1094945 3300030745 Bacteria 1139
268 Ga0265331_10017318 3300031250 Bacteria 3763
269 Ga0307408_100000123 3300031548 Bacteria 85710
270 Ga0307408_100000405 3300031548 Bacteria 38760
271 Ga0307408_100002117 3300031548 Bacteria 14261
272 Ga0307408_100159019 3300031548 Bacteria 1792
273 Ga0307408_100185853 3300031548 Bacteria 1670
274 Ga0307408_100305928 3300031548 Bacteria 1333
275 Ga0307406_10005922 3300031901 Bacteria 6707
276 Ga0307414_10028934 3300032004 Bacteria 3600
277 Ga0395899_0125026 3300037312 Bacteria 1839
278 Ga0395899_0258722 3300037312 Bacteria 1191
279 Ga0395899_0455075 3300037312 Bacteria 837
280 Ga0395900_0022865 3300037418 Bacteria 6397
281 Ga0395900_0153100 3300037418 Bacteria 2355
282 Ga0395900_0218651 3300037418 Bacteria 1921
283 Ga0395898_0009320 3300037466 Bacteria 10318
284 Ga0395905_0091347 3300037471 Bacteria 2854
285 Ga0395901_0000852 3300038443 Bacteria 33536
286 Ga0395901_0070309 3300038443 Bacteria 3646
287 Ga0436361_0061503 3300039447 Bacteria 127805
288 Ga0436361_0066267 3300039447 Bacteria 1324
289 Ga0436361_0208984 3300039447 Bacteria 5394
290 Ga0436361_0249401 3300039447 Bacteria 41096
291 Ga0436361_0355761 3300039447 Bacteria 5104
292 Ga0436361_0582882 3300039447 Bacteria 967
293 Ga0436361_1127900 3300039447 Bacteria 4656
294 Ga0436361_1137694 3300039447 Bacteria 1155
295 Ga0450891_001876 3300042129 Unclassified 2155
296 Ga0466969_0074686 3300044656 Bacteria 1626
297 Ga0466972_0000201 3300044658 Bacteria 43791
298 Ga0466972_0012055 3300044658 Bacteria 4344
299 Ga0466972_0100758 3300044658 Bacteria 1367
300 Ga0466965_0001752 3300044683 Bacteria 8962
301 Ga0466965_0143202 3300044683 Bacteria 1246
302 Ga0466966_0011912 3300044684 Bacteria 5764
303 Ga0466964_0008546 3300044706 Bacteria 3848
304 Ga0466964_0030771 3300044706 Bacteria 2125
305 Ga0466968_0020841 3300044735 Bacteria 2650
306 Ga0466968_0035277 3300044735 Bacteria 2092
307 Ga0466968_0135202 3300044735 Bacteria 1124
308 Ga0466970_0076094 3300044765 Bacteria 1808
309 Ga0466957_0083551 3300044842 Bacteria 1992
310 Ga0495617_000013 3300046452 Bacteria 290031
311 Ga0495617_003301 3300046452 Bacteria 6111
312 Ga0495617_005003 3300046452 Bacteria 4761
313 Ga0495617_018999 3300046452 Bacteria 2324
314 Ga0495617_055804 3300046452 Bacteria 1310
315 Ga0495627_000001 3300046453 Bacteria 1104709
316 Ga0495590_0000016 3300046457 Bacteria 225874
317 Ga0495590_0022671 3300046457 Bacteria 2220
318 Ga0495638_0000057 3300046460 Bacteria 193690
319 Ga0495638_0004128 3300046460 Bacteria 11108
320 Ga0495638_0056530 3300046460 Bacteria 2435
321 Ga0495653_0000025 3300046463 Bacteria 160471
322 Ga0495650_0000129 3300046471 Bacteria 177255
323 Ga0495650_0000226 3300046471 Bacteria 115930
324 Ga0495650_0000246 3300046471 Bacteria 107109
325 Ga0495650_0000289 3300046471 Bacteria 93255
326 Ga0495650_0000348 3300046471 Bacteria 82107
327 Ga0495650_0044851 3300046471 Bacteria 1865
328 Ga0495605_0000139 3300046474 Bacteria 93710
329 Ga0495605_0001875 3300046474 Bacteria 13444
330 Ga0495605_0042384 3300046474 Bacteria 2263
331 Ga0495639_0017786 3300046475 Bacteria 3089
332 Ga0495584_0000249 3300046491 Bacteria 38940
333 Ga0495584_0090556 3300046491 Bacteria 1542
334 Ga0495585_0019035 3300046492 Bacteria 3962
335 Ga0495585_0030455 3300046492 Bacteria 3068
336 Ga0495585_0058745 3300046492 Bacteria 2121
337 Ga0495585_0092983 3300046492 Bacteria 1622
338 Ga0495585_0140606 3300046492 Bacteria 1264
339 Ga0495596_0006652 3300046500 Bacteria 5293
340 Ga0495607_0014033 3300046501 Bacteria 5230
341 Ga0495607_0020177 3300046501 Bacteria 4218
342 Ga0495607_0026933 3300046501 Bacteria 3561
343 Ga0495607_0036570 3300046501 Bacteria 2956
344 Ga0495607_0047634 3300046501 Bacteria 2510
345 Ga0495607_0172959 3300046501 Bacteria 1089
346 Ga0495583_0000009 3300046506 Bacteria 372527
347 Ga0495583_0000396 3300046506 Bacteria 66329
348 Ga0495583_0000688 3300046506 Bacteria 43737
349 Ga0495606_0000087 3300046507 Bacteria 156407
350 Ga0495606_0000137 3300046507 Bacteria 124670
351 Ga0495606_0000197 3300046507 Bacteria 105038
352 Ga0495606_0000573 3300046507 Bacteria 58366
353 Ga0495606_0001754 3300046507 Bacteria 27852
354 Ga0495606_0001765 3300046507 Bacteria 27716
355 Ga0495606_0007194 3300046507 Bacteria 10039
356 Ga0495606_0007396 3300046507 Bacteria 9849
357 Ga0495606_0021465 3300046507 Bacteria 4729
358 Ga0495606_0039610 3300046507 Bacteria 3173
359 Ga0495606_0088226 3300046507 Bacteria 1913
360 Ga0495606_0171458 3300046507 Bacteria 1258
361 Ga0495610_0000008 3300046512 Bacteria 622732
362 Ga0495610_0003847 3300046512 Bacteria 11408
363 Ga0495610_0004964 3300046512 Bacteria 9635
364 Ga0495610_0005455 3300046512 Bacteria 9030
365 Ga0495610_0052378 3300046512 Bacteria 1981
366 Ga0495610_0088120 3300046512 Bacteria 1411
367 Ga0495616_0000761 3300046513 Bacteria 23546
368 Ga0495616_0018907 3300046513 Bacteria 3767
369 Ga0495637_0000404 3300046520 Bacteria 31974
370 Ga0495637_0023363 3300046520 Bacteria 2812
371 Ga0495637_0096718 3300046520 Bacteria 1158
372 Ga0495643_0000236 3300046522 Bacteria 83225
373 Ga0495643_0000289 3300046522 Bacteria 71822
374 Ga0495643_0177305 3300046522 Bacteria 1038
375 Ga0495644_0000527 3300046523 Bacteria 16268
376 Ga0495644_0006564 3300046523 Bacteria 4504
377 Ga0495648_0000002 3300046524 Bacteria 593972
378 Ga0495648_0002256 3300046524 Bacteria 18028
379 Ga0495648_0005244 3300046524 Bacteria 10831
380 Ga0495648_0011919 3300046524 Bacteria 6521
381 Ga0495648_0050843 3300046524 Bacteria 2529
382 Ga0495648_0096262 3300046524 Bacteria 1645
383 Ga0495642_0003770 3300046528 Bacteria 5935
384 Ga0495642_0008063 3300046528 Bacteria 4029
385 Ga0495642_0084904 3300046528 Bacteria 1336
386 Ga0495654_0000002 3300046530 Bacteria 1021205
387 Ga0495654_0031792 3300046530 Bacteria 2678
388 Ga0495654_0063659 3300046530 Bacteria 1765
389 Ga0495598_0043435 3300046537 Bacteria 1324
390 Ga0495609_0000541 3300046538 Bacteria 29926
391 Ga0495609_0009695 3300046538 Bacteria 4646
392 Ga0495609_0010811 3300046538 Bacteria 4364
393 Ga0495609_0013838 3300046538 Bacteria 3803
394 Ga0495609_0025559 3300046538 Bacteria 2707
395 Ga0495609_0041227 3300046538 Bacteria 2075
396 Ga0495609_0052280 3300046538 Bacteria 1818
397 Ga0495621_0003018 3300046539 Bacteria 4592
398 Ga0495621_0098186 3300046539 Bacteria 1111
399 Ga0495597_0000025 3300046542 Bacteria 142649
400 Ga0495597_0000848 3300046542 Bacteria 24046
401 Ga0495597_0041028 3300046542 Bacteria 2068
402 Ga0495597_0094603 3300046542 Bacteria 1265
403 Ga0495622_0000023 3300046557 Bacteria 155188
404 Ga0495622_0000816 3300046557 Bacteria 17235
405 Ga0495622_0046998 3300046557 Bacteria 2006
406 Ga0495633_0000073 3300046558 Bacteria 130286
407 Ga0495633_0000399 3300046558 Bacteria 45392
408 Ga0495633_0007655 3300046558 Bacteria 6184
409 Ga0495633_0008319 3300046558 Bacteria 5859
410 Ga0495633_0011430 3300046558 Bacteria 4788
411 Ga0495633_0023761 3300046558 Bacteria 3034
412 Ga0495633_0026360 3300046558 Bacteria 2853
413 Ga0495633_0033544 3300046558 Bacteria 2475
414 Ga0495656_0040260 3300046615 Bacteria 1946
415 Ga0495656_0073187 3300046615 Bacteria 1527
416 Ga0495668_0000083 3300046616 Bacteria 153471
417 Ga0495668_0000132 3300046616 Bacteria 112674
418 Ga0495668_0001954 3300046616 Bacteria 18283
419 Ga0495668_0002007 3300046616 Bacteria 17796
420 Ga0495611_0030469 3300046648 Bacteria 2372
421 Ga0495611_0046148 3300046648 Bacteria 1952
422 Ga0495611_0072547 3300046648 Bacteria 1575
423 Ga0495625_0000177 3300046660 Bacteria 98918
424 Ga0495625_0000482 3300046660 Bacteria 59590
425 Ga0495625_0002519 3300046660 Bacteria 19715
426 Ga0495625_0083052 3300046660 Bacteria 2227
427 Ga0495625_0088411 3300046660 Bacteria 2146
428 Ga0495625_0093541 3300046660 Bacteria 2075
429 Ga0495625_0162209 3300046660 Bacteria 1497
430 Ga0495625_0174033 3300046660 Bacteria 1435
431 Ga0495625_0290901 3300046660 Bacteria 1048
432 Ga0495659_0000154 3300046664 Bacteria 30383
433 Ga0495659_0000394 3300046664 Bacteria 16709
434 Ga0495661_0121846 3300046665 Bacteria 1439
435 Ga0495623_0069440 3300046679 Bacteria 2196
436 Ga0495670_0000099 3300046691 Bacteria 37893
437 Ga0495670_0011768 3300046691 Bacteria 4306
438 Ga0495670_0034938 3300046691 Bacteria 2504
439 Ga0495670_0214037 3300046691 Bacteria 1023
440 Ga0495671_0000002 3300046692 Bacteria 1136189
441 Ga0495671_0000282 3300046692 Bacteria 42563
442 Ga0495671_0050074 3300046692 Bacteria 2081
443 Ga0495671_0051125 3300046692 Bacteria 2056
444 Ga0495671_0052657 3300046692 Bacteria 2022
445 Ga0495649_0011278 3300046694 Bacteria 5248
446 Ga0495649_0203111 3300046694 Bacteria 1028
447 Ga0495660_0000473 3300046810 Bacteria 33431
448 Ga0495660_0001536 3300046810 Bacteria 15558
449 Ga0495660_0002502 3300046810 Bacteria 11723
450 Ga0495660_0042988 3300046810 Bacteria 2494
451 Ga0495660_0067640 3300046810 Bacteria 1902
452 Ga0495660_0092871 3300046810 Bacteria 1565
453 Ga0495636_0004129 3300047318 Bacteria 5689
454 Ga0495672_0000063 3300047320 Bacteria 201893
455 Ga0495672_0000291 3300047320 Bacteria 69062
456 Ga0495672_0001774 3300047320 Bacteria 20729
457 Ga0495672_0022462 3300047320 Bacteria 4099
458 Ga0495672_0029323 3300047320 Bacteria 3467
459 Ga0495672_0032420 3300047320 Bacteria 3250
460 Ga0495683_0002242 3300047323 Bacteria 11820
461 Ga0495683_0041964 3300047323 Bacteria 2307
462 Ga0495687_000587 3300047443 Bacteria 42438
463 Ga0495687_009668 3300047443 Bacteria 5366
464 Ga0495687_039151 3300047443 Bacteria 2099
465 Ga0495677_0013618 3300047445 Bacteria 2960
466 Ga0495677_0018818 3300047445 Bacteria 2504
467 Ga0495677_0031843 3300047445 Bacteria 1919
468 Ga0495677_0043624 3300047445 Bacteria 1644
469 Ga0495679_052687 3300047446 Bacteria 1216
470 Ga0495673_0000005 3300047469 Bacteria 943364
471 Ga0495673_0000015 3300047469 Bacteria 598766
472 Ga0495673_0000044 3300047469 Bacteria 283033
473 Ga0495673_0014024 3300047469 Bacteria 4183
474 Ga0495673_0044141 3300047469 Bacteria 1990
475 Ga0495686_0000488 3300047472 Bacteria 58473
476 Ga0495686_0094774 3300047472 Bacteria 1808
477 Ga0495686_0215834 3300047472 Bacteria 1093
478 Ga0495614_0047091 3300048089 Bacteria 1849
479 Ga0495626_0073030 3300048091 Bacteria 1537
480 Ga0496101_0046587 3300048904 Bacteria 3110
481 Ga0496103_0005164 3300048906 Bacteria 7856
482 Ga0496103_0141188 3300048906 Bacteria 1540
483 Ga0496105_0105836 3300048908 Bacteria 2322
484 Ga0496108_0009055 3300048911 Bacteria 8064
485 Ga0496109_0025459 3300048912 Bacteria 5274
486 Ga0496110_0093715 3300048913 Bacteria 2688
487 Ga0496111_0120771 3300048914 Bacteria 1935
488 Ga0496111_0148680 3300048914 Bacteria 1737
489 Ga0496116_0039707 3300048919 Bacteria 3249
490 Ga0496116_0044254 3300048919 Bacteria 3026
491 Ga0496116_0049011 3300048919 Bacteria 2829
492 Ga0496116_0126328 3300048919 Bacteria 1468
493 Ga0496117_0000001 3300048920 Bacteria 2526244
494 Ga0496118_0000002 3300048921 Bacteria 1690764
495 Ga0496118_0114516 3300048921 Bacteria 1777
496 Ga0496118_0284831 3300048921 Bacteria 917
497 Ga0496120_0051377 3300048923 Bacteria 2355
498 Ga0496121_0015651 3300048924 Bacteria 7913
499 Ga0496121_0017195 3300048924 Bacteria 7405
500 Ga0496121_0042446 3300048924 Bacteria 3956
501 Ga0496121_0094298 3300048924 Bacteria 2329
502 Ga0496121_0159233 3300048924 Bacteria 1653
503 Ga0496121_0164068 3300048924 Bacteria 1621
504 Ga0496121_0364605 3300048924 Bacteria 958
505 Ga0496122_0001290 3300048925 Bacteria 41594
506 Ga0496122_0198352 3300048925 Bacteria 1176
507 Ga0496123_0001053 3300048926 Bacteria 41720
508 Ga0496123_0011598 3300048926 Bacteria 7619
509 Ga0496123_0077795 3300048926 Bacteria 2035
510 Ga0496124_0093882 3300048927 Bacteria 2441
511 Ga0496124_0114180 3300048927 Bacteria 2169
512 Ga0496124_0165936 3300048927 Bacteria 1716
513 Ga0496124_0234525 3300048927 Bacteria 1369
514 Ga0496124_0515965 3300048927 Bacteria 797
515 Ga0496125_0070939 3300048928 Bacteria 2724
516 Ga0496125_0164246 3300048928 Bacteria 1503
517 Ga0496125_0183358 3300048928 Bacteria 1391
518 Ga0496126_0002465 3300048929 Bacteria 24936
519 Ga0495678_000002 3300049459 Bacteria 999613
520 Ga0495678_000069 3300049459 Bacteria 131739
521 Ga0495678_002088 3300049459 Bacteria 14198
522 Ga0495682_0000522 3300049460 Bacteria 26585
523 Ga0495682_0001454 3300049460 Bacteria 12754
524 Ga0501031_0189841 3300049568 Bacteria 1342
525 Ga0501047_0031158 3300049581 Bacteria 5143
526 Ga0501047_0488797 3300049581 Bacteria 1058
527 Ga0501069_0037735 3300049585 Bacteria 2666
528 Ga0501070_0003058 3300049586 Bacteria 14565
529 Ga0501070_0018741 3300049586 Bacteria 5806
530 Ga0501070_0129833 3300049586 Bacteria 2082
531 Ga0501074_0001678 3300049590 Bacteria 15070
532 Ga0501222_001905 3300049662 Bacteria 2891
533 Ga0501227_016453 3300049665 Bacteria 1662
534 Ga0501080_0173204 3300049742 Bacteria 1989
535 Ga0501269_000028 3300049766 Bacteria 47862
536 Ga0501279_001113 3300049775 Bacteria 3535
537 Ga0501035_0006572 3300049822 Bacteria 10894
538 Ga0501035_0047104 3300049822 Bacteria 3872
539 Ga0501044_0016102 3300049823 Bacteria 8038
540 nmdc:mga05p37_394950_c1 3300050507 Bacteria 1616
541 nmdc:mga0n895_399776_c1 3300050512 Bacteria 1389
542 Ga0500557_082127 3300053105 Bacteria 1065
543 Ga0500594_0036043 3300053118 Bacteria 1329
544 Ga0500618_000044 3300053125 Bacteria 110159
545 Ga0500618_001190 3300053125 Bacteria 12512
546 Ga0500637_0032236 3300053178 Bacteria 2921
547 2511250094 2511231003 Bacteria 5606035
548 2521559374 2521172590 Bacteria 5047645
549 2550693618 2548876994 Bacteria 4904866
550 2553007294 2551306416 Bacteria 6152985
551 2601668171 2600255292 Bacteria 6300551
552 2643792368 2643221554 Bacteria 6603920
553 2644027564 2643221603 Bacteria 6147767
554 2644212142 2643221638 Bacteria 6579467
555 2644251004 2643221645 Bacteria 7207331
556 2644354814 2643221664 Bacteria 7272945
557 2738715374 2738541276 Bacteria 4690596
558 2738739754 2738541280 Bacteria 6630198
559 2738828139 2738541297 Bacteria 6549566
560 2738842245 2738541300 Bacteria 6675882
561 2739151935 2738541357 Bacteria 6549408
562 2739194044 2738543003 Bacteria 6549560
563 2739273946 2738543018 Bacteria 6718814
564 2739320331 2738543026 Bacteria 6549408
565 2739338761 2738543029 Bacteria 6549249
566 2739342990 2738543030 Bacteria 6719714
567 2765570624 2765235838 Bacteria 5445269
568 2808983437 2808606386 Bacteria 4471946
569 2809128664 2808606415 Bacteria 4576710
570 2809148285 2808606419 Bacteria 4576925
571 2819592073 2818991445 Bacteria 4955017
572 2819615904 2818991449 Bacteria 5518009
573 2821132590 2821131069 Bacteria 6108407
574 2839098170 2839094727 Bacteria 5534556
575 2842716557 2842711865 Bacteria 7155354
576 2852620293 2852618963 Bacteria 4577824
577 2857550405 2857547612 Bacteria 6179999
578 2857557281 2857553236 Bacteria 6166726
579 2857560154 2857558681 Bacteria 6617694
580 2857566662 2857564685 Bacteria 6290584
581 2884816934 2884811622 Bacteria 5552861
582 2884840509 2884836552 Bacteria 5219991
583 2884855766 2884852848 Bacteria 5221161
584 2885085279 2885080285 Bacteria 6355622
585 2896157309 2896154374 Bacteria 5221518
586 2904424405 2904424332 Bacteria 7633521
587 2904443788 2904439833 Bacteria 5931679
588 2904532687 2904530477 Bacteria 5876334
589 2904585181 2904584206 Bacteria 6028872
590 2904593530 2904589729 Bacteria 6113573
591 2904605713 2904601388 Bacteria 5884906
592 2919048016 2919046199 Bacteria 5567169
593 2919081506 2919079590 Bacteria 5946433
594 2919477908 2919476304 Bacteria 5888696
595 2923513042 2923510766 Bacteria 5926163
596 2928133878 2928130867 Bacteria 5467269
597 2932411879 2932410948 Bacteria 6312192
598 2932418554 2932416698 Bacteria 6315112
599 Ga0182008_10000119
600 JGI24736J21556_1000622
601 JGI24741J21665_1001939
602 JGI24740J21852_10002530
603 JGI25155J39150_1000132
604 JGI25155J39150_1000204
605 JGI25156J39149_1000154
606 JGI25154J39366_1000401
607 JGI25154J39366_1000462
608 JGI25154J39366_1000584
609 JGI25158J39367_1001697
610 JGI25157J39369_1000169
611 JGI25152J39213_1000071
612 JGI25152J39213_1008174
613 JGI25150J39212_1001132
614 JGI25150J39212_1004210
615 JGI25150J39212_1023915
616 JGI25159J45721_1001513
617 rootH1_10030757
618 rootL2_10035620
619 rootL2_10035621
620 JGI25161J50226_1002030
621 Ga0055538_1000070
622 Ga0055539_1000105
623 Ga0055533_1000113
624 Ga0055532_1000017
625 Ga0055525_1000153
626 Ga0055529_1000836
627 Ga0055526_1000023
628 Ga0055526_1000093
629 Ga0055526_1014758
630 Ga0055526_1015012
631 Ga0055537_1000129
632 Ga0055537_1014279
633 Ga0055524_1001524
634 Ga0055524_1002022
635 Ga0055524_1006163
636 Ga0055524_1012128
637 Ga0055534_1000594
638 Ga0055534_1000965
639 Ga0055534_1006448
640 Ga0055528_1000013
641 Ga0055530_10008006
642 Ga0055531_10007685
643 Ga0055541_1000071
644 Ga0055543_1000257
645 Ga0065165_1000296
646 Ga0070658_10015291
647 Ga0070676_10002125
648 Ga0070683_100013472
649 Ga0070670_100034164
650 Ga0070670_100146878
651 Ga0070677_10000503
652 Ga0070680_100014045
653 Ga0070680_100014372
654 Ga0070682_100006613
655 Ga0070682_100037177
656 Ga0068868_100082159
657 Ga0070660_100008001
658 Ga0070691_10003585
659 Ga0070661_100007333
660 Ga0070692_10001511
661 Ga0070668_100004906
662 Ga0070675_100003996
663 Ga0070671_100001515
664 Ga0070674_100000820
665 Ga0070673_100000942
666 Ga0070659_100016131
667 Ga0070667_100004180
668 Ga0070701_10211897
669 Ga0070663_100007817
670 Ga0070663_100403543
671 Ga0070662_100322386
672 Ga0070681_10007131
673 Ga0070681_10054098
674 Ga0068867_100006618
675 Ga0070685_10035025
676 Ga0070679_100005054
677 Ga0070679_100020024
678 Ga0070684_100007023
679 Ga0068853_100003222
680 Ga0068853_100007747
681 Ga0068853_100022204
682 Ga0070672_100002351
683 Ga0070665_100007171
684 Ga0068855_100000645
685 Ga0068855_100039144
686 Ga0068857_100010439
687 Ga0068857_100120115
688 Ga0068857_100569558
689 Ga0068854_100007809
690 Ga0068854_100018764
691 Ga0068856_100034723
692 Ga0068852_100008844
693 Ga0068852_100009587
694 Ga0068864_100009648
695 Ga0068861_100508504
696 Ga0068851_10000337
697 Ga0068870_10002201
698 Ga0068863_100159200
699 Ga0068858_100188609
700 Ga0068860_100016807
701 Ga0081455_10109804
702 Ga0070717_10343075
703 Ga0070712_100010843
704 Ga0075366_10021765
705 Ga0097621_100142077
706 Ga0068871_100019557
707 Ga0068865_100046168
708 Ga0079104_1011794
709 Ga0105251_10012847
710 Ga0105244_10004545
711 Ga0105244_10004656
712 Ga0105240_10008095
713 Ga0105240_10028762
714 Ga0105240_10031188
715 Ga0105240_10143049
716 Ga0105242_10271703
717 Ga0105238_10000213
718 Ga0105239_10010698
719 Ga0105239_10745024
720 Ga0157373_10012705
721 Ga0157373_10022750
722 Ga0157371_10012336
723 Ga0157370_10035175
724 Ga0157369_10017641
725 Ga0163162_10092537
726 Ga0157372_10015387
727 Ga0157375_10014562
728 Ga0157375_10015014
729 Ga0157376_10059642
730 Ga0182006_1000008
731 Ga0182006_1000067
732 Ga0182006_1005802
733 Ga0182007_10001506
734 Ga0182007_10011770
735 Ga0182005_1000002
736 Ga0182005_1000008
737 Ga0163161_10093305
738 Ga0163161_10100826
739 Ga0197907_10920354
740 Ga0206356_11707524
741 Ga0206354_10831098
742 Ga0206353_10297193
743 Ga0154015_1003343
744 Ga0213872_10000148
745 Ga0213872_10000952
746 Ga0213872_10010316
747 Ga0213872_10012846
748 Ga0213872_10077561
749 Ga0209435_100015
750 Ga0209435_100162
751 Ga0209436_100030
752 Ga0209436_105529
753 Ga0209784_100009
754 Ga0209566_100007
755 Ga0209674_100018
756 Ga0209147_100004
757 Ga0209563_100020
758 Ga0209437_100045
759 Ga0209258_100226
760 Ga0207425_1000001
761 Ga0207425_1000048
762 Ga0207425_1001395
763 Ga0207425_1008583
764 Ga0209646_1000020
765 Ga0209646_1000040
766 Ga0209646_1000252
767 Ga0209026_1000034
768 Ga0209026_1004555
769 Ga0209026_1011731
770 Ga0209677_100010
771 Ga0209759_1000049
772 Ga0209759_1000809
773 Ga0209129_1000003
774 Ga0209129_1005240
775 Ga0209565_1000003
776 Ga0209565_1003876
777 Ga0209565_1005148
778 Ga0209455_1000026
779 Ga0209455_1002265
780 Ga0209673_1000003
781 Ga0209130_1000194
782 Ga0209130_1003496
783 Ga0209130_1011501
784 Ga0209675_1000003
785 Ga0209675_1008241
786 Ga0209675_1010068
787 Ga0209025_1009622
788 Ga0209564_1000002
789 Ga0209564_1000007
790 Ga0209564_1000012
791 Ga0209564_1000199
792 Ga0209564_1011504
793 Ga0209564_1014810
794 Ga0209758_1000041
795 Ga0209758_1000679
796 Ga0209050_1000089
797 Ga0209050_1006473
798 Ga0209050_1032512
799 Ga0209256_1000112
800 Ga0209256_1000163
801 Ga0209256_1000334
802 Ga0209256_1008572
803 Ga0207426_1019542
804 Ga0209051_1035726
805 Ga0209257_1000003
806 Ga0207697_10025189
807 Ga0207655_1009232
808 Ga0207655_1019524
809 Ga0207682_10000941
810 Ga0207680_10016018
811 Ga0207647_10011731
812 Ga0207645_10000645
813 Ga0207643_10006063
814 Ga0207705_10000968
815 Ga0207707_10001282
816 Ga0207707_10002882
817 Ga0207695_10001039
818 Ga0207695_10004188
819 Ga0207695_10006509
820 Ga0207695_10040809
821 Ga0207693_10072058
822 Ga0207660_10001117
823 Ga0207660_10009834
824 Ga0207662_10421753
825 Ga0207657_10008022
826 Ga0207649_10005238
827 Ga0207652_10001658
828 Ga0207652_10004611
829 Ga0207694_10001111
830 Ga0207650_10042756
831 Ga0207650_10173087
832 Ga0207659_10023547
833 Ga0207644_10011870
834 Ga0207690_10007706
835 Ga0207670_10381074
836 Ga0207669_10000959
837 Ga0207691_10000226
838 Ga0207711_10172967
839 Ga0207689_10068442
840 Ga0207661_10010699
841 Ga0207667_10000191
842 Ga0207667_10001277
843 Ga0207667_10174926
844 Ga0207651_10003124
845 Ga0207668_10047536
846 Ga0207640_10005025
847 Ga0207703_10287725
848 Ga0207639_10008090
849 Ga0207678_10018407
850 Ga0207702_10000474
851 Ga0207641_10006327
852 Ga0207641_10491517
853 Ga0207648_10012020
854 Ga0207674_10031021
855 Ga0207674_10053930
856 Ga0207683_10000022
857 Ga0207698_10000276
858 Ga0207698_10009589
859 Ga0209281_1004582
860 Ga0268266_10005048
861 Ga0268264_10043371
862 Ga0265338_10048239
863 Ga0316177_1204095
864 Ga0316180_1144385
865 Ga0316182_1094945
866 Ga0265331_10017318
867 Ga0307408_100000123
868 Ga0307408_100000405
869 Ga0307408_100002117
870 Ga0307408_100159019
871 Ga0307408_100185853
872 Ga0307408_100305928
873 Ga0307406_10005922
874 Ga0307414_10028934
875 Ga0395899_0125026
876 Ga0395899_0258722
877 Ga0395899_0455075
878 Ga0395900_0022865
879 Ga0395900_0153100
880 Ga0395900_0218651
881 Ga0395898_0009320
882 Ga0395905_0091347
883 Ga0395901_0000852
884 Ga0395901_0070309
885 Ga0436361_0061503
886 Ga0436361_0066267
887 Ga0436361_0208984
888 Ga0436361_0249401
889 Ga0436361_0355761
890 Ga0436361_0582882
891 Ga0436361_1127900
892 Ga0436361_1137694
893 Ga0450891_001876
894 Ga0466969_0074686
895 Ga0466972_0000201
896 Ga0466972_0012055
897 Ga0466972_0100758
898 Ga0466965_0001752
899 Ga0466965_0143202
900 Ga0466966_0011912
901 Ga0466964_0008546
902 Ga0466964_0030771
903 Ga0466968_0020841
904 Ga0466968_0035277
905 Ga0466968_0135202
906 Ga0466970_0076094
907 Ga0466957_0083551
908 Ga0495617_000013
909 Ga0495617_003301
910 Ga0495617_005003
911 Ga0495617_018999
912 Ga0495617_055804
913 Ga0495627_000001
914 Ga0495590_0000016
915 Ga0495590_0022671
916 Ga0495638_0000057
917 Ga0495638_0004128
918 Ga0495638_0056530
919 Ga0495653_0000025
920 Ga0495650_0000129
921 Ga0495650_0000226
922 Ga0495650_0000246
923 Ga0495650_0000289
924 Ga0495650_0000348
925 Ga0495650_0044851
926 Ga0495605_0000139
927 Ga0495605_0001875
928 Ga0495605_0042384
929 Ga0495639_0017786
930 Ga0495584_0000249
931 Ga0495584_0090556
932 Ga0495585_0019035
933 Ga0495585_0030455
934 Ga0495585_0058745
935 Ga0495585_0092983
936 Ga0495585_0140606
937 Ga0495596_0006652
938 Ga0495607_0014033
939 Ga0495607_0020177
940 Ga0495607_0026933
941 Ga0495607_0036570
942 Ga0495607_0047634
943 Ga0495607_0172959
944 Ga0495583_0000009
945 Ga0495583_0000396
946 Ga0495583_0000688
947 Ga0495606_0000087
948 Ga0495606_0000137
949 Ga0495606_0000197
950 Ga0495606_0000573
951 Ga0495606_0001754
952 Ga0495606_0001765
953 Ga0495606_0007194
954 Ga0495606_0007396
955 Ga0495606_0021465
956 Ga0495606_0039610
957 Ga0495606_0088226
958 Ga0495606_0171458
959 Ga0495610_0000008
960 Ga0495610_0003847
961 Ga0495610_0004964
962 Ga0495610_0005455
963 Ga0495610_0052378
964 Ga0495610_0088120
965 Ga0495616_0000761
966 Ga0495616_0018907
967 Ga0495637_0000404
968 Ga0495637_0023363
969 Ga0495637_0096718
970 Ga0495643_0000236
971 Ga0495643_0000289
972 Ga0495643_0177305
973 Ga0495644_0000527
974 Ga0495644_0006564
975 Ga0495648_0000002
976 Ga0495648_0002256
977 Ga0495648_0005244
978 Ga0495648_0011919
979 Ga0495648_0050843
980 Ga0495648_0096262
981 Ga0495642_0003770
982 Ga0495642_0008063
983 Ga0495642_0084904
984 Ga0495654_0000002
985 Ga0495654_0031792
986 Ga0495654_0063659
987 Ga0495598_0043435
988 Ga0495609_0000541
989 Ga0495609_0009695
990 Ga0495609_0010811
991 Ga0495609_0013838
992 Ga0495609_0025559
993 Ga0495609_0041227
994 Ga0495609_0052280
995 Ga0495621_0003018
996 Ga0495621_0098186
997 Ga0495597_0000025
998 Ga0495597_0000848
999 Ga0495597_0041028
1000 Ga0495597_0094603
1001 Ga0495622_0000023
1002 Ga0495622_0000816
1003 Ga0495622_0046998
1004 Ga0495633_0000073
1005 Ga0495633_0000399
1006 Ga0495633_0007655
1007 Ga0495633_0008319
1008 Ga0495633_0011430
1009 Ga0495633_0023761
1010 Ga0495633_0026360
1011 Ga0495633_0033544
1012 Ga0495656_0040260
1013 Ga0495656_0073187
1014 Ga0495668_0000083
1015 Ga0495668_0000132
1016 Ga0495668_0001954
1017 Ga0495668_0002007
1018 Ga0495611_0030469
1019 Ga0495611_0046148
1020 Ga0495611_0072547
1021 Ga0495625_0000177
1022 Ga0495625_0000482
1023 Ga0495625_0002519
1024 Ga0495625_0083052
1025 Ga0495625_0088411
1026 Ga0495625_0093541
1027 Ga0495625_0162209
1028 Ga0495625_0174033
1029 Ga0495625_0290901
1030 Ga0495659_0000154
1031 Ga0495659_0000394
1032 Ga0495661_0121846
1033 Ga0495623_0069440
1034 Ga0495670_0000099
1035 Ga0495670_0011768
1036 Ga0495670_0034938
1037 Ga0495670_0214037
1038 Ga0495671_0000002
1039 Ga0495671_0000282
1040 Ga0495671_0050074
1041 Ga0495671_0051125
1042 Ga0495671_0052657
1043 Ga0495649_0011278
1044 Ga0495649_0203111
1045 Ga0495660_0000473
1046 Ga0495660_0001536
1047 Ga0495660_0002502
1048 Ga0495660_0042988
1049 Ga0495660_0067640
1050 Ga0495660_0092871
1051 Ga0495636_0004129
1052 Ga0495672_0000063
1053 Ga0495672_0000291
1054 Ga0495672_0001774
1055 Ga0495672_0022462
1056 Ga0495672_0029323
1057 Ga0495672_0032420
1058 Ga0495683_0002242
1059 Ga0495683_0041964
1060 Ga0495687_000587
1061 Ga0495687_009668
1062 Ga0495687_039151
1063 Ga0495677_0013618
1064 Ga0495677_0018818
1065 Ga0495677_0031843
1066 Ga0495677_0043624
1067 Ga0495679_052687
1068 Ga0495673_0000005
1069 Ga0495673_0000015
1070 Ga0495673_0000044
1071 Ga0495673_0014024
1072 Ga0495673_0044141
1073 Ga0495686_0000488
1074 Ga0495686_0094774
1075 Ga0495686_0215834
1076 Ga0495614_0047091
1077 Ga0495626_0073030
1078 Ga0496101_0046587
1079 Ga0496103_0005164
1080 Ga0496103_0141188
1081 Ga0496105_0105836
1082 Ga0496108_0009055
1083 Ga0496109_0025459
1084 Ga0496110_0093715
1085 Ga0496111_0120771
1086 Ga0496111_0148680
1087 Ga0496116_0039707
1088 Ga0496116_0044254
1089 Ga0496116_0049011
1090 Ga0496116_0126328
1091 Ga0496117_0000001
1092 Ga0496118_0000002
1093 Ga0496118_0114516
1094 Ga0496118_0284831
1095 Ga0496120_0051377
1096 Ga0496121_0015651
1097 Ga0496121_0017195
1098 Ga0496121_0042446
1099 Ga0496121_0094298
1100 Ga0496121_0159233
1101 Ga0496121_0164068
1102 Ga0496121_0364605
1103 Ga0496122_0001290
1104 Ga0496122_0198352
1105 Ga0496123_0001053
1106 Ga0496123_0011598
1107 Ga0496123_0077795
1108 Ga0496124_0093882
1109 Ga0496124_0114180
1110 Ga0496124_0165936
1111 Ga0496124_0234525
1112 Ga0496124_0515965
1113 Ga0496125_0070939
1114 Ga0496125_0164246
1115 Ga0496125_0183358
1116 Ga0496126_0002465
1117 Ga0495678_000002
1118 Ga0495678_000069
1119 Ga0495678_002088
1120 Ga0495682_0000522
1121 Ga0495682_0001454
1122 Ga0501031_0189841
1123 Ga0501047_0031158
1124 Ga0501047_0488797
1125 Ga0501069_0037735
1126 Ga0501070_0003058
1127 Ga0501070_0018741
1128 Ga0501070_0129833
1129 Ga0501074_0001678
1130 Ga0501222_001905
1131 Ga0501227_016453
1132 Ga0501080_0173204
1133 Ga0501269_000028
1134 Ga0501279_001113
1135 Ga0501035_0006572
1136 Ga0501035_0047104
1137 Ga0501044_0016102
1138 nmdc:mga05p37_394950_c1
1139 nmdc:mga0n895_399776_c1
1140 Ga0500557_082127
1141 Ga0500594_0036043
1142 Ga0500618_000044
1143 Ga0500618_001190
1144 Ga0500637_0032236
1145 2511250094
1146 2521559374
1147 2550693618
1148 2553007294
1149 2601668171
1150 2643792368
1151 2644027564
1152 2644212142
1153 2644251004
1154 2644354814
1155 2738715374
1156 2738739754
1157 2738828139
1158 2738842245
1159 2739151935
1160 2739194044
1161 2739273946
1162 2739320331
1163 2739338761
1164 2739342990
1165 2765570624
1166 2808983437
1167 2809128664
1168 2809148285
1169 2819592073
1170 2819615904
1171 2821132590
1172 2839098170
1173 2842716557
1174 2852620293
1175 2857550405
1176 2857557281
1177 2857560154
1178 2857566662
1179 2884816934
1180 2884840509
1181 2884855766
1182 2885085279
1183 2896157309
1184 2904424405
1185 2904443788
1186 2904532687
1187 2904585181
1188 2904593530
1189 2904605713
1190 2919048016
1191 2919081506
1192 2919477908
1193 2923513042
1194 2928133878
1195 2932411879
1196 2932418554

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16123

HAGH_C

Hydroxyacylglutathione hydrolase C-terminus

197

285

0.94

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

34

196

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s0i-assembly1.cif.gz_A crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site 0.9517 3 257
2qed-assembly1.cif.gz_A crystal structure of salmonella thyphimurium lt2 glyoxalase ii 0.9453 1 257
6s0i-assembly1.cif.gz_A crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site 0.9444 3 257
2qed-assembly1.cif.gz_A crystal structure of salmonella thyphimurium lt2 glyoxalase ii 0.9417 1 257
8ewo-assembly2.cif.gz_B crystal structure of putative glyoxylase ii from pseudomonas aeruginosa 0.9401 1 257
ID Description Score Start End Superfamily
2obwA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9455 1 257 3.60.15.10
2obwA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9419 1 257 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9368 3 259 3.60.15.10
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9301 3 257 3.60.15.10
af_K7KLP6_1_199_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9288 3 170 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A522RZU3-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 0.9884 1 259 GO:0004416
GO:0019243
GO:0046872
AF-A0A7R8ZYR4-F1-model_v4 hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) 0.9815 1 222 GO:0004416
GO:0005261
GO:0016020
GO:0019243
GO:0031123
GO:0046872
AF-A0A0R2V9S8-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 0.9796 12 257 GO:0004416
GO:0019243
GO:0046872
AF-A0A1T2L6A1-F1-model_v4 Hydroxyacylglutathione hydrolase 0.9766 1 154 GO:0016787
AF-A0A1X1MT64-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 0.9732 1 257 GO:0004416
GO:0019243
GO:0046872

Map