F467796

General Info

Members Datasets Scaffolds Average Seq Length
598 408 513 248

Family's Representative Sequence

Representative Sequence 3300027471|Ga0209995_1011499|Ga0209995_10114991
Length 292
Sequence MMFRQLRFEHSCKSACNQFGKVAVAKDLCSYSMPVRNLQSSGPCDTHIVAVIEFRKVNKWFGPLQVLKDIDLTVDAGNVVVVCGPSGSGKSTLIRCINRLETIQSGDIIVDGRSVCDARLDAASLRANVGMVFQSFNLYPHMTVLDNITLAPLKVKRLSSAEAQKIATGLLDRVGIPDKANAYPANLSGGQQQRVAIARALAMKPKIMLFDEPTSALDPEMINEVLEVMTDLARDGMTMVVVTHEMGFARRVADRVVFMDQGQIIEANKPENFFAAPESPRAQQFLSKILSH

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
4 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
5 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
6 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
7 2643221569 Achromobacter sp. Root565 Isolate Unclassified
8 2643221594 Achromobacter sp. Root170 Isolate Unclassified
9 2643221621 Achromobacter sp. Root83 Isolate Unclassified
10 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
11 2643221688 Rhizobium sp. Root482 Isolate Unclassified
12 2643221736 Bosea sp. Root483D1 Isolate Unclassified
13 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
14 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
15 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
16 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
17 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
18 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
19 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
20 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
21 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
22 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
23 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
24 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
25 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
26 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
27 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
28 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
29 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
30 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
31 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
32 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
33 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
34 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
35 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
36 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
37 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
38 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
39 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
40 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
41 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
42 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
43 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
44 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
45 2909042592 Labrys sp. LIt4 Isolate Nodule
46 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
47 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
48 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
49 2919726948 Bacillus pumilus 4489 Isolate Unclassified
50 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
51 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
52 2932401849 Devosia sp. 2618 Isolate Rhizosphere
53 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
54 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
55 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
56 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
57 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
58 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
59 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
60 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
61 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
62 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
63 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
64 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
65 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
66 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
67 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
68 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
69 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
70 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
71 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
72 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
73 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
74 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
75 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
76 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
77 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
79 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
80 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
81 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
82 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
83 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
84 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
87 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
90 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
91 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
100 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
101 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
102 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
103 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
104 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
105 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
108 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
109 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
123 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
124 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
125 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
126 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
127 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
128 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
135 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
138 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
139 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
140 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
141 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
142 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
155 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
167 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
168 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
169 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
170 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
171 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
172 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
233 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
239 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
243 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
254 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
255 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
266 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
267 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
268 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
269 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
270 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
271 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
272 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
277 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
301 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
305 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
315 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
316 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
317 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
318 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
319 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
338 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
339 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
340 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
341 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
342 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
343 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
344 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
345 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
346 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
382 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
383 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
384 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
388 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
389 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
397 641522639 Methylobacterium sp. 4-46 Isolate Nodule
398 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
399 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
400 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
401 8022653035 Bacillus sp. Rc4 Isolate Unclassified
402 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
403 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
404 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
405 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
406 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
407 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
408 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.79
Metatranscriptomes 0
Isolates 14.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 2.01
Rhizoplane 4.01
Rhizosphere 74.75
Stem 0
Stem Tuber 0
Unclassified 12.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000229 3300002704 Bacteria 22119
2 JGI25156J39149_1003302 3300002705 Bacteria 5339
3 JGI25154J39366_1000511 3300002738 Bacteria 19768
4 JGI25157J39369_1004131 3300002741 Bacteria 2717
5 JGI25151J46595_10000095 3300003187 Bacteria 118630
6 JGI25151J46595_10000318 3300003187 Bacteria 52064
7 Ga0055538_1000024 3300003751 Bacteria 241526
8 Ga0055526_1000249 3300003771 Bacteria 45798
9 Ga0055524_1000043 3300003775 Bacteria 152518
10 Ga0065714_10067678 3300005288 Bacteria 5290
11 Ga0065704_10013198 3300005289 Bacteria 2076
12 Ga0065715_10000426 3300005293 Bacteria 19372
13 Ga0065715_10009394 3300005293 Bacteria 5401
14 Ga0065707_10098051 3300005295 Bacteria 3117
15 Ga0070690_100001728 3300005330 Bacteria 11534
16 Ga0070670_100000241 3300005331 Bacteria 49604
17 Ga0068869_100065337 3300005334 Bacteria 2678
18 Ga0070666_10006590 3300005335 Bacteria 7137
19 Ga0070666_10023588 3300005335 Bacteria 4005
20 Ga0070666_10330185 3300005335 Bacteria 1089
21 Ga0070680_100055288 3300005336 Bacteria 3243
22 Ga0070682_100027582 3300005337 Bacteria 3409
23 Ga0068868_100032140 3300005338 Bacteria 4036
24 Ga0070691_10003903 3300005341 Bacteria 6747
25 Ga0070687_100140713 3300005343 Bacteria 1405
26 Ga0070661_100064324 3300005344 Bacteria 2695
27 Ga0070661_100108327 3300005344 Bacteria 2073
28 Ga0070661_100298825 3300005344 Bacteria 1253
29 Ga0070668_100280882 3300005347 Bacteria 1390
30 Ga0070669_100062838 3300005353 Bacteria 2731
31 Ga0070675_100015962 3300005354 Bacteria 5950
32 Ga0070671_100003162 3300005355 Bacteria 12839
33 Ga0070671_100123386 3300005355 Bacteria 2180
34 Ga0070671_100606094 3300005355 Bacteria 946
35 Ga0070673_100009896 3300005364 Bacteria 6424
36 Ga0070673_100016661 3300005364 Bacteria 5204
37 Ga0070673_100169713 3300005364 Bacteria 1861
38 Ga0070673_100602672 3300005364 Bacteria 1002
39 Ga0070667_100009817 3300005367 Bacteria 7934
40 Ga0070667_100038018 3300005367 Bacteria 4036
41 Ga0070667_100386595 3300005367 Bacteria 1272
42 Ga0070714_100068229 3300005435 Bacteria 3068
43 Ga0070713_100118514 3300005436 Bacteria 2318
44 Ga0070700_100093866 3300005441 Bacteria 1964
45 Ga0070663_100019625 3300005455 Bacteria 4461
46 Ga0070663_100050570 3300005455 Bacteria 2957
47 Ga0070678_100094092 3300005456 Bacteria 2306
48 Ga0070681_10007675 3300005458 Bacteria 10552
49 Ga0070681_10019365 3300005458 Bacteria 6811
50 Ga0068867_100226451 3300005459 Bacteria 1509
51 Ga0068867_100249872 3300005459 Bacteria 1442
52 Ga0070706_100126446 3300005467 Bacteria 2384
53 Ga0070707_100011228 3300005468 Bacteria 8347
54 Ga0070707_100025476 3300005468 Bacteria 5611
55 Ga0070679_100050772 3300005530 Bacteria 4131
56 Ga0070679_100088679 3300005530 Bacteria 3080
57 Ga0070679_100419173 3300005530 Bacteria 1284
58 Ga0070697_100031141 3300005536 Bacteria 4289
59 Ga0070672_100043746 3300005543 Bacteria 3456
60 Ga0070672_100055242 3300005543 Bacteria 3110
61 Ga0070672_100073479 3300005543 Bacteria 2725
62 Ga0070686_100069349 3300005544 Bacteria 2303
63 Ga0070686_100317162 3300005544 Bacteria 1161
64 Ga0070695_100017441 3300005545 Bacteria 4353
65 Ga0070696_100031376 3300005546 Bacteria 3641
66 Ga0070665_100003905 3300005548 Bacteria 15758
67 Ga0068855_100000235 3300005563 Bacteria 70600
68 Ga0068855_100005884 3300005563 Bacteria 14957
69 Ga0068855_100045149 3300005563 Bacteria 5211
70 Ga0068855_100336100 3300005563 Bacteria 1666
71 Ga0070664_100001253 3300005564 Bacteria 20319
72 Ga0070664_100037578 3300005564 Bacteria 4071
73 Ga0068857_100321719 3300005577 Bacteria 1429
74 Ga0068854_100033253 3300005578 Bacteria 3595
75 Ga0068854_100049200 3300005578 Bacteria 3010
76 Ga0068856_100007513 3300005614 Bacteria 10641
77 Ga0070702_100168334 3300005615 Bacteria 1423
78 Ga0068866_10158450 3300005718 Bacteria 1318
79 Ga0068866_10307548 3300005718 Bacteria 992
80 Ga0068851_10116864 3300005834 Bacteria 1430
81 Ga0068863_100662197 3300005841 Bacteria 1036
82 Ga0068858_100052331 3300005842 Bacteria 3778
83 Ga0068860_100078904 3300005843 Bacteria 3131
84 Ga0075365_10313104 3300006038 Bacteria 1105
85 Ga0075368_10018116 3300006042 Bacteria 2643
86 Ga0075363_100133742 3300006048 Bacteria 1392
87 Ga0075364_10041702 3300006051 Bacteria 2981
88 Ga0075432_10003120 3300006058 Bacteria 5599
89 Ga0070716_100154194 3300006173 Bacteria 1481
90 Ga0075369_10035098 3300006186 Bacteria 2130
91 Ga0075366_10002900 3300006195 Bacteria 8906
92 Ga0075366_10026350 3300006195 Bacteria 3404
93 Ga0097621_100257266 3300006237 Bacteria 1531
94 Ga0075370_10039197 3300006353 Bacteria 2668
95 Ga0075428_100434147 3300006844 Bacteria 1407
96 Ga0075431_100026024 3300006847 Bacteria 5998
97 Ga0075431_100195359 3300006847 Bacteria 2072
98 Ga0075431_100282471 3300006847 Bacteria 1680
99 Ga0075433_10084026 3300006852 Bacteria 2810
100 Ga0075433_10132243 3300006852 Bacteria 2217
101 Ga0075433_10187925 3300006852 Bacteria 1838
102 Ga0075434_100000912 3300006871 Bacteria 23726
103 Ga0075434_100003395 3300006871 Bacteria 14264
104 Ga0075434_100053087 3300006871 Bacteria 4028
105 Ga0075434_100113809 3300006871 Bacteria 2718
106 Ga0068865_100072944 3300006881 Bacteria 2440
107 Ga0075436_100005072 3300006914 Bacteria 9064
108 Ga0075436_100137224 3300006914 Bacteria 1718
109 Ga0099826_10000111 3300006948 Bacteria 38073
110 Ga0099794_10218042 3300007265 Bacteria 979
111 Ga0105251_10001709 3300009011 Bacteria 18381
112 Ga0105244_10085698 3300009036 Bacteria 1554
113 Ga0105250_10059492 3300009092 Bacteria 1534
114 Ga0105250_10079229 3300009092 Bacteria 1331
115 Ga0111539_10254829 3300009094 Bacteria 2043
116 Ga0111539_10601240 3300009094 Bacteria 1281
117 Ga0105245_10028254 3300009098 Bacteria 4945
118 Ga0105245_10256027 3300009098 Bacteria 1702
119 Ga0114129_10046851 3300009147 Bacteria 6076
120 Ga0114129_10117245 3300009147 Bacteria 3669
121 Ga0105243_10025532 3300009148 Bacteria 4516
122 Ga0105241_10009789 3300009174 Bacteria 7044
123 Ga0105242_10038460 3300009176 Bacteria 3847
124 Ga0105242_10252814 3300009176 Bacteria 1589
125 Ga0105248_10001597 3300009177 Bacteria 25193
126 Ga0105248_10029885 3300009177 Bacteria 6081
127 Ga0105248_10201612 3300009177 Bacteria 2242
128 Ga0105248_10581094 3300009177 Bacteria 1264
129 Ga0105237_10039387 3300009545 Bacteria 4771
130 Ga0105237_10111120 3300009545 Bacteria 2732
131 Ga0105237_10593508 3300009545 Bacteria 1114
132 Ga0105238_10000113 3300009551 Bacteria 89675
133 Ga0105238_10058573 3300009551 Bacteria 3860
134 Ga0105238_10105126 3300009551 Bacteria 2805
135 Ga0105238_10299803 3300009551 Bacteria 1591
136 Ga0105249_10073334 3300009553 Bacteria 3167
137 Ga0105249_10447338 3300009553 Bacteria 1330
138 Ga0105239_10001563 3300010375 Bacteria 30254
139 Ga0105239_10017697 3300010375 Bacteria 7885
140 Ga0105239_10262397 3300010375 Bacteria 1941
141 Ga0105246_10010742 3300011119 Bacteria 5674
142 Ga0105246_10018015 3300011119 Bacteria 4498
143 Ga0105246_10152400 3300011119 Bacteria 1751
144 Ga0157319_1001881 3300012497 Bacteria 1141
145 Ga0157373_10092948 3300013100 Bacteria 2124
146 Ga0157373_10161683 3300013100 Bacteria 1576
147 Ga0157371_10166634 3300013102 Bacteria 1573
148 Ga0157370_10284202 3300013104 Bacteria 1528
149 Ga0171462_1012 3300013250 Bacteria 208216
150 Ga0157378_10187876 3300013297 Bacteria 1947
151 Ga0163162_10001128 3300013306 Bacteria 24861
152 Ga0163162_10017943 3300013306 Bacteria 6925
153 Ga0163162_10115131 3300013306 Bacteria 2789
154 Ga0163162_10233793 3300013306 Bacteria 1969
155 Ga0157372_10032766 3300013307 Bacteria 5701
156 Ga0157372_10047601 3300013307 Bacteria 4765
157 Ga0157375_10001058 3300013308 Bacteria 23752
158 Ga0157375_10107199 3300013308 Bacteria 2887
159 Ga0157375_10219956 3300013308 Bacteria 2057
160 Ga0157380_10005138 3300014326 Bacteria 9145
161 Ga0157376_10010980 3300014969 Bacteria 6654
162 Ga0182006_1000245 3300015261 Bacteria 50641
163 Ga0182007_10001008 3300015262 Bacteria 15430
164 Ga0209435_100124 3300025206 Bacteria 27904
165 Ga0209646_1000238 3300025246 Bacteria 57384
166 Ga0209026_1003975 3300025250 Bacteria 4614
167 Ga0209759_1000921 3300025256 Bacteria 21615
168 Ga0209130_1001190 3300025284 Bacteria 18542
169 Ga0209676_1008189 3300025292 Bacteria 4717
170 Ga0209025_1000429 3300025294 Bacteria 83306
171 Ga0209564_1000041 3300025295 Bacteria 405199
172 Ga0209564_1008314 3300025295 Bacteria 5142
173 Ga0209758_1002010 3300025297 Bacteria 21870
174 Ga0209050_1001827 3300025298 Bacteria 20722
175 Ga0209050_1016676 3300025298 Bacteria 2987
176 Ga0209256_1000014 3300025299 Bacteria 687409
177 Ga0207426_1000085 3300025302 Bacteria 293171
178 Ga0209051_1009097 3300025303 Bacteria 5160
179 Ga0207697_10008134 3300025315 Bacteria 4618
180 Ga0207697_10022284 3300025315 Bacteria 2594
181 Ga0207656_10086379 3300025321 Bacteria 1417
182 Ga0207656_10135133 3300025321 Bacteria 1158
183 Ga0207696_1099331 3300025711 Bacteria 793
184 Ga0207713_1003781 3300025735 Bacteria 10149
185 Ga0207642_10250366 3300025899 Bacteria 1005
186 Ga0207688_10004542 3300025901 Bacteria 7557
187 Ga0207688_10014828 3300025901 Bacteria 4229
188 Ga0207680_10003765 3300025903 Bacteria 7140
189 Ga0207680_10207096 3300025903 Bacteria 1339
190 Ga0207647_10045724 3300025904 Bacteria 2730
191 Ga0207647_10232048 3300025904 Bacteria 1062
192 Ga0207645_10020234 3300025907 Bacteria 4359
193 Ga0207707_10032009 3300025912 Bacteria 4604
194 Ga0207695_10002110 3300025913 Bacteria 30178
195 Ga0207671_10001053 3300025914 Bacteria 33415
196 Ga0207671_10124001 3300025914 Bacteria 1977
197 Ga0207693_10154107 3300025915 Bacteria 1808
198 Ga0207660_10025398 3300025917 Bacteria 4020
199 Ga0207657_10002201 3300025919 Bacteria 21128
200 Ga0207649_10186349 3300025920 Bacteria 1456
201 Ga0207649_10297588 3300025920 Bacteria 1179
202 Ga0207652_10052510 3300025921 Bacteria 3499
203 Ga0207652_10362267 3300025921 Bacteria 1309
204 Ga0207646_10065881 3300025922 Bacteria 3233
205 Ga0207681_10022576 3300025923 Bacteria 4015
206 Ga0207681_10485962 3300025923 Bacteria 1009
207 Ga0207694_10000075 3300025924 Bacteria 114693
208 Ga0207694_10100159 3300025924 Bacteria 2295
209 Ga0207694_10402529 3300025924 Bacteria 1138
210 Ga0207650_10001805 3300025925 Bacteria 15135
211 Ga0207659_10208975 3300025926 Bacteria 1563
212 Ga0207687_10393465 3300025927 Bacteria 1138
213 Ga0207664_10104432 3300025929 Bacteria 2346
214 Ga0207690_10012404 3300025932 Bacteria 5096
215 Ga0207706_10002107 3300025933 Bacteria 19464
216 Ga0207686_10175927 3300025934 Bacteria 1513
217 Ga0207669_10184266 3300025937 Bacteria 1500
218 Ga0207665_10124210 3300025939 Bacteria 1826
219 Ga0207691_10008329 3300025940 Bacteria 9957
220 Ga0207691_10061325 3300025940 Bacteria 3417
221 Ga0207711_10005820 3300025941 Bacteria 10412
222 Ga0207711_10015929 3300025941 Bacteria 6235
223 Ga0207689_10056084 3300025942 Bacteria 3242
224 Ga0207679_10016389 3300025945 Bacteria 4921
225 Ga0207667_10000110 3300025949 Bacteria 131872
226 Ga0207667_10006885 3300025949 Bacteria 13735
227 Ga0207667_10018717 3300025949 Bacteria 7758
228 Ga0207667_10480648 3300025949 Bacteria 1261
229 Ga0207651_10134326 3300025960 Bacteria 1900
230 Ga0207712_10358754 3300025961 Bacteria 1214
231 Ga0207640_10009174 3300025981 Bacteria 5526
232 Ga0207658_10244664 3300025986 Bacteria 1521
233 Ga0207658_10323656 3300025986 Bacteria 1335
234 Ga0207677_10414542 3300026023 Bacteria 1145
235 Ga0207703_10274227 3300026035 Bacteria 1529
236 Ga0207703_10544347 3300026035 Bacteria 1094
237 Ga0207678_10006728 3300026067 Bacteria 10191
238 Ga0207678_10103002 3300026067 Bacteria 2437
239 Ga0207678_10107857 3300026067 Bacteria 2375
240 Ga0207708_10023099 3300026075 Bacteria 4698
241 Ga0207708_10027482 3300026075 Bacteria 4308
242 Ga0207702_10016597 3300026078 Bacteria 6093
243 Ga0207702_10082368 3300026078 Bacteria 2797
244 Ga0207702_10308948 3300026078 Bacteria 1503
245 Ga0207674_10058955 3300026116 Bacteria 3887
246 Ga0207683_10001733 3300026121 Bacteria 19431
247 Ga0207683_10022161 3300026121 Bacteria 5451
248 Ga0209973_1013537 3300027252 Bacteria 1007
249 Ga0209995_1011499 3300027471 Bacteria 1439
250 Ga0209982_1000864 3300027552 Bacteria 3975
251 Ga0209970_1005183 3300027614 Bacteria 2153
252 Ga0210002_1001446 3300027617 Bacteria 3348
253 Ga0209983_1006509 3300027665 Bacteria 2397
254 Ga0209282_1000732 3300027666 Bacteria 16518
255 Ga0209998_10003754 3300027717 Bacteria 3287
256 Ga0209974_10003272 3300027876 Bacteria 5857
257 Ga0209974_10005507 3300027876 Bacteria 4450
258 Ga0209974_10007787 3300027876 Bacteria 3682
259 Ga0207428_10020006 3300027907 Bacteria 5701
260 Ga0268266_10005433 3300028379 Bacteria 11880
261 Ga0268266_10616305 3300028379 Bacteria 1043
262 Ga0268264_10074017 3300028381 Bacteria 2892
263 Ga0265330_10017135 3300031235 Bacteria 3339
264 Ga0265325_10015182 3300031241 Bacteria 4337
265 Ga0265339_10013765 3300031249 Bacteria 4896
266 Ga0307408_100180746 3300031548 Bacteria 1691
267 Ga0307408_100457746 3300031548 Bacteria 1108
268 Ga0265342_10067903 3300031712 Bacteria 2085
269 Ga0316576_10001641 3300031727 Bacteria 12249
270 Ga0307405_10080630 3300031731 Bacteria 2125
271 Ga0307405_10472443 3300031731 Bacteria 999
272 Ga0307413_10015212 3300031824 Bacteria 3936
273 Ga0307413_10045836 3300031824 Bacteria 2595
274 Ga0307410_10045319 3300031852 Bacteria 2927
275 Ga0307410_10064110 3300031852 Bacteria 2524
276 Ga0307410_10508339 3300031852 Bacteria 992
277 Ga0307406_10022045 3300031901 Bacteria 3775
278 Ga0307406_10219947 3300031901 Bacteria 1411
279 Ga0307407_10041710 3300031903 Bacteria 2568
280 Ga0307407_10079086 3300031903 Bacteria 1983
281 Ga0307407_10125158 3300031903 Bacteria 1636
282 Ga0307412_10007247 3300031911 Bacteria 6287
283 Ga0307412_10025051 3300031911 Bacteria 3690
284 Ga0307412_10061814 3300031911 Bacteria 2519
285 Ga0307412_10209542 3300031911 Bacteria 1486
286 Ga0307409_100014522 3300031995 Bacteria 5128
287 Ga0307409_100054396 3300031995 Bacteria 3082
288 Ga0307409_100288192 3300031995 Bacteria 1521
289 Ga0307409_100508467 3300031995 Bacteria 1174
290 Ga0307416_100069352 3300032002 Bacteria 2917
291 Ga0307416_100375443 3300032002 Bacteria 1450
292 Ga0307414_10047790 3300032004 Bacteria 2948
293 Ga0307415_100009625 3300032126 Bacteria 5431
294 Ga0316580_10097353 3300032139 Bacteria 901
295 Ga0373940_0072746 3300035088 Bacteria 1004
296 Ga0373956_0043945 3300035119 Bacteria 1990
297 Ga0373931_0222278 3300035691 Bacteria 1137
298 Ga0373927_0371959 3300035695 Bacteria 942
299 Ga0373937_0317772 3300036401 Bacteria 1473
300 Ga0316582_0002253 3300036647 Bacteria 8981
301 Ga0316582_0059315 3300036647 Bacteria 2450
302 Ga0316584_0004012 3300036712 Bacteria 9688
303 Ga0316584_0061397 3300036712 Bacteria 2814
304 Ga0316584_0173116 3300036712 Bacteria 1600
305 Ga0395900_0003258 3300037418 Bacteria 17580
306 Ga0395905_0125367 3300037471 Bacteria 2415
307 Ga0395901_0462636 3300038443 Bacteria 1296
308 Ga0439431_0017370 3300041997 Bacteria 1691
309 Ga0439452_000046 3300042010 Bacteria 130842
310 Ga0439456_013399 3300042013 Bacteria 1706
311 Ga0439434_0005016 3300042435 Bacteria 3871
312 Ga0450901_000920 3300042533 Bacteria 3443
313 Ga0451577_0000068 3300042876 Bacteria 241923
314 Ga0451577_0621428 3300042876 Bacteria 980
315 Ga0466972_0146165 3300044658 Bacteria 1112
316 Ga0466965_0305061 3300044683 Bacteria 865
317 Ga0451576_0049550 3300045051 Bacteria 4408
318 Ga0451576_0062156 3300045051 Bacteria 3894
319 Ga0451576_0654731 3300045051 Bacteria 1104
320 Ga0451576_0762095 3300045051 Bacteria 1016
321 Ga0466967_0277776 3300045976 Bacteria 1606
322 Ga0466967_0340526 3300045976 Bacteria 1450
323 Ga0495627_014592 3300046453 Bacteria 2737
324 Ga0495590_0002665 3300046457 Bacteria 7378
325 Ga0495591_000144 3300046458 Bacteria 75817
326 Ga0495629_0217576 3300046459 Bacteria 1318
327 Ga0495653_0003314 3300046463 Bacteria 12931
328 Ga0495605_0005803 3300046474 Bacteria 7144
329 Ga0495605_0170437 3300046474 Bacteria 962
330 Ga0495584_0094867 3300046491 Bacteria 1506
331 Ga0495596_0112154 3300046500 Bacteria 1059
332 Ga0495607_0002089 3300046501 Bacteria 16681
333 Ga0495607_0004246 3300046501 Bacteria 10621
334 Ga0495607_0010943 3300046501 Bacteria 6068
335 Ga0495606_0000990 3300046507 Bacteria 41399
336 Ga0495606_0032733 3300046507 Bacteria 3597
337 Ga0495610_0007209 3300046512 Bacteria 7462
338 Ga0495610_0008769 3300046512 Bacteria 6493
339 Ga0495610_0011039 3300046512 Bacteria 5553
340 Ga0495620_0000065 3300046515 Bacteria 90842
341 Ga0495620_0005571 3300046515 Bacteria 7018
342 Ga0495628_0002680 3300046516 Bacteria 15934
343 Ga0495630_0001625 3300046517 Bacteria 15627
344 Ga0495632_0000421 3300046519 Bacteria 40149
345 Ga0495637_0029051 3300046520 Bacteria 2464
346 Ga0495643_0002355 3300046522 Bacteria 15142
347 Ga0495642_0005038 3300046528 Bacteria 5089
348 Ga0495652_0001468 3300046529 Bacteria 26039
349 Ga0495652_0263252 3300046529 Bacteria 1272
350 Ga0495654_0092122 3300046530 Bacteria 1405
351 Ga0495665_0000184 3300046531 Bacteria 31944
352 Ga0495587_0012602 3300046536 Bacteria 5317
353 Ga0495597_0006750 3300046542 Bacteria 5908
354 Ga0495597_0054633 3300046542 Bacteria 1753
355 Ga0495645_0011832 3300046543 Bacteria 6147
356 Ga0495635_0007577 3300046663 Bacteria 7574
357 Ga0495661_0000047 3300046665 Bacteria 146326
358 Ga0495588_0305420 3300046674 Bacteria 837
359 Ga0495599_0169126 3300046678 Bacteria 1349
360 Ga0495623_0001022 3300046679 Bacteria 18934
361 Ga0495669_0023296 3300046684 Bacteria 2694
362 Ga0495669_0102548 3300046684 Bacteria 1330
363 Ga0495670_0003366 3300046691 Bacteria 7866
364 Ga0495649_0292364 3300046694 Bacteria 831
365 Ga0495589_0000669 3300046794 Bacteria 22466
366 Ga0495589_0001077 3300046794 Bacteria 16294
367 Ga0495600_0078820 3300046809 Bacteria 2151
368 Ga0495600_0109330 3300046809 Bacteria 1800
369 Ga0495660_0048800 3300046810 Bacteria 2314
370 Ga0495581_0070940 3300047315 Bacteria 2016
371 Ga0495604_0002912 3300047317 Bacteria 13721
372 Ga0495674_0024236 3300047319 Bacteria 5579
373 Ga0495680_0020202 3300047322 Bacteria 5609
374 Ga0495683_0001566 3300047323 Bacteria 14818
375 Ga0495687_000005 3300047443 Bacteria 610401
376 Ga0495675_0014062 3300047444 Bacteria 5059
377 Ga0495679_000674 3300047446 Bacteria 22384
378 Ga0495679_020367 3300047446 Bacteria 2311
379 Ga0495685_033324 3300047447 Bacteria 1770
380 Ga0495673_0098907 3300047469 Bacteria 1182
381 Ga0495681_0001120 3300047470 Bacteria 20319
382 Ga0495681_0008370 3300047470 Bacteria 6493
383 Ga0495681_0009690 3300047470 Bacteria 5905
384 Ga0495593_0005628 3300047673 Bacteria 7395
385 Ga0495602_0001075 3300048088 Bacteria 26813
386 Ga0495626_0130360 3300048091 Bacteria 1074
387 Ga0496100_0040757 3300048903 Bacteria 2957
388 Ga0496100_0252008 3300048903 Bacteria 1306
389 Ga0496101_0006058 3300048904 Bacteria 7760
390 Ga0496102_0002576 3300048905 Bacteria 15461
391 Ga0496102_0368929 3300048905 Bacteria 1351
392 Ga0496103_0053703 3300048906 Bacteria 2497
393 Ga0496103_0065993 3300048906 Bacteria 2258
394 Ga0496104_0025327 3300048907 Bacteria 5469
395 Ga0496104_0489109 3300048907 Bacteria 1142
396 Ga0496105_0245484 3300048908 Bacteria 1452
397 Ga0496105_0284961 3300048908 Bacteria 1331
398 Ga0496107_0022464 3300048910 Bacteria 4458
399 Ga0496107_0164597 3300048910 Bacteria 1644
400 Ga0496108_0588166 3300048911 Bacteria 970
401 Ga0496110_0003254 3300048913 Bacteria 12382
402 Ga0496111_0516318 3300048914 Bacteria 879
403 Ga0496112_0002364 3300048915 Bacteria 15157
404 Ga0496112_0069699 3300048915 Bacteria 3473
405 Ga0496113_0001917 3300048916 Bacteria 11882
406 Ga0496113_0178186 3300048916 Bacteria 1685
407 Ga0496115_0027633 3300048918 Bacteria 4441
408 Ga0496115_0128763 3300048918 Bacteria 2086
409 Ga0496116_0002577 3300048919 Bacteria 18879
410 Ga0496116_0020483 3300048919 Bacteria 5021
411 Ga0496116_0149677 3300048919 Bacteria 1299
412 Ga0496117_0018750 3300048920 Bacteria 5714
413 Ga0496118_0145091 3300048921 Bacteria 1496
414 Ga0496121_0000100 3300048924 Bacteria 198641
415 Ga0496121_0011781 3300048924 Bacteria 9644
416 Ga0496121_0040642 3300048924 Bacteria 4076
417 Ga0496121_0095257 3300048924 Bacteria 2314
418 Ga0496121_0102919 3300048924 Bacteria 2198
419 Ga0496122_0004972 3300048925 Bacteria 16086
420 Ga0496122_0006588 3300048925 Bacteria 13254
421 Ga0496122_0194543 3300048925 Bacteria 1193
422 Ga0496123_0003372 3300048926 Bacteria 18061
423 Ga0496124_0002797 3300048927 Bacteria 22104
424 Ga0496124_0004561 3300048927 Bacteria 16098
425 Ga0496124_0050893 3300048927 Bacteria 3526
426 Ga0496125_0005929 3300048928 Bacteria 13386
427 Ga0496125_0011406 3300048928 Bacteria 8890
428 Ga0496125_0013098 3300048928 Bacteria 8177
429 Ga0496125_0050941 3300048928 Bacteria 3421
430 Ga0496126_0001145 3300048929 Bacteria 44005
431 Ga0496126_0048630 3300048929 Bacteria 3874
432 Ga0496126_0085248 3300048929 Bacteria 2785
433 Ga0501033_0068078 3300049570 Bacteria 2618
434 Ga0501033_0070443 3300049570 Bacteria 2569
435 Ga0501034_0205845 3300049571 Bacteria 1924
436 Ga0501034_0218713 3300049571 Bacteria 1858
437 Ga0501034_0273426 3300049571 Bacteria 1630
438 Ga0501036_0047235 3300049572 Bacteria 3646
439 Ga0501036_0364544 3300049572 Bacteria 1206
440 Ga0501037_0015751 3300049573 Bacteria 5564
441 Ga0501038_0002511 3300049574 Bacteria 17093
442 Ga0501039_0001556 3300049575 Bacteria 16876
443 Ga0501040_0003219 3300049576 Bacteria 10561
444 Ga0501041_0000212 3300049577 Bacteria 26965
445 Ga0501042_0000098 3300049578 Bacteria 34576
446 Ga0501043_0188310 3300049579 Bacteria 1606
447 Ga0501043_0196687 3300049579 Bacteria 1566
448 Ga0501046_0015300 3300049580 Bacteria 6451
449 Ga0501047_0089084 3300049581 Bacteria 2963
450 Ga0501048_0004806 3300049582 Bacteria 10296
451 Ga0501069_0063037 3300049585 Bacteria 2070
452 Ga0501070_0017605 3300049586 Bacteria 5999
453 Ga0501070_0531285 3300049586 Bacteria 943
454 Ga0501071_0000452 3300049587 Bacteria 20662
455 Ga0501072_0044935 3300049588 Bacteria 3472
456 Ga0501072_0255965 3300049588 Bacteria 1394
457 Ga0501073_0013088 3300049589 Bacteria 6052
458 Ga0501073_0034857 3300049589 Bacteria 3580
459 Ga0501073_0176678 3300049589 Bacteria 1478
460 Ga0501073_0219077 3300049589 Bacteria 1315
461 Ga0501074_0004506 3300049590 Bacteria 9974
462 Ga0501074_0023654 3300049590 Bacteria 4465
463 Ga0501075_0000095 3300049591 Bacteria 40804
464 Ga0501076_0000386 3300049592 Bacteria 27579
465 Ga0501077_0000670 3300049593 Bacteria 20698
466 Ga0501217_076390 3300049661 Bacteria 920
467 Ga0501079_0001514 3300049741 Bacteria 16455
468 Ga0501080_0097373 3300049742 Bacteria 2731
469 Ga0501081_0000063 3300049743 Bacteria 41530
470 Ga0501083_0007185 3300049744 Bacteria 7908
471 Ga0501035_0118540 3300049822 Bacteria 2316
472 Ga0501044_0026894 3300049823 Bacteria 6089
473 Ga0501044_0079262 3300049823 Bacteria 3328
474 Ga0501045_0000186 3300049824 Bacteria 34725
475 nmdc:mga03n38_132249_c1 3300050490 Bacteria 1238
476 nmdc:mga00v17_13505_c2 3300050491 Bacteria 4157
477 nmdc:mga0yw44_282733_c1 3300050492 Bacteria 1109
478 nmdc:mga0yw44_306779_c1 3300050492 Bacteria 1064
479 nmdc:mga0k408_40516_c1 3300050493 Bacteria 2680
480 nmdc:mga0k408_5235_c1 3300050493 Bacteria 6887
481 nmdc:mga07m45_14313_c1 3300050496 Bacteria 4223
482 nmdc:mga05p37_113218_c1 3300050507 Bacteria 3336
483 nmdc:mga05p37_643123_c1 3300050507 Bacteria 1189
484 nmdc:mga09592_306117_c1 3300050508 Bacteria 1377
485 nmdc:mga06r32_262154_c1 3300050510 Bacteria 1716
486 nmdc:mga06r32_473266_c1 3300050510 Bacteria 1231
487 nmdc:mga08y16_100368_c1 3300050511 Bacteria 3013
488 nmdc:mga08y16_404359_c1 3300050511 Bacteria 1397
489 nmdc:mga08y16_94837_c1 3300050511 Bacteria 3108
490 nmdc:mga0n895_25810_c1 3300050512 Bacteria 5556
491 nmdc:mga0n895_31767_c1 3300050512 Bacteria 5059
492 nmdc:mga0n895_377049_c1 3300050512 Bacteria 1436
493 nmdc:mga0n895_613_c1 3300050512 Bacteria 24760
494 nmdc:mga0n895_659914_c1 3300050512 Bacteria 1044
495 nmdc:mga0rr50_61810_c1 3300050513 Bacteria 2823
496 nmdc:mga0rr50_94600_c1 3300050513 Bacteria 2334
497 nmdc:mga08x19_114342_c1 3300050514 Bacteria 1803
498 nmdc:mga08x19_21028_c1 3300050514 Bacteria 4025
499 nmdc:mga08x19_352653_c1 3300050514 Bacteria 1027
500 nmdc:mga0a205_17778_c1 3300050515 Bacteria 6671
501 nmdc:mga0a205_229939_c1 3300050515 Bacteria 1738
502 nmdc:mga0a205_258328_c1 3300050515 Bacteria 1620
503 nmdc:mga0a205_46558_c1 3300050515 Bacteria 4183
504 nmdc:mga0sz30_47029_c1 3300050516 Bacteria 1823
505 Ga0500643_008152 3300053087 Bacteria 4144
506 Ga0500566_0000210 3300053094 Bacteria 30847
507 Ga0500568_0000048 3300053139 Bacteria 119025
508 Ga0500568_0020221 3300053139 Bacteria 2883
509 Ga0500568_0022641 3300053139 Bacteria 2684
510 Ga0500616_0055893 3300053153 Bacteria 2062
511 Ga0501084_0000662 3300054114 Bacteria 26273
512 Ga0501082_0000921 3300060353 Bacteria 25918
513 Ga0530510_0381796 3300061734 Bacteria 1060

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100606094 Ga0070671_1006060941 218
2 3300005364 Ga0070673_100016661 Ga0070673_1000166614 218
3 3300005455 Ga0070663_100019625 Ga0070663_1000196252 218
4 3300005543 Ga0070672_100073479 Ga0070672_1000734793 218
5 3300009177 Ga0105248_10581094 Ga0105248_105810942 218
6 3300013104 Ga0157370_10284202 Ga0157370_102842022 218
7 3300025940 Ga0207691_10061325 Ga0207691_100613253 218
8 3300026035 Ga0207703_10544347 Ga0207703_105443472 218
9 3300026067 Ga0207678_10107857 Ga0207678_101078572 218
10 3300013308 Ga0157375_10107199 Ga0157375_101071992 231
11 3300025321 Ga0207656_10086379 Ga0207656_100863791 231
12 3300026023 Ga0207677_10414542 Ga0207677_104145422 231
13 3300042435 Ga0439434_0005016 Ga0439434_0005016_478_1224 231
14 3300044683 Ga0466965_0305061 Ga0466965_0305061_23_784 231
15 3300046474 Ga0495605_0170437 Ga0495605_0170437_83_811 235
16 3300049589 Ga0501073_0013088 Ga0501073_0013088_3832_4557 235
17 3300005364 Ga0070673_100009896 Ga0070673_1000098964 236
18 3300005364 Ga0070673_100602672 Ga0070673_1006026721 236
19 3300005843 Ga0068860_100078904 Ga0068860_1000789044 236
20 3300028381 Ga0268264_10074017 Ga0268264_100740171 236
21 3300042013 Ga0439456_013399 Ga0439456_013399_137_847 236
22 3300046501 Ga0495607_0004246 Ga0495607_0004246_3579_4289 236
23 3300046501 Ga0495607_0010943 Ga0495607_0010943_3741_4451 236
24 3300046507 Ga0495606_0000990 Ga0495606_0000990_12916_13626 236
25 3300046515 Ga0495620_0000065 Ga0495620_0000065_79032_79742 236
26 3300046794 Ga0495589_0000669 Ga0495589_0000669_9300_10010 236
27 3300047446 Ga0495679_000674 Ga0495679_000674_12371_13081 236
28 3300048924 Ga0496121_0102919 Ga0496121_0102919_1375_2106 237
29 3300053094 Ga0500566_0000210 Ga0500566_0000210_22980_23744 238
30 iso_pu_bacteria 2511231027 2511391173 238
31 iso_pu_bacteria 2511231119 2511700415 238
32 iso_pu_bacteria 2648501850 2651531710 238
33 iso_pu_bacteria 2684623153 2686997642 238
34 iso_pu_bacteria 2695420354 2695628405 238
35 iso_pu_bacteria 2739367655 2739612591 238
36 iso_pu_bacteria 2739367655 2739613731 238
37 iso_pu_bacteria 2808606399 2809055615 238
38 iso_pu_bacteria 2842871566 2842874104 238
39 iso_pu_bacteria 2844533157 2844535060 238
40 iso_pu_bacteria 2877768649 2877771302 238
41 iso_pu_bacteria 2880169592 2880172169 238
42 iso_pu_bacteria 2889295896 2889298428 238
43 iso_pu_bacteria 2897109615 2897112444 238
44 iso_pu_bacteria 2897803580 2897809667 238
45 iso_pu_bacteria 2919726948 2919728545 238
46 iso_pu_bacteria 2928521798 2928525185 238
47 iso_pu_bacteria 2954011201 2954011275 238
48 iso_pu_bacteria 2981284811 2981289175 238
49 iso_pu_bacteria 2981289755 2981293991 238
50 iso_pu_bacteria 2981980479 2981984754 238
51 iso_pu_bacteria 2981985349 2981989682 238
52 iso_pu_bacteria 3002141150 3002145492 238
53 iso_pu_bacteria 3006879489 3006882443 238
54 iso_pu_bacteria 3006984091 3006985803 238
55 iso_pu_bacteria 8022630665 8022632043 238
56 iso_pu_bacteria 8022653035 8022654559 238
57 iso_pu_bacteria 8054280661 8054283859 238
58 iso_pu_bacteria 8057733483 8057738649 238
59 3300003187 JGI25151J46595_10000318 JGI25151J46595_100003189 239
60 3300003751 Ga0055538_1000024 Ga0055538_1000024173 239
61 3300005335 Ga0070666_10006590 Ga0070666_100065905 239
62 3300005335 Ga0070666_10330185 Ga0070666_103301852 239
63 3300005364 Ga0070673_100169713 Ga0070673_1001697132 239
64 3300005435 Ga0070714_100068229 Ga0070714_1000682292 239
65 3300005456 Ga0070678_100094092 Ga0070678_1000940923 239
66 3300005563 Ga0068855_100000235 Ga0068855_10000023514 239
67 3300005563 Ga0068855_100045149 Ga0068855_1000451495 239
68 3300005578 Ga0068854_100049200 Ga0068854_1000492002 239
69 3300005834 Ga0068851_10116864 Ga0068851_101168642 239
70 3300006051 Ga0075364_10041702 Ga0075364_100417024 239
71 3300009011 Ga0105251_10001709 Ga0105251_100017099 239
72 3300009036 Ga0105244_10085698 Ga0105244_100856982 239
73 3300009092 Ga0105250_10059492 Ga0105250_100594921 239
74 3300009092 Ga0105250_10079229 Ga0105250_100792291 239
75 3300009177 Ga0105248_10029885 Ga0105248_100298854 239
76 3300009545 Ga0105237_10593508 Ga0105237_105935082 239
77 3300009551 Ga0105238_10000113 Ga0105238_1000011351 239
78 3300009551 Ga0105238_10058573 Ga0105238_100585733 239
79 3300010375 Ga0105239_10001563 Ga0105239_100015635 239
80 3300010375 Ga0105239_10262397 Ga0105239_102623973 239
81 3300011119 Ga0105246_10152400 Ga0105246_101524002 239
82 3300013306 Ga0163162_10001128 Ga0163162_1000112820 239
83 3300013308 Ga0157375_10001058 Ga0157375_1000105813 239
84 3300015261 Ga0182006_1000245 Ga0182006_10002453 239
85 3300015262 Ga0182007_10001008 Ga0182007_1000100815 239
86 3300025284 Ga0209130_1001190 Ga0209130_10011909 239
87 3300025294 Ga0209025_1000429 Ga0209025_100042969 239
88 3300025297 Ga0209758_1002010 Ga0209758_10020109 239
89 3300025302 Ga0207426_1000085 Ga0207426_1000085184 239
90 3300025321 Ga0207656_10135133 Ga0207656_101351331 239
91 3300025711 Ga0207696_1099331 Ga0207696_10993311 239
92 3300025735 Ga0207713_1003781 Ga0207713_10037814 239
93 3300025903 Ga0207680_10003765 Ga0207680_100037654 239
94 3300025904 Ga0207647_10045724 Ga0207647_100457242 239
95 3300025904 Ga0207647_10232048 Ga0207647_102320481 239
96 3300025913 Ga0207695_10002110 Ga0207695_100021102 239
97 3300025914 Ga0207671_10001053 Ga0207671_1000105318 239
98 3300025924 Ga0207694_10000075 Ga0207694_1000007537 239
99 3300025924 Ga0207694_10100159 Ga0207694_101001592 239
100 3300025941 Ga0207711_10015929 Ga0207711_100159294 239
101 3300025949 Ga0207667_10000110 Ga0207667_1000011048 239
102 3300025949 Ga0207667_10018717 Ga0207667_100187175 239
103 3300025960 Ga0207651_10134326 Ga0207651_101343262 239
104 3300025981 Ga0207640_10009174 Ga0207640_100091744 239
105 3300026121 Ga0207683_10022161 Ga0207683_100221613 239
106 3300028379 Ga0268266_10616305 Ga0268266_106163051 239
107 3300031727 Ga0316576_10001641 Ga0316576_1000164112 239
108 3300041997 Ga0439431_0017370 Ga0439431_0017370_443_1171 239
109 3300044658 Ga0466972_0146165 Ga0466972_0146165_352_1080 239
110 3300045051 Ga0451576_0654731 Ga0451576_0654731_18_746 239
111 3300046457 Ga0495590_0002665 Ga0495590_0002665_6266_6994 239
112 3300046459 Ga0495629_0217576 Ga0495629_0217576_547_1275 239
113 3300046463 Ga0495653_0003314 Ga0495653_0003314_2688_3416 239
114 3300046474 Ga0495605_0005803 Ga0495605_0005803_971_1699 239
115 3300046491 Ga0495584_0094867 Ga0495584_0094867_563_1291 239
116 3300046500 Ga0495596_0112154 Ga0495596_0112154_112_840 239
117 3300046507 Ga0495606_0032733 Ga0495606_0032733_375_1103 239
118 3300046512 Ga0495610_0007209 Ga0495610_0007209_1459_2187 239
119 3300046512 Ga0495610_0011039 Ga0495610_0011039_3404_4132 239
120 3300046515 Ga0495620_0005571 Ga0495620_0005571_1775_2503 239
121 3300046516 Ga0495628_0002680 Ga0495628_0002680_1510_2238 239
122 3300046517 Ga0495630_0001625 Ga0495630_0001625_13406_14134 239
123 3300046528 Ga0495642_0005038 Ga0495642_0005038_462_1190 239
124 3300046529 Ga0495652_0001468 Ga0495652_0001468_4320_5048 239
125 3300046531 Ga0495665_0000184 Ga0495665_0000184_21242_21970 239
126 3300046536 Ga0495587_0012602 Ga0495587_0012602_1289_2017 239
127 3300046542 Ga0495597_0006750 Ga0495597_0006750_4779_5507 239
128 3300046542 Ga0495597_0054633 Ga0495597_0054633_332_1060 239
129 3300046543 Ga0495645_0011832 Ga0495645_0011832_2031_2759 239
130 3300046663 Ga0495635_0007577 Ga0495635_0007577_522_1250 239
131 3300046674 Ga0495588_0305420 Ga0495588_0305420_80_808 239
132 3300046678 Ga0495599_0169126 Ga0495599_0169126_532_1260 239
133 3300046679 Ga0495623_0001022 Ga0495623_0001022_5644_6372 239
134 3300046684 Ga0495669_0023296 Ga0495669_0023296_726_1454 239
135 3300046684 Ga0495669_0102548 Ga0495669_0102548_65_793 239
136 3300046691 Ga0495670_0003366 Ga0495670_0003366_4670_5398 239
137 3300046694 Ga0495649_0292364 Ga0495649_0292364_38_766 239
138 3300046794 Ga0495589_0001077 Ga0495589_0001077_3310_4038 239
139 3300046809 Ga0495600_0078820 Ga0495600_0078820_828_1556 239
140 3300046810 Ga0495660_0048800 Ga0495660_0048800_932_1660 239
141 3300047315 Ga0495581_0070940 Ga0495581_0070940_835_1563 239
142 3300047317 Ga0495604_0002912 Ga0495604_0002912_5295_6023 239
143 3300047319 Ga0495674_0024236 Ga0495674_0024236_684_1412 239
144 3300047322 Ga0495680_0020202 Ga0495680_0020202_4756_5484 239
145 3300047323 Ga0495683_0001566 Ga0495683_0001566_6478_7206 239
146 3300047443 Ga0495687_000005 Ga0495687_000005_392543_393271 239
147 3300047444 Ga0495675_0014062 Ga0495675_0014062_1959_2687 239
148 3300047446 Ga0495679_020367 Ga0495679_020367_135_863 239
149 3300047447 Ga0495685_033324 Ga0495685_033324_857_1585 239
150 3300047469 Ga0495673_0098907 Ga0495673_0098907_420_1148 239
151 3300047673 Ga0495593_0005628 Ga0495593_0005628_4174_4902 239
152 3300048088 Ga0495602_0001075 Ga0495602_0001075_17215_17943 239
153 3300048091 Ga0495626_0130360 Ga0495626_0130360_100_828 239
154 3300048903 Ga0496100_0040757 Ga0496100_0040757_2108_2836 239
155 3300048904 Ga0496101_0006058 Ga0496101_0006058_57_785 239
156 3300048905 Ga0496102_0002576 Ga0496102_0002576_2732_3460 239
157 3300048906 Ga0496103_0053703 Ga0496103_0053703_1220_1948 239
158 3300048906 Ga0496103_0065993 Ga0496103_0065993_50_778 239
159 3300048907 Ga0496104_0025327 Ga0496104_0025327_2970_3698 239
160 3300048908 Ga0496105_0245484 Ga0496105_0245484_130_858 239
161 3300048908 Ga0496105_0284961 Ga0496105_0284961_579_1307 239
162 3300048910 Ga0496107_0022464 Ga0496107_0022464_231_959 239
163 3300048910 Ga0496107_0164597 Ga0496107_0164597_635_1363 239
164 3300048913 Ga0496110_0003254 Ga0496110_0003254_4596_5324 239
165 3300048915 Ga0496112_0002364 Ga0496112_0002364_9806_10534 239
166 3300048916 Ga0496113_0001917 Ga0496113_0001917_259_987 239
167 3300048918 Ga0496115_0027633 Ga0496115_0027633_2734_3462 239
168 3300048918 Ga0496115_0128763 Ga0496115_0128763_1244_1972 239
169 3300048919 Ga0496116_0002577 Ga0496116_0002577_16792_17520 239
170 3300048920 Ga0496117_0018750 Ga0496117_0018750_3392_4120 239
171 3300048921 Ga0496118_0145091 Ga0496118_0145091_176_904 239
172 3300048924 Ga0496121_0040642 Ga0496121_0040642_1594_2322 239
173 3300048925 Ga0496122_0006588 Ga0496122_0006588_5195_5923 239
174 3300048927 Ga0496124_0004561 Ga0496124_0004561_11800_12528 239
175 3300048928 Ga0496125_0011406 Ga0496125_0011406_2316_3044 239
176 3300048929 Ga0496126_0048630 Ga0496126_0048630_696_1424 239
177 3300050491 nmdc:mga00v17_13505_c2 nmdc:mga00v17_13505_c2_2585_3310 239
178 3300050492 nmdc:mga0yw44_306779_c1 nmdc:mga0yw44_306779_c1_334_1053 239
179 3300053139 Ga0500568_0020221 Ga0500568_0020221_1734_2462 239
180 3300053153 Ga0500616_0055893 Ga0500616_0055893_941_1669 239
181 iso_pu_bacteria 2521172590 2521560528 239
182 iso_pu_bacteria 2818991449 2819617213 239
183 iso_pu_bacteria 2904439833 2904442851 239
184 iso_pu_bacteria 2904530477 2904534952 239
185 iso_pu_bacteria 2904584206 2904588709 239
186 iso_pu_bacteria 2904589729 2904594217 239
187 iso_pu_bacteria 2904601388 2904604942 239
188 iso_pu_bacteria 2909042592 2909047787 239
189 iso_pu_bacteria 2919046199 2919048651 239
190 iso_pu_bacteria 2919079590 2919083178 239
191 iso_pu_bacteria 2928130867 2928133034 239
192 iso_pu_bacteria 8048746797 8048748705 239
193 3300005347 Ga0070668_100280882 Ga0070668_1002808822 240
194 3300005459 Ga0068867_100226451 Ga0068867_1002264511 240
195 3300005718 Ga0068866_10307548 Ga0068866_103075482 240
196 3300006038 Ga0075365_10313104 Ga0075365_103131042 240
197 3300006195 Ga0075366_10002900 Ga0075366_100029005 240
198 3300009094 Ga0111539_10601240 Ga0111539_106012402 240
199 3300009098 Ga0105245_10256027 Ga0105245_102560272 240
200 3300009148 Ga0105243_10025532 Ga0105243_100255322 240
201 3300009545 Ga0105237_10111120 Ga0105237_101111202 240
202 3300009553 Ga0105249_10447338 Ga0105249_104473382 240
203 3300011119 Ga0105246_10018015 Ga0105246_100180154 240
204 3300014326 Ga0157380_10005138 Ga0157380_100051385 240
205 3300025899 Ga0207642_10250366 Ga0207642_102503662 240
206 3300025901 Ga0207688_10004542 Ga0207688_100045425 240
207 3300025914 Ga0207671_10124001 Ga0207671_101240012 240
208 3300025927 Ga0207687_10393465 Ga0207687_103934652 240
209 3300025937 Ga0207669_10184266 Ga0207669_101842662 240
210 3300025961 Ga0207712_10358754 Ga0207712_103587542 240
211 3300026075 Ga0207708_10023099 Ga0207708_100230994 240
212 3300032139 Ga0316580_10097353 Ga0316580_100973531 240
213 3300036647 Ga0316582_0002253 Ga0316582_0002253_6135_6857 240
214 3300036647 Ga0316582_0059315 Ga0316582_0059315_323_1045 240
215 3300036712 Ga0316584_0061397 Ga0316584_0061397_1446_2168 240
216 3300036712 Ga0316584_0173116 Ga0316584_0173116_355_1077 240
217 3300046529 Ga0495652_0263252 Ga0495652_0263252_64_822 240
218 3300050492 nmdc:mga0yw44_282733_c1 nmdc:mga0yw44_282733_c1_227_961 240
219 3300050493 nmdc:mga0k408_5235_c1 nmdc:mga0k408_5235_c1_6087_6833 240
220 iso_pu_bacteria 2508501114 2509078542 240
221 iso_pu_bacteria 2775506901 2776266116 240
222 iso_pu_bacteria 2844315083 2844322666 240
223 iso_pu_bacteria 2876761206 2876766077 240
224 iso_pu_bacteria 2903727486 2903734819 240
225 iso_pu_bacteria 2906602504 2906604870 240
226 iso_pu_bacteria 2919055335 2919055512 240
227 iso_pu_bacteria 2932794094 2932801578 240
228 iso_pu_bacteria 3005409236 3005409946 240
229 iso_pu_bacteria 3005594810 3005602740 240
230 iso_pu_bacteria 3005718088 3005725212 240
231 iso_pu_bacteria 8056967851 8056976675 240
232 3300003187 JGI25151J46595_10000095 JGI25151J46595_100000952 241
233 3300005343 Ga0070687_100140713 Ga0070687_1001407132 241
234 3300005367 Ga0070667_100386595 Ga0070667_1003865951 241
235 3300005530 Ga0070679_100088679 Ga0070679_1000886792 241
236 3300005548 Ga0070665_100003905 Ga0070665_1000039053 241
237 3300005841 Ga0068863_100662197 Ga0068863_1006621972 241
238 3300009177 Ga0105248_10201612 Ga0105248_102016123 241
239 3300009551 Ga0105238_10299803 Ga0105238_102998032 241
240 3300012497 Ga0157319_1001881 Ga0157319_10018812 241
241 3300013100 Ga0157373_10161683 Ga0157373_101616831 241
242 3300013102 Ga0157371_10166634 Ga0157371_101666342 241
243 3300025292 Ga0209676_1008189 Ga0209676_10081893 241
244 3300025298 Ga0209050_1001827 Ga0209050_100182718 241
245 3300025298 Ga0209050_1016676 Ga0209050_10166762 241
246 3300025303 Ga0209051_1009097 Ga0209051_10090973 241
247 3300025921 Ga0207652_10052510 Ga0207652_100525103 241
248 3300028379 Ga0268266_10005433 Ga0268266_100054333 241
249 3300031235 Ga0265330_10017135 Ga0265330_100171351 241
250 3300031241 Ga0265325_10015182 Ga0265325_100151824 241
251 3300031249 Ga0265339_10013765 Ga0265339_100137652 241
252 3300031712 Ga0265342_10067903 Ga0265342_100679033 241
253 3300031731 Ga0307405_10472443 Ga0307405_104724431 241
254 3300031911 Ga0307412_10007247 Ga0307412_100072473 241
255 3300037418 Ga0395900_0003258 Ga0395900_0003258_3690_4427 241
256 3300042876 Ga0451577_0000068 Ga0451577_0000068_142126_142887 241
257 3300045051 Ga0451576_0049550 Ga0451576_0049550_1177_1902 241
258 3300048919 Ga0496116_0020483 Ga0496116_0020483_1297_2037 241
259 3300048924 Ga0496121_0095257 Ga0496121_0095257_1005_1817 241
260 3300048925 Ga0496122_0004972 Ga0496122_0004972_12314_13054 241
261 3300048926 Ga0496123_0003372 Ga0496123_0003372_12370_13110 241
262 3300048927 Ga0496124_0002797 Ga0496124_0002797_7341_8087 241
263 3300048927 Ga0496124_0050893 Ga0496124_0050893_1943_2683 241
264 3300048928 Ga0496125_0005929 Ga0496125_0005929_2152_2892 241
265 3300048928 Ga0496125_0013098 Ga0496125_0013098_4524_5258 241
266 3300048928 Ga0496125_0050941 Ga0496125_0050941_1858_2598 241
267 3300048929 Ga0496126_0085248 Ga0496126_0085248_2010_2750 241
268 3300049570 Ga0501033_0068078 Ga0501033_0068078_180_905 241
269 3300049571 Ga0501034_0205845 Ga0501034_0205845_1059_1823 241
270 3300049572 Ga0501036_0364544 Ga0501036_0364544_278_1003 241
271 3300049579 Ga0501043_0188310 Ga0501043_0188310_11_736 241
272 3300049581 Ga0501047_0089084 Ga0501047_0089084_528_1259 241
273 3300049586 Ga0501070_0531285 Ga0501070_0531285_142_867 241
274 3300049588 Ga0501072_0255965 Ga0501072_0255965_230_961 241
275 3300049589 Ga0501073_0219077 Ga0501073_0219077_167_934 241
276 3300049823 Ga0501044_0026894 Ga0501044_0026894_4330_5055 241
277 3300053087 Ga0500643_008152 Ga0500643_008152_1005_1808 241
278 3300053139 Ga0500568_0000048 Ga0500568_0000048_26475_27278 241
279 3300053139 Ga0500568_0022641 Ga0500568_0022641_83_817 241
280 iso_pu_bacteria 2599185292 2599905929 241
281 iso_pu_bacteria 2599185292 2599907820 241
282 iso_pu_bacteria 2643221569 2643859083 241
283 iso_pu_bacteria 2643221569 2643859890 241
284 iso_pu_bacteria 2643221594 2643979180 241
285 iso_pu_bacteria 2643221594 2643980087 241
286 iso_pu_bacteria 2643221621 2644121224 241
287 iso_pu_bacteria 2643221621 2644122950 241
288 iso_pu_bacteria 2643221627 2644153838 241
289 iso_pu_bacteria 2643221688 2644492754 241
290 iso_pu_bacteria 2758568016 2758638217 241
291 iso_pu_bacteria 2808606395 2809033811 241
292 iso_pu_bacteria 2808606395 2809036053 241
293 iso_pu_bacteria 2837678835 2837681732 241
294 iso_pu_bacteria 2854896431 2854896654 241
295 iso_pu_bacteria 2857531043 2857533350 241
296 iso_pu_bacteria 2857537821 2857539719 241
297 iso_pu_bacteria 2932401849 2932404049 241
298 iso_pu_bacteria 2941479691 2941484926 241
299 iso_pu_bacteria 2995726249 2995727661 241
300 iso_pu_bacteria 643348564 643601343 241
301 iso_pu_bacteria 8002392321 8002395602 241
302 iso_pu_bacteria 8045864390 8045868898 241
303 iso_pu_bacteria 8055034563 8055036369 241
304 3300002704 JGI25155J39150_1000229 JGI25155J39150_100022919 242
305 3300002705 JGI25156J39149_1003302 JGI25156J39149_10033023 242
306 3300002738 JGI25154J39366_1000511 JGI25154J39366_10005116 242
307 3300002741 JGI25157J39369_1004131 JGI25157J39369_10041313 242
308 3300003771 Ga0055526_1000249 Ga0055526_100024920 242
309 3300003775 Ga0055524_1000043 Ga0055524_100004381 242
310 3300005288 Ga0065714_10067678 Ga0065714_100676782 242
311 3300005289 Ga0065704_10013198 Ga0065704_100131982 242
312 3300005293 Ga0065715_10000426 Ga0065715_100004266 242
313 3300005293 Ga0065715_10009394 Ga0065715_100093944 242
314 3300005295 Ga0065707_10098051 Ga0065707_100980513 242
315 3300005330 Ga0070690_100001728 Ga0070690_1000017287 242
316 3300005331 Ga0070670_100000241 Ga0070670_10000024113 242
317 3300005334 Ga0068869_100065337 Ga0068869_1000653372 242
318 3300005335 Ga0070666_10023588 Ga0070666_100235884 242
319 3300005336 Ga0070680_100055288 Ga0070680_1000552883 242
320 3300005337 Ga0070682_100027582 Ga0070682_1000275822 242
321 3300005338 Ga0068868_100032140 Ga0068868_1000321402 242
322 3300005341 Ga0070691_10003903 Ga0070691_100039036 242
323 3300005344 Ga0070661_100064324 Ga0070661_1000643243 242
324 3300005344 Ga0070661_100108327 Ga0070661_1001083272 242
325 3300005344 Ga0070661_100298825 Ga0070661_1002988251 242
326 3300005353 Ga0070669_100062838 Ga0070669_1000628383 242
327 3300005354 Ga0070675_100015962 Ga0070675_1000159623 242
328 3300005355 Ga0070671_100003162 Ga0070671_1000031625 242
329 3300005355 Ga0070671_100123386 Ga0070671_1001233863 242
330 3300005367 Ga0070667_100009817 Ga0070667_1000098176 242
331 3300005367 Ga0070667_100038018 Ga0070667_1000380182 242
332 3300005436 Ga0070713_100118514 Ga0070713_1001185142 242
333 3300005441 Ga0070700_100093866 Ga0070700_1000938662 242
334 3300005455 Ga0070663_100050570 Ga0070663_1000505702 242
335 3300005458 Ga0070681_10007675 Ga0070681_100076753 242
336 3300005458 Ga0070681_10019365 Ga0070681_100193653 242
337 3300005459 Ga0068867_100249872 Ga0068867_1002498722 242
338 3300005467 Ga0070706_100126446 Ga0070706_1001264463 242
339 3300005468 Ga0070707_100011228 Ga0070707_1000112289 242
340 3300005468 Ga0070707_100025476 Ga0070707_1000254763 242
341 3300005530 Ga0070679_100050772 Ga0070679_1000507724 242
342 3300005530 Ga0070679_100419173 Ga0070679_1004191731 242
343 3300005536 Ga0070697_100031141 Ga0070697_1000311413 242
344 3300005543 Ga0070672_100043746 Ga0070672_1000437462 242
345 3300005543 Ga0070672_100055242 Ga0070672_1000552422 242
346 3300005544 Ga0070686_100069349 Ga0070686_1000693492 242
347 3300005544 Ga0070686_100317162 Ga0070686_1003171622 242
348 3300005545 Ga0070695_100017441 Ga0070695_1000174415 242
349 3300005546 Ga0070696_100031376 Ga0070696_1000313763 242
350 3300005563 Ga0068855_100005884 Ga0068855_1000058849 242
351 3300005563 Ga0068855_100336100 Ga0068855_1003361002 242
352 3300005564 Ga0070664_100001253 Ga0070664_10000125313 242
353 3300005564 Ga0070664_100037578 Ga0070664_1000375782 242
354 3300005577 Ga0068857_100321719 Ga0068857_1003217192 242
355 3300005578 Ga0068854_100033253 Ga0068854_1000332534 242
356 3300005614 Ga0068856_100007513 Ga0068856_1000075134 242
357 3300005615 Ga0070702_100168334 Ga0070702_1001683343 242
358 3300005718 Ga0068866_10158450 Ga0068866_101584502 242
359 3300005842 Ga0068858_100052331 Ga0068858_1000523312 242
360 3300006042 Ga0075368_10018116 Ga0075368_100181163 242
361 3300006048 Ga0075363_100133742 Ga0075363_1001337422 242
362 3300006058 Ga0075432_10003120 Ga0075432_100031203 242
363 3300006173 Ga0070716_100154194 Ga0070716_1001541942 242
364 3300006186 Ga0075369_10035098 Ga0075369_100350982 242
365 3300006195 Ga0075366_10026350 Ga0075366_100263504 242
366 3300006237 Ga0097621_100257266 Ga0097621_1002572662 242
367 3300006353 Ga0075370_10039197 Ga0075370_100391972 242
368 3300006844 Ga0075428_100434147 Ga0075428_1004341473 242
369 3300006847 Ga0075431_100026024 Ga0075431_1000260246 242
370 3300006847 Ga0075431_100195359 Ga0075431_1001953592 242
371 3300006847 Ga0075431_100282471 Ga0075431_1002824712 242
372 3300006852 Ga0075433_10084026 Ga0075433_100840261 242
373 3300006852 Ga0075433_10132243 Ga0075433_101322433 242
374 3300006852 Ga0075433_10187925 Ga0075433_101879252 242
375 3300006871 Ga0075434_100000912 Ga0075434_1000009123 242
376 3300006871 Ga0075434_100003395 Ga0075434_1000033959 242
377 3300006871 Ga0075434_100053087 Ga0075434_1000530873 242
378 3300006871 Ga0075434_100113809 Ga0075434_1001138093 242
379 3300006881 Ga0068865_100072944 Ga0068865_1000729443 242
380 3300006914 Ga0075436_100005072 Ga0075436_1000050722 242
381 3300006914 Ga0075436_100137224 Ga0075436_1001372242 242
382 3300006948 Ga0099826_10000111 Ga0099826_1000011114 242
383 3300007265 Ga0099794_10218042 Ga0099794_102180422 242
384 3300009094 Ga0111539_10254829 Ga0111539_102548293 242
385 3300009098 Ga0105245_10028254 Ga0105245_100282545 242
386 3300009147 Ga0114129_10046851 Ga0114129_100468512 242
387 3300009147 Ga0114129_10117245 Ga0114129_101172452 242
388 3300009174 Ga0105241_10009789 Ga0105241_100097894 242
389 3300009176 Ga0105242_10038460 Ga0105242_100384602 242
390 3300009176 Ga0105242_10252814 Ga0105242_102528142 242
391 3300009177 Ga0105248_10001597 Ga0105248_1000159715 242
392 3300009545 Ga0105237_10039387 Ga0105237_100393873 242
393 3300009551 Ga0105238_10105126 Ga0105238_101051263 242
394 3300009553 Ga0105249_10073334 Ga0105249_100733344 242
395 3300010375 Ga0105239_10017697 Ga0105239_100176974 242
396 3300011119 Ga0105246_10010742 Ga0105246_100107422 242
397 3300013100 Ga0157373_10092948 Ga0157373_100929481 242
398 3300013250 Ga0171462_1012 Ga0171462_101276 242
399 3300013297 Ga0157378_10187876 Ga0157378_101878762 242
400 3300013306 Ga0163162_10017943 Ga0163162_100179434 242
401 3300013306 Ga0163162_10115131 Ga0163162_101151312 242
402 3300013306 Ga0163162_10233793 Ga0163162_102337932 242
403 3300013307 Ga0157372_10032766 Ga0157372_100327663 242
404 3300013307 Ga0157372_10047601 Ga0157372_100476015 242
405 3300013308 Ga0157375_10219956 Ga0157375_102199563 242
406 3300014969 Ga0157376_10010980 Ga0157376_100109806 242
407 3300025206 Ga0209435_100124 Ga0209435_10012429 242
408 3300025246 Ga0209646_1000238 Ga0209646_100023839 242
409 3300025250 Ga0209026_1003975 Ga0209026_10039755 242
410 3300025256 Ga0209759_1000921 Ga0209759_100092123 242
411 3300025295 Ga0209564_1000041 Ga0209564_1000041347 242
412 3300025295 Ga0209564_1008314 Ga0209564_10083143 242
413 3300025299 Ga0209256_1000014 Ga0209256_1000014207 242
414 3300025315 Ga0207697_10008134 Ga0207697_100081345 242
415 3300025315 Ga0207697_10022284 Ga0207697_100222843 242
416 3300025901 Ga0207688_10014828 Ga0207688_100148285 242
417 3300025903 Ga0207680_10207096 Ga0207680_102070962 242
418 3300025907 Ga0207645_10020234 Ga0207645_100202344 242
419 3300025912 Ga0207707_10032009 Ga0207707_100320095 242
420 3300025915 Ga0207693_10154107 Ga0207693_101541072 242
421 3300025917 Ga0207660_10025398 Ga0207660_100253983 242
422 3300025919 Ga0207657_10002201 Ga0207657_1000220112 242
423 3300025920 Ga0207649_10186349 Ga0207649_101863492 242
424 3300025920 Ga0207649_10297588 Ga0207649_102975882 242
425 3300025921 Ga0207652_10362267 Ga0207652_103622672 242
426 3300025922 Ga0207646_10065881 Ga0207646_100658813 242
427 3300025923 Ga0207681_10022576 Ga0207681_100225763 242
428 3300025923 Ga0207681_10485962 Ga0207681_104859622 242
429 3300025924 Ga0207694_10402529 Ga0207694_104025292 242
430 3300025925 Ga0207650_10001805 Ga0207650_100018056 242
431 3300025926 Ga0207659_10208975 Ga0207659_102089752 242
432 3300025929 Ga0207664_10104432 Ga0207664_101044322 242
433 3300025932 Ga0207690_10012404 Ga0207690_100124043 242
434 3300025933 Ga0207706_10002107 Ga0207706_100021079 242
435 3300025934 Ga0207686_10175927 Ga0207686_101759272 242
436 3300025939 Ga0207665_10124210 Ga0207665_101242102 242
437 3300025940 Ga0207691_10008329 Ga0207691_100083294 242
438 3300025941 Ga0207711_10005820 Ga0207711_100058203 242
439 3300025942 Ga0207689_10056084 Ga0207689_100560844 242
440 3300025945 Ga0207679_10016389 Ga0207679_100163892 242
441 3300025949 Ga0207667_10006885 Ga0207667_100068856 242
442 3300025949 Ga0207667_10480648 Ga0207667_104806482 242
443 3300025986 Ga0207658_10244664 Ga0207658_102446641 242
444 3300025986 Ga0207658_10323656 Ga0207658_103236562 242
445 3300026035 Ga0207703_10274227 Ga0207703_102742272 242
446 3300026067 Ga0207678_10006728 Ga0207678_100067285 242
447 3300026067 Ga0207678_10103002 Ga0207678_101030021 242
448 3300026075 Ga0207708_10027482 Ga0207708_100274823 242
449 3300026078 Ga0207702_10016597 Ga0207702_100165974 242
450 3300026078 Ga0207702_10082368 Ga0207702_100823682 242
451 3300026078 Ga0207702_10308948 Ga0207702_103089481 242
452 3300026116 Ga0207674_10058955 Ga0207674_100589554 242
453 3300026121 Ga0207683_10001733 Ga0207683_1000173312 242
454 3300027252 Ga0209973_1013537 Ga0209973_10135372 242
455 3300027471 Ga0209995_1011499 Ga0209995_10114991 242
456 3300027552 Ga0209982_1000864 Ga0209982_10008642 242
457 3300027614 Ga0209970_1005183 Ga0209970_10051832 242
458 3300027617 Ga0210002_1001446 Ga0210002_10014464 242
459 3300027665 Ga0209983_1006509 Ga0209983_10065093 242
460 3300027666 Ga0209282_1000732 Ga0209282_10007324 242
461 3300027717 Ga0209998_10003754 Ga0209998_100037542 242
462 3300027876 Ga0209974_10003272 Ga0209974_100032723 242
463 3300027876 Ga0209974_10005507 Ga0209974_100055072 242
464 3300027876 Ga0209974_10007787 Ga0209974_100077873 242
465 3300027907 Ga0207428_10020006 Ga0207428_100200064 242
466 3300031548 Ga0307408_100180746 Ga0307408_1001807462 242
467 3300031548 Ga0307408_100457746 Ga0307408_1004577461 242
468 3300031731 Ga0307405_10080630 Ga0307405_100806302 242
469 3300031824 Ga0307413_10015212 Ga0307413_100152122 242
470 3300031824 Ga0307413_10045836 Ga0307413_100458362 242
471 3300031852 Ga0307410_10045319 Ga0307410_100453193 242
472 3300031852 Ga0307410_10064110 Ga0307410_100641103 242
473 3300031852 Ga0307410_10508339 Ga0307410_105083392 242
474 3300031901 Ga0307406_10022045 Ga0307406_100220452 242
475 3300031901 Ga0307406_10219947 Ga0307406_102199472 242
476 3300031903 Ga0307407_10041710 Ga0307407_100417102 242
477 3300031903 Ga0307407_10079086 Ga0307407_100790862 242
478 3300031903 Ga0307407_10125158 Ga0307407_101251582 242
479 3300031911 Ga0307412_10025051 Ga0307412_100250515 242
480 3300031911 Ga0307412_10061814 Ga0307412_100618142 242
481 3300031911 Ga0307412_10209542 Ga0307412_102095422 242
482 3300031995 Ga0307409_100014522 Ga0307409_1000145223 242
483 3300031995 Ga0307409_100054396 Ga0307409_1000543962 242
484 3300031995 Ga0307409_100288192 Ga0307409_1002881922 242
485 3300031995 Ga0307409_100508467 Ga0307409_1005084672 242
486 3300032002 Ga0307416_100069352 Ga0307416_1000693522 242
487 3300032002 Ga0307416_100375443 Ga0307416_1003754432 242
488 3300032004 Ga0307414_10047790 Ga0307414_100477903 242
489 3300032126 Ga0307415_100009625 Ga0307415_1000096254 242
490 3300035088 Ga0373940_0072746 Ga0373940_0072746_100_828 242
491 3300035119 Ga0373956_0043945 Ga0373956_0043945_860_1588 242
492 3300035691 Ga0373931_0222278 Ga0373931_0222278_339_1115 242
493 3300035695 Ga0373927_0371959 Ga0373927_0371959_37_765 242
494 3300036401 Ga0373937_0317772 Ga0373937_0317772_634_1362 242
495 3300036712 Ga0316584_0004012 Ga0316584_0004012_633_1361 242
496 3300037471 Ga0395905_0125367 Ga0395905_0125367_529_1272 242
497 3300038443 Ga0395901_0462636 Ga0395901_0462636_236_982 242
498 3300042010 Ga0439452_000046 Ga0439452_000046_124075_124845 242
499 3300042533 Ga0450901_000920 Ga0450901_000920_1747_2505 242
500 3300042876 Ga0451577_0621428 Ga0451577_0621428_175_903 242
501 3300045051 Ga0451576_0062156 Ga0451576_0062156_503_1246 242
502 3300045051 Ga0451576_0762095 Ga0451576_0762095_36_812 242
503 3300045976 Ga0466967_0277776 Ga0466967_0277776_132_872 242
504 3300045976 Ga0466967_0340526 Ga0466967_0340526_92_868 242
505 3300046453 Ga0495627_014592 Ga0495627_014592_356_1126 242
506 3300046458 Ga0495591_000144 Ga0495591_000144_48438_49208 242
507 3300046501 Ga0495607_0002089 Ga0495607_0002089_3959_4729 242
508 3300046512 Ga0495610_0008769 Ga0495610_0008769_997_1767 242
509 3300046519 Ga0495632_0000421 Ga0495632_0000421_32155_32919 242
510 3300046520 Ga0495637_0029051 Ga0495637_0029051_710_1444 242
511 3300046522 Ga0495643_0002355 Ga0495643_0002355_8717_9481 242
512 3300046530 Ga0495654_0092122 Ga0495654_0092122_393_1157 242
513 3300046665 Ga0495661_0000047 Ga0495661_0000047_100123_100893 242
514 3300046809 Ga0495600_0109330 Ga0495600_0109330_232_1011 242
515 3300047470 Ga0495681_0001120 Ga0495681_0001120_1066_1830 242
516 3300047470 Ga0495681_0008370 Ga0495681_0008370_3714_4484 242
517 3300047470 Ga0495681_0009690 Ga0495681_0009690_2149_2919 242
518 3300048903 Ga0496100_0252008 Ga0496100_0252008_507_1235 242
519 3300048905 Ga0496102_0368929 Ga0496102_0368929_186_938 242
520 3300048907 Ga0496104_0489109 Ga0496104_0489109_298_1074 242
521 3300048911 Ga0496108_0588166 Ga0496108_0588166_106_882 242
522 3300048914 Ga0496111_0516318 Ga0496111_0516318_75_815 242
523 3300048915 Ga0496112_0069699 Ga0496112_0069699_2424_3200 242
524 3300048916 Ga0496113_0178186 Ga0496113_0178186_42_818 242
525 3300048919 Ga0496116_0149677 Ga0496116_0149677_442_1170 242
526 3300048924 Ga0496121_0000100 Ga0496121_0000100_144405_145133 242
527 3300048924 Ga0496121_0011781 Ga0496121_0011781_2312_3073 242
528 3300048925 Ga0496122_0194543 Ga0496122_0194543_64_792 242
529 3300048929 Ga0496126_0001145 Ga0496126_0001145_5476_6204 242
530 3300049570 Ga0501033_0070443 Ga0501033_0070443_207_935 242
531 3300049571 Ga0501034_0218713 Ga0501034_0218713_460_1191 242
532 3300049571 Ga0501034_0273426 Ga0501034_0273426_119_874 242
533 3300049572 Ga0501036_0047235 Ga0501036_0047235_2878_3606 242
534 3300049573 Ga0501037_0015751 Ga0501037_0015751_4151_4879 242
535 3300049574 Ga0501038_0002511 Ga0501038_0002511_3689_4417 242
536 3300049575 Ga0501039_0001556 Ga0501039_0001556_11012_11740 242
537 3300049576 Ga0501040_0003219 Ga0501040_0003219_6701_7429 242
538 3300049577 Ga0501041_0000212 Ga0501041_0000212_12819_13547 242
539 3300049578 Ga0501042_0000098 Ga0501042_0000098_26709_27437 242
540 3300049579 Ga0501043_0196687 Ga0501043_0196687_659_1438 242
541 3300049580 Ga0501046_0015300 Ga0501046_0015300_174_902 242
542 3300049582 Ga0501048_0004806 Ga0501048_0004806_2171_2899 242
543 3300049585 Ga0501069_0063037 Ga0501069_0063037_1032_1763 242
544 3300049586 Ga0501070_0017605 Ga0501070_0017605_3648_4376 242
545 3300049587 Ga0501071_0000452 Ga0501071_0000452_6659_7387 242
546 3300049588 Ga0501072_0044935 Ga0501072_0044935_2032_2760 242
547 3300049589 Ga0501073_0034857 Ga0501073_0034857_1818_2549 242
548 3300049589 Ga0501073_0176678 Ga0501073_0176678_117_872 242
549 3300049590 Ga0501074_0004506 Ga0501074_0004506_5361_6089 242
550 3300049590 Ga0501074_0023654 Ga0501074_0023654_3072_3803 242
551 3300049591 Ga0501075_0000095 Ga0501075_0000095_26702_27430 242
552 3300049592 Ga0501076_0000386 Ga0501076_0000386_2112_2840 242
553 3300049593 Ga0501077_0000670 Ga0501077_0000670_15966_16694 242
554 3300049661 Ga0501217_076390 Ga0501217_076390_177_905 242
555 3300049741 Ga0501079_0001514 Ga0501079_0001514_14830_15558 242
556 3300049742 Ga0501080_0097373 Ga0501080_0097373_1059_1790 242
557 3300049743 Ga0501081_0000063 Ga0501081_0000063_13458_14186 242
558 3300049744 Ga0501083_0007185 Ga0501083_0007185_1737_2465 242
559 3300049822 Ga0501035_0118540 Ga0501035_0118540_120_851 242
560 3300049823 Ga0501044_0079262 Ga0501044_0079262_113_844 242
561 3300049824 Ga0501045_0000186 Ga0501045_0000186_5894_6622 242
562 3300050490 nmdc:mga03n38_132249_c1 nmdc:mga03n38_132249_c1_317_1045 242
563 3300050493 nmdc:mga0k408_40516_c1 nmdc:mga0k408_40516_c1_1248_1976 242
564 3300050496 nmdc:mga07m45_14313_c1 nmdc:mga07m45_14313_c1_1859_2587 242
565 3300050507 nmdc:mga05p37_113218_c1 nmdc:mga05p37_113218_c1_375_1121 242
566 3300050507 nmdc:mga05p37_643123_c1 nmdc:mga05p37_643123_c1_249_1022 242
567 3300050508 nmdc:mga09592_306117_c1 nmdc:mga09592_306117_c1_616_1362 242
568 3300050510 nmdc:mga06r32_262154_c1 nmdc:mga06r32_262154_c1_684_1424 242
569 3300050510 nmdc:mga06r32_473266_c1 nmdc:mga06r32_473266_c1_330_1100 242
570 3300050511 nmdc:mga08y16_100368_c1 nmdc:mga08y16_100368_c1_820_1596 242
571 3300050511 nmdc:mga08y16_404359_c1 nmdc:mga08y16_404359_c1_420_1148 242
572 3300050511 nmdc:mga08y16_94837_c1 nmdc:mga08y16_94837_c1_1034_1810 242
573 3300050512 nmdc:mga0n895_25810_c1 nmdc:mga0n895_25810_c1_3055_3831 242
574 3300050512 nmdc:mga0n895_31767_c1 nmdc:mga0n895_31767_c1_1616_2344 242
575 3300050512 nmdc:mga0n895_377049_c1 nmdc:mga0n895_377049_c1_51_827 242
576 3300050512 nmdc:mga0n895_613_c1 nmdc:mga0n895_613_c1_19519_20247 242
577 3300050512 nmdc:mga0n895_659914_c1 nmdc:mga0n895_659914_c1_107_856 242
578 3300050513 nmdc:mga0rr50_61810_c1 nmdc:mga0rr50_61810_c1_1352_2080 242
579 3300050513 nmdc:mga0rr50_94600_c1 nmdc:mga0rr50_94600_c1_959_1687 242
580 3300050514 nmdc:mga08x19_114342_c1 nmdc:mga08x19_114342_c1_86_862 242
581 3300050514 nmdc:mga08x19_21028_c1 nmdc:mga08x19_21028_c1_36_764 242
582 3300050514 nmdc:mga08x19_352653_c1 nmdc:mga08x19_352653_c1_60_857 242
583 3300050515 nmdc:mga0a205_17778_c1 nmdc:mga0a205_17778_c1_5486_6214 242
584 3300050515 nmdc:mga0a205_229939_c1 nmdc:mga0a205_229939_c1_282_1028 242
585 3300050515 nmdc:mga0a205_258328_c1 nmdc:mga0a205_258328_c1_819_1592 242
586 3300050515 nmdc:mga0a205_46558_c1 nmdc:mga0a205_46558_c1_2902_3678 242
587 3300050516 nmdc:mga0sz30_47029_c1 nmdc:mga0sz30_47029_c1_551_1342 242
588 3300054114 Ga0501084_0000662 Ga0501084_0000662_23434_24162 242
589 3300060353 Ga0501082_0000921 Ga0501082_0000921_4005_4733 242
590 3300061734 Ga0530510_0381796 Ga0530510_0381796_41_769 242
591 iso_pu_bacteria 2643221565 2643845765 242
592 iso_pu_bacteria 2643221736 2644743064 242
593 iso_pu_bacteria 2838074704 2838079886 242
594 iso_pu_bacteria 2852387548 2852392330 242
595 iso_pu_bacteria 2876377896 2876378120 242
596 iso_pu_bacteria 2945961074 2945962943 242
597 iso_pu_bacteria 641522639 641641997 242
598 iso_pu_bacteria 8046767195 8046773407 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

67

215

0.95

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

148

249

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9906 2 241
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9888 1 240
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9847 1 240
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9784 2 241
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9773 1 240
ID Description Score Start End Superfamily
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9885 1 240 3.40.50.300
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9845 1 240 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9561 2 236 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9522 1 219 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9518 1 236 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4Y8J269-F1-model_v4 deleted 0.9985 1 212
AF-A0A2T5G7R1-F1-model_v4 Glutamine transport ATP-binding protein GlnQ 0.9984 1 239 GO:0005524
GO:0015424
GO:0016887
AF-A0A8B2V9U2-F1-model_v4 deleted 0.9982 1 239
AF-A0A0H5Q9M2-F1-model_v4 Glutamate transport ATP-binding protein 0.998 1 239 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-A0A1F0F7W3-F1-model_v4 Polar amino acid ABC transporter ATP-binding protein 0.998 1 210 GO:0005524
GO:0005886
GO:0015424
GO:0016887

Feature Viewer

pLDDT pTM Quality
95.05 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map