F467804

General Info

Members Datasets Scaffolds Average Seq Length
598 334 1196 175

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0525705|Ga0436361_0525705_2931_3533
Length 172
Sequence MRDALLEGLRAPLTEPPPAPDDPELLALAASVRQAAEATLGRSLAIRQVDAGSCNGCELEIHALNNAFYDLERFGLRFVASPRHADVLLVTGPVTCNMAEALKRTYDATPAPKWVVASGACGCPPSPKTLLKGLLALMRGREKEGDPLAGCKAAATPRFNPGWRDLYKTLND

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
97 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
98 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
331 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.86
Nodule 0
Rhizoplane 6.02
Rhizosphere 85.28
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0525705 3300039447 Bacteria 4021
2 2214772973 2209111006 Bacteria 13664
3 ARSoilYngRDRAFT_c00271 3300000042 Bacteria 7864
4 ARcpr5yngRDRAFT_c000144 3300000043 Bacteria 11410
5 ARSoilOldRDRAFT_c000251 3300000044 Bacteria 7817
6 ARCol0yngRDRAFT_1000173 3300000652 Bacteria 11015
7 JGI25404J52841_10001640 3300003659 Bacteria 4008
8 Ga0065716_1001617 3300005277 Bacteria 5144
9 Ga0065704_10014826 3300005289 Bacteria 2345
10 Ga0070658_10042629 3300005327 Bacteria 3665
11 Ga0070683_100135213 3300005329 Bacteria 2334
12 Ga0070683_100741943 3300005329 Bacteria 941
13 Ga0070690_100523942 3300005330 Bacteria 890
14 Ga0070690_100540983 3300005330 Bacteria 877
15 Ga0068869_101202756 3300005334 Bacteria 666
16 Ga0070666_10388823 3300005335 Bacteria 1002
17 Ga0070680_100081266 3300005336 Bacteria 2674
18 Ga0070682_100023469 3300005337 Bacteria 3661
19 Ga0070660_100011386 3300005339 Bacteria 6317
20 Ga0070660_100040763 3300005339 Bacteria 3536
21 Ga0070689_100012758 3300005340 Bacteria 6065
22 Ga0070689_100680566 3300005340 Bacteria 897
23 Ga0070687_100601139 3300005343 Bacteria 756
24 Ga0070668_100052214 3300005347 Bacteria 3151
25 Ga0070669_100025035 3300005353 Bacteria 4284
26 Ga0070669_100212667 3300005353 Bacteria 1526
27 Ga0070669_101072474 3300005353 Bacteria 693
28 Ga0070675_100193576 3300005354 Bacteria 1763
29 Ga0070675_100546476 3300005354 Unclassified 1047
30 Ga0070675_100555137 3300005354 Bacteria 1039
31 Ga0070674_100047420 3300005356 Bacteria 2944
32 Ga0070673_100592147 3300005364 Bacteria 1011
33 Ga0070688_100097846 3300005365 Unclassified 1929
34 Ga0070688_100107368 3300005365 Bacteria 1850
35 Ga0070667_100028081 3300005367 Bacteria 4683
36 Ga0070667_100273204 3300005367 Bacteria 1516
37 Ga0070709_11182060 3300005434 Bacteria 614
38 Ga0070714_100368120 3300005435 Bacteria 1353
39 Ga0070713_100284837 3300005436 Bacteria 1517
40 Ga0070711_100426220 3300005439 Bacteria 1082
41 Ga0070705_100203246 3300005440 Bacteria 1360
42 Ga0070663_100014235 3300005455 Bacteria 5101
43 Ga0070663_100081651 3300005455 Bacteria 2377
44 Ga0070678_100048719 3300005456 Bacteria 3053
45 Ga0070678_100433656 3300005456 Bacteria 1148
46 Ga0070662_100768524 3300005457 Bacteria 818
47 Ga0070681_10026770 3300005458 Bacteria 5798
48 Ga0070681_10060026 3300005458 Bacteria 3781
49 Ga0070681_11196550 3300005458 Bacteria 682
50 Ga0068867_100004534 3300005459 Bacteria 9766
51 Ga0070685_10015350 3300005466 Bacteria 4066
52 Ga0070685_10875760 3300005466 Bacteria 667
53 Ga0070679_100190779 3300005530 Bacteria 2018
54 Ga0070684_100451359 3300005535 Unclassified 1188
55 Ga0070697_100080048 3300005536 Bacteria 2691
56 Ga0070697_100383978 3300005536 Bacteria 1217
57 Ga0070697_100567508 3300005536 Bacteria 996
58 Ga0068853_100059919 3300005539 Bacteria 3289
59 Ga0070672_100107080 3300005543 Bacteria 2275
60 Ga0070672_100114792 3300005543 Bacteria 2199
61 Ga0070686_100106041 3300005544 Bacteria 1907
62 Ga0070696_100000817 3300005546 Bacteria 20048
63 Ga0070693_100374229 3300005547 Bacteria 981
64 Ga0070665_100038838 3300005548 Bacteria 4786
65 Ga0070665_100190808 3300005548 Bacteria 2050
66 Ga0068855_100136549 3300005563 Bacteria 2798
67 Ga0068854_100048208 3300005578 Bacteria 3039
68 Ga0068856_100238555 3300005614 Bacteria 1834
69 Ga0068852_100146859 3300005616 Bacteria 2188
70 Ga0068852_101433170 3300005616 Bacteria 713
71 Ga0068859_100023458 3300005617 Bacteria 6191
72 Ga0068859_100367563 3300005617 Bacteria 1534
73 Ga0068864_100024729 3300005618 Bacteria 5053
74 Ga0068864_101052129 3300005618 Bacteria 809
75 Ga0068864_101491575 3300005618 Bacteria 679
76 Ga0068861_100757215 3300005719 Bacteria 908
77 Ga0068863_100213110 3300005841 Bacteria 1860
78 Ga0068858_100452125 3300005842 Bacteria 1238
79 Ga0068860_100075810 3300005843 Bacteria 3199
80 Ga0068860_100260287 3300005843 Bacteria 1691
81 Ga0068862_100614674 3300005844 Bacteria 1045
82 Ga0068862_101113190 3300005844 Bacteria 785
83 Ga0081455_10002722 3300005937 Bacteria 20863
84 Ga0081538_10140186 3300005981 Bacteria 1117
85 Ga0081540_1000140 3300005983 Bacteria 75770
86 Ga0081539_10027712 3300005985 Bacteria 3581
87 Ga0075365_10148438 3300006038 Bacteria 1630
88 Ga0075368_10066212 3300006042 Bacteria 1452
89 Ga0075363_100129228 3300006048 Bacteria 1416
90 Ga0075363_100415477 3300006048 Bacteria 791
91 Ga0075364_10156435 3300006051 Bacteria 1537
92 Ga0070716_100097946 3300006173 Bacteria 1791
93 Ga0070716_100255139 3300006173 Bacteria 1197
94 Ga0070716_100481128 3300006173 Bacteria 912
95 Ga0070712_100417191 3300006175 Bacteria 1112
96 Ga0070712_100662745 3300006175 Unclassified 887
97 Ga0075362_10015104 3300006177 Bacteria 3135
98 Ga0075362_10098367 3300006177 Bacteria 1365
99 Ga0075362_10162195 3300006177 Bacteria 1077
100 Ga0075362_10271320 3300006177 Bacteria 837
101 Ga0075362_10353772 3300006177 Bacteria 735
102 Ga0075367_10162300 3300006178 Bacteria 1390
103 Ga0075367_10236007 3300006178 Bacteria 1145
104 Ga0075367_10418033 3300006178 Bacteria 849
105 Ga0075369_10051730 3300006186 Bacteria 1779
106 Ga0075369_10150656 3300006186 Bacteria 1063
107 Ga0075366_10145992 3300006195 Bacteria 1431
108 Ga0097621_100770346 3300006237 Bacteria 890
109 Ga0075370_10146961 3300006353 Bacteria 1380
110 Ga0075370_10353526 3300006353 Bacteria 878
111 Ga0068871_100686959 3300006358 Bacteria 937
112 Ga0075430_100075097 3300006846 Bacteria 2834
113 Ga0075433_10119436 3300006852 Bacteria 2340
114 Ga0075433_10847623 3300006852 Bacteria 798
115 Ga0075434_100000519 3300006871 Bacteria 29333
116 Ga0075434_100160574 3300006871 Bacteria 2267
117 Ga0068865_100472118 3300006881 Unclassified 1041
118 Ga0068865_101090232 3300006881 Bacteria 703
119 Ga0075436_100041538 3300006914 Bacteria 3174
120 Ga0075436_100244833 3300006914 Bacteria 1276
121 Ga0097620_100023457 3300006931 Bacteria 6191
122 Ga0097620_100367553 3300006931 Bacteria 1534
123 Ga0075435_100004741 3300007076 Bacteria 9387
124 Ga0075435_100065102 3300007076 Bacteria 2963
125 Ga0075435_100093857 3300007076 Bacteria 2480
126 Ga0075435_100192522 3300007076 Bacteria 1726
127 Ga0075435_100481043 3300007076 Bacteria 1072
128 Ga0075435_100505545 3300007076 Bacteria 1045
129 Ga0099794_10025507 3300007265 Bacteria 2724
130 Ga0099795_10045144 3300007788 Bacteria 1583
131 Ga0099795_10498745 3300007788 Bacteria 567
132 Ga0105240_10013204 3300009093 Bacteria 11364
133 Ga0105240_10020195 3300009093 Bacteria 8892
134 Ga0105240_10428922 3300009093 Bacteria 1484
135 Ga0105240_11262889 3300009093 Bacteria 780
136 Ga0111539_10012295 3300009094 Bacteria 10730
137 Ga0111539_10015669 3300009094 Bacteria 9422
138 Ga0105245_10001061 3300009098 Bacteria 24893
139 Ga0105245_10626162 3300009098 Bacteria 1104
140 Ga0105243_10101445 3300009148 Bacteria 2390
141 Ga0105243_10260632 3300009148 Bacteria 1552
142 Ga0105243_10475689 3300009148 Bacteria 1178
143 Ga0105241_10082987 3300009174 Bacteria 2513
144 Ga0105242_10794087 3300009176 Bacteria 936
145 Ga0105248_10010127 3300009177 Bacteria 10385
146 Ga0105248_10099607 3300009177 Bacteria 3275
147 Ga0105248_11321747 3300009177 Bacteria 815
148 Ga0105248_11508556 3300009177 Bacteria 761
149 Ga0105237_10083693 3300009545 Bacteria 3181
150 Ga0105237_10560154 3300009545 Bacteria 1150
151 Ga0105238_10598417 3300009551 Bacteria 1110
152 Ga0105238_11671007 3300009551 Bacteria 668
153 Ga0099796_10070733 3300010159 Bacteria 1259
154 Ga0105239_10001550 3300010375 Bacteria 30371
155 Ga0105239_10143367 3300010375 Bacteria 2663
156 Ga0105239_10596174 3300010375 Bacteria 1260
157 Ga0105239_11616508 3300010375 Bacteria 749
158 Ga0105246_10417862 3300011119 Bacteria 1118
159 Ga0105246_11424020 3300011119 Bacteria 648
160 Ga0157321_1005149 3300012487 Bacteria 848
161 Ga0157347_1013325 3300012502 Bacteria 897
162 Ga0157339_1001407 3300012505 Bacteria 1468
163 Ga0157327_1002381 3300012512 Bacteria 1291
164 Ga0157338_1002315 3300012515 Bacteria 1488
165 Ga0157369_10006059 3300013105 Bacteria 14033
166 Ga0157374_10351102 3300013296 Bacteria 1465
167 Ga0157374_10966956 3300013296 Bacteria 870
168 Ga0157378_10331170 3300013297 Bacteria 1482
169 Ga0157378_10960703 3300013297 Bacteria 887
170 Ga0163162_10147098 3300013306 Bacteria 2473
171 Ga0163162_10175987 3300013306 Bacteria 2265
172 Ga0163162_10527821 3300013306 Bacteria 1310
173 Ga0157372_10293457 3300013307 Bacteria 1891
174 Ga0157375_10348844 3300013308 Bacteria 1646
175 Ga0163163_10558397 3300014325 Bacteria 1207
176 Ga0163163_11081720 3300014325 Bacteria 865
177 Ga0157380_10860238 3300014326 Bacteria 929
178 Ga0157379_10006642 3300014968 Bacteria 9980
179 Ga0157379_10734467 3300014968 Bacteria 929
180 Ga0157376_10014414 3300014969 Bacteria 5934
181 Ga0213872_10077981 3300021361 Bacteria 1489
182 Ga0213876_10114856 3300021384 Bacteria 1429
183 Ga0213871_10016854 3300021441 Bacteria 1767
184 Ga0209758_1000628 3300025297 Bacteria 54130
185 Ga0209758_1037101 3300025297 Bacteria 1889
186 Ga0207426_1041783 3300025302 Bacteria 1419
187 Ga0207656_10282497 3300025321 Bacteria 819
188 Ga0207653_10144950 3300025885 Bacteria 871
189 Ga0207688_10140376 3300025901 Bacteria 1422
190 Ga0207680_10358013 3300025903 Bacteria 1026
191 Ga0207645_10021004 3300025907 Bacteria 4264
192 Ga0207705_10180002 3300025909 Bacteria 1595
193 Ga0207654_10058002 3300025911 Bacteria 2252
194 Ga0207707_10009349 3300025912 Bacteria 8502
195 Ga0207707_10037100 3300025912 Bacteria 4259
196 Ga0207707_10989265 3300025912 Bacteria 691
197 Ga0207695_10447428 3300025913 Bacteria 1175
198 Ga0207695_10724050 3300025913 Bacteria 875
199 Ga0207695_11257288 3300025913 Bacteria 621
200 Ga0207671_10075226 3300025914 Bacteria 2525
201 Ga0207671_10413670 3300025914 Bacteria 1073
202 Ga0207671_10686101 3300025914 Bacteria 815
203 Ga0207693_10052638 3300025915 Bacteria 3193
204 Ga0207693_10375485 3300025915 Bacteria 1112
205 Ga0207693_10903811 3300025915 Bacteria 677
206 Ga0207660_10072675 3300025917 Bacteria 2505
207 Ga0207662_10027784 3300025918 Bacteria 3267
208 Ga0207657_10006914 3300025919 Bacteria 11704
209 Ga0207657_10014412 3300025919 Bacteria 7721
210 Ga0207652_10059292 3300025921 Bacteria 3299
211 Ga0207652_10558200 3300025921 Bacteria 1029
212 Ga0207681_10034997 3300025923 Bacteria 3307
213 Ga0207681_10366734 3300025923 Bacteria 1156
214 Ga0207681_11458756 3300025923 Bacteria 574
215 Ga0207659_10315727 3300025926 Bacteria 1288
216 Ga0207659_11098806 3300025926 Bacteria 684
217 Ga0207664_10521571 3300025929 Bacteria 1065
218 Ga0207644_10682455 3300025931 Bacteria 856
219 Ga0207686_10531371 3300025934 Bacteria 917
220 Ga0207709_10202184 3300025935 Bacteria 1420
221 Ga0207709_10262542 3300025935 Bacteria 1267
222 Ga0207670_10009110 3300025936 Bacteria 5640
223 Ga0207670_10049143 3300025936 Bacteria 2820
224 Ga0207670_10643928 3300025936 Bacteria 873
225 Ga0207669_10110930 3300025937 Bacteria 1838
226 Ga0207669_10548517 3300025937 Bacteria 932
227 Ga0207704_10001901 3300025938 Bacteria 9356
228 Ga0207704_10276827 3300025938 Bacteria 1273
229 Ga0207665_10095691 3300025939 Bacteria 2064
230 Ga0207665_10177613 3300025939 Bacteria 1541
231 Ga0207691_10031610 3300025940 Bacteria 4938
232 Ga0207691_10053009 3300025940 Bacteria 3704
233 Ga0207691_10075557 3300025940 Bacteria 3038
234 Ga0207711_10002162 3300025941 Bacteria 17680
235 Ga0207711_10018267 3300025941 Bacteria 5829
236 Ga0207661_10420540 3300025944 Bacteria 1214
237 Ga0207679_10964215 3300025945 Bacteria 781
238 Ga0207667_10249290 3300025949 Bacteria 1816
239 Ga0207667_10427675 3300025949 Bacteria 1347
240 Ga0207651_10297997 3300025960 Bacteria 1340
241 Ga0207651_10369857 3300025960 Bacteria 1212
242 Ga0207668_10021325 3300025972 Bacteria 4131
243 Ga0207668_10439026 3300025972 Bacteria 1111
244 Ga0207668_10687864 3300025972 Bacteria 898
245 Ga0207658_10053056 3300025986 Bacteria 2994
246 Ga0207658_10772815 3300025986 Bacteria 871
247 Ga0207658_11295361 3300025986 Bacteria 666
248 Ga0207703_10089229 3300026035 Bacteria 2589
249 Ga0207678_10005453 3300026067 Bacteria 11377
250 Ga0207678_10184880 3300026067 Bacteria 1780
251 Ga0207702_10192476 3300026078 Bacteria 1885
252 Ga0207641_10698296 3300026088 Unclassified 999
253 Ga0207648_10076441 3300026089 Bacteria 2919
254 Ga0207676_10018138 3300026095 Bacteria 5112
255 Ga0207676_10964632 3300026095 Bacteria 839
256 Ga0207674_10491834 3300026116 Bacteria 1185
257 Ga0207675_100572420 3300026118 Bacteria 1130
258 Ga0207683_10040765 3300026121 Bacteria 4054
259 Ga0207683_10082698 3300026121 Bacteria 2853
260 Ga0207698_11201416 3300026142 Bacteria 772
261 Ga0209995_1041075 3300027471 Bacteria 781
262 Ga0209588_1043860 3300027671 Bacteria 1445
263 Ga0209813_10036435 3300027866 Bacteria 1478
264 Ga0207428_10000617 3300027907 Bacteria 42011
265 Ga0207428_10137888 3300027907 Bacteria 1864
266 Ga0268266_10034328 3300028379 Bacteria 4314
267 Ga0268266_10038487 3300028379 Bacteria 4071
268 Ga0268266_10334429 3300028379 Bacteria 1420
269 Ga0268266_10830652 3300028379 Bacteria 893
270 Ga0268265_10530172 3300028380 Bacteria 1115
271 Ga0268265_10574841 3300028380 Bacteria 1073
272 Ga0268265_10899658 3300028380 Bacteria 869
273 Ga0268265_11098486 3300028380 Bacteria 789
274 Ga0268264_11112946 3300028381 Bacteria 798
275 Ga0268264_11404224 3300028381 Bacteria 709
276 Ga0265338_10334602 3300028800 Bacteria 1093
277 Ga0265332_10000641 3300031238 Bacteria 22774
278 Ga0265340_10004511 3300031247 Bacteria 7768
279 Ga0265331_10037460 3300031250 Bacteria 2374
280 Ga0307408_100677508 3300031548 Bacteria 925
281 Ga0265342_10000282 3300031712 Bacteria 57360
282 Ga0307412_10230941 3300031911 Bacteria 1425
283 Ga0373930_0000008 3300034816 Bacteria 20461
284 Ga0373948_0032258 3300034817 Bacteria 1061
285 Ga0373950_0000251 3300034818 Bacteria 6803
286 Ga0373958_0001093 3300034819 Bacteria 3575
287 Ga0373938_0002210 3300034957 Bacteria 3122
288 Ga0373938_0103131 3300034957 Bacteria 719
289 Ga0373926_0252489 3300035083 Bacteria 684
290 Ga0373928_0000087 3300035084 Bacteria 16099
291 Ga0373928_0087199 3300035084 Bacteria 796
292 Ga0373929_0001483 3300035085 Bacteria 4466
293 Ga0373940_0001880 3300035088 Bacteria 3945
294 Ga0373944_0118878 3300035089 Bacteria 909
295 Ga0373949_0001679 3300035090 Bacteria 6169
296 Ga0373951_0000363 3300035091 Bacteria 13633
297 Ga0373952_0001136 3300035092 Bacteria 4859
298 Ga0373923_0003601 3300035111 Bacteria 4994
299 Ga0373923_0200087 3300035111 Bacteria 923
300 Ga0373932_0000746 3300035112 Bacteria 9717
301 Ga0373936_0000762 3300035113 Bacteria 11306
302 Ga0373936_0057658 3300035113 Bacteria 1580
303 Ga0373936_0059258 3300035113 Bacteria 1560
304 Ga0373939_0000794 3300035114 Bacteria 7784
305 Ga0373939_0006840 3300035114 Bacteria 2757
306 Ga0373941_0000224 3300035115 Bacteria 10933
307 Ga0373945_0005484 3300035116 Bacteria 4061
308 Ga0373945_0136832 3300035116 Bacteria 985
309 Ga0373953_0133104 3300035117 Bacteria 1061
310 Ga0373954_0000950 3300035118 Bacteria 11319
311 Ga0373956_0090608 3300035119 Bacteria 1410
312 Ga0373960_0001070 3300035121 Bacteria 5904
313 Ga0373960_0017827 3300035121 Bacteria 1844
314 Ga0373943_0050661 3300035170 Bacteria 2041
315 Ga0373943_0117518 3300035170 Bacteria 1410
316 Ga0373943_0175543 3300035170 Bacteria 1175
317 Ga0373946_0001576 3300035171 Bacteria 7942
318 Ga0373955_0000473 3300035172 Bacteria 16929
319 Ga0373955_0069750 3300035172 Bacteria 1962
320 Ga0373955_0147741 3300035172 Bacteria 1382
321 Ga0373955_0699492 3300035172 Bacteria 622
322 Ga0373961_0012313 3300035241 Bacteria 2139
323 Ga0373962_0004934 3300035242 Bacteria 3225
324 Ga0373924_0003209 3300035410 Bacteria 5590
325 Ga0373924_0151686 3300035410 Bacteria 1014
326 Ga0373924_0328122 3300035410 Bacteria 681
327 Ga0373931_0068439 3300035691 Bacteria 1932
328 Ga0373931_0148429 3300035691 Bacteria 1364
329 Ga0373935_0000096 3300035692 Bacteria 39013
330 Ga0373935_0077453 3300035692 Bacteria 2155
331 Ga0373935_0245566 3300035692 Bacteria 1251
332 Ga0373935_0453464 3300035692 Bacteria 927
333 Ga0373935_0683792 3300035692 Bacteria 754
334 Ga0373927_0063388 3300035695 Bacteria 2391
335 Ga0373927_0232452 3300035695 Bacteria 1211
336 Ga0373927_0568747 3300035695 Bacteria 749
337 Ga0373927_0636432 3300035695 Bacteria 705
338 Ga0373933_0189355 3300035724 Bacteria 1314
339 Ga0373933_0276455 3300035724 Bacteria 1085
340 Ga0373933_0439060 3300035724 Bacteria 853
341 Ga0373947_0000081 3300035725 Bacteria 48660
342 Ga0373947_0032148 3300035725 Bacteria 3091
343 Ga0373947_0698047 3300035725 Bacteria 692
344 Ga0373937_0000515 3300036401 Bacteria 34939
345 Ga0373937_0038458 3300036401 Bacteria 4359
346 Ga0373937_0047767 3300036401 Bacteria 3917
347 Ga0373937_0197216 3300036401 Bacteria 1892
348 Ga0373937_0663084 3300036401 Bacteria 989
349 Ga0373937_0726604 3300036401 Bacteria 940
350 Ga0373937_0750103 3300036401 Bacteria 924
351 Ga0316582_0012895 3300036647 Bacteria 4685
352 Ga0316584_0034649 3300036712 Bacteria 3742
353 Ga0373925_0000011 3300037068 Bacteria 209840
354 Ga0373925_0022050 3300037068 Bacteria 4642
355 Ga0373925_0155467 3300037068 Bacteria 1798
356 Ga0373925_0472278 3300037068 Bacteria 1028
357 Ga0373925_1385464 3300037068 Bacteria 576
358 Ga0395899_0010421 3300037312 Bacteria 7123
359 Ga0395900_0198343 3300037418 Bacteria 2032
360 Ga0316581_0012869 3300037588 Bacteria 2363
361 Ga0436364_0473443 3300037853 Bacteria 988
362 Ga0395901_0005716 3300038443 Bacteria 12591
363 Ga0242420_021997 3300038996 Bacteria 1145
364 Ga0436365_0599441 3300039437 Bacteria 1290
365 Ga0436365_0671084 3300039437 Bacteria 7886
366 Ga0436360_0162963 3300039438 Bacteria 996
367 Ga0436360_0284301 3300039438 Bacteria 5209
368 Ga0436360_0348412 3300039438 Bacteria 1394
369 Ga0436360_0355072 3300039438 Bacteria 946
370 Ga0436360_0467137 3300039438 Bacteria 621
371 Ga0436360_0529284 3300039438 Bacteria 7177
372 Ga0436360_1182028 3300039438 Bacteria 952
373 Ga0436361_0173801 3300039447 Bacteria 2528
374 Ga0436361_0638520 3300039447 Bacteria 1424
375 Ga0436361_0866137 3300039447 Bacteria 1086
376 Ga0439453_0018592 3300041408 Bacteria 1230
377 Ga0439466_0062005 3300041411 Bacteria 1203
378 Ga0439435_0035723 3300042436 Bacteria 1371
379 Ga0451577_0047744 3300042876 Bacteria 3827
380 Ga0451577_0049365 3300042876 Bacteria 3758
381 Ga0453684_0299156 3300044712 Bacteria 1829
382 Ga0451576_0000056 3300045051 Bacteria 303398
383 Ga0451576_0066897 3300045051 Bacteria 3740
384 Ga0495592_0000493 3300046454 Bacteria 28774
385 Ga0495592_0089479 3300046454 Bacteria 2211
386 Ga0495592_0685343 3300046454 Bacteria 618
387 Ga0495603_0127665 3300046455 Bacteria 1482
388 Ga0495629_0009691 3300046459 Bacteria 7036
389 Ga0495651_0000364 3300046462 Bacteria 34831
390 Ga0495651_0100558 3300046462 Bacteria 2153
391 Ga0495653_0000398 3300046463 Bacteria 34931
392 Ga0495580_0098850 3300046472 Bacteria 2030
393 Ga0495639_0360206 3300046475 Bacteria 731
394 Ga0495662_0002976 3300046476 Bacteria 8551
395 Ga0495662_0215126 3300046476 Bacteria 947
396 Ga0495664_0000019 3300046477 Bacteria 153012
397 Ga0495664_0205980 3300046477 Bacteria 1192
398 Ga0495608_0000026 3300046511 Bacteria 156234
399 Ga0495618_0000015 3300046514 Bacteria 152478
400 Ga0495618_0143961 3300046514 Bacteria 1524
401 Ga0495618_0203411 3300046514 Bacteria 1253
402 Ga0495628_0000006 3300046516 Bacteria 306606
403 Ga0495630_0041469 3300046517 Bacteria 3437
404 Ga0495630_0491786 3300046517 Bacteria 941
405 Ga0495666_0195923 3300046526 Bacteria 930
406 Ga0495652_0000030 3300046529 Bacteria 152921
407 Ga0495665_0213740 3300046531 Bacteria 998
408 Ga0495640_0000246 3300046533 Bacteria 35995
409 Ga0495640_0026370 3300046533 Bacteria 4201
410 Ga0495640_0074059 3300046533 Bacteria 2278
411 Ga0495640_0123612 3300046533 Bacteria 1680
412 Ga0495586_0303140 3300046535 Bacteria 915
413 Ga0495587_0000021 3300046536 Bacteria 152895
414 Ga0495587_0307957 3300046536 Bacteria 885
415 Ga0495587_0316710 3300046536 Bacteria 871
416 Ga0495645_0000001 3300046543 Bacteria 657910
417 Ga0495645_0236860 3300046543 Bacteria 1220
418 Ga0495622_0114263 3300046557 Bacteria 1235
419 Ga0495667_0000027 3300046559 Bacteria 152535
420 Ga0495634_0000008 3300046642 Bacteria 163983
421 Ga0495634_0110209 3300046642 Bacteria 1770
422 Ga0495635_0000028 3300046663 Bacteria 121669
423 Ga0495635_0347361 3300046663 Bacteria 990
424 Ga0495657_0003276 3300046675 Bacteria 13293
425 Ga0495657_0342651 3300046675 Bacteria 886
426 Ga0495599_0000232 3300046678 Bacteria 34997
427 Ga0495599_0333320 3300046678 Bacteria 912
428 Ga0495623_0000448 3300046679 Bacteria 27077
429 Ga0495646_0000148 3300046680 Bacteria 35382
430 Ga0495647_0298673 3300046681 Bacteria 726
431 Ga0495658_0022212 3300046683 Bacteria 3353
432 Ga0495613_0016339 3300046689 Bacteria 5531
433 Ga0495613_0409183 3300046689 Bacteria 924
434 Ga0495613_0430720 3300046689 Bacteria 896
435 Ga0495624_0016986 3300046690 Bacteria 4891
436 Ga0495624_0821381 3300046690 Bacteria 549
437 Ga0495600_0000195 3300046809 Bacteria 35017
438 Ga0495600_0078969 3300046809 Bacteria 2149
439 Ga0495600_0256686 3300046809 Bacteria 1111
440 Ga0495581_0021665 3300047315 Bacteria 3723
441 Ga0495604_0000002 3300047317 Bacteria 530904
442 Ga0495674_0000004 3300047319 Bacteria 531855
443 Ga0495674_0021189 3300047319 Bacteria 6013
444 Ga0495674_0120182 3300047319 Bacteria 2220
445 Ga0495674_0196276 3300047319 Bacteria 1676
446 Ga0495674_0273635 3300047319 Bacteria 1385
447 Ga0495680_0003584 3300047322 Bacteria 15203
448 Ga0495680_0058661 3300047322 Bacteria 2974
449 Ga0495675_0000351 3300047444 Bacteria 32308
450 Ga0495684_0000004 3300047471 Bacteria 307093
451 Ga0495684_0218078 3300047471 Bacteria 1400
452 Ga0495684_0550892 3300047471 Bacteria 785
453 Ga0495593_0007024 3300047673 Bacteria 6602
454 Ga0495602_0000001 3300048088 Bacteria 510904
455 Ga0495602_0038308 3300048088 Bacteria 4435
456 Ga0495602_0123484 3300048088 Bacteria 2079
457 Ga0495602_0230317 3300048088 Bacteria 1393
458 Ga0495614_0254624 3300048089 Bacteria 804
459 Ga0496100_0513340 3300048903 Bacteria 924
460 Ga0496101_0073275 3300048904 Bacteria 2515
461 Ga0496102_0096276 3300048905 Bacteria 2744
462 Ga0496104_0032753 3300048907 Bacteria 4838
463 Ga0496104_0151891 3300048907 Bacteria 2222
464 Ga0496104_0199591 3300048907 Bacteria 1912
465 Ga0496104_0250177 3300048907 Bacteria 1685
466 Ga0496105_0016668 3300048908 Bacteria 5869
467 Ga0496105_0020406 3300048908 Bacteria 5354
468 Ga0496105_0416923 3300048908 Bacteria 1063
469 Ga0496106_0042085 3300048909 Bacteria 3425
470 Ga0496106_0523949 3300048909 Bacteria 952
471 Ga0496106_0568989 3300048909 Bacteria 909
472 Ga0496106_0694010 3300048909 Unclassified 811
473 Ga0496107_0027934 3300048910 Bacteria 4008
474 Ga0496108_0037502 3300048911 Bacteria 4037
475 Ga0496108_0062234 3300048911 Bacteria 3143
476 Ga0496109_0009555 3300048912 Bacteria 8267
477 Ga0496109_0039477 3300048912 Bacteria 4273
478 Ga0496109_0373040 3300048912 Bacteria 1348
479 Ga0496109_0490711 3300048912 Bacteria 1159
480 Ga0496109_1382678 3300048912 Bacteria 639
481 Ga0496110_0128921 3300048913 Bacteria 2283
482 Ga0496111_0253461 3300048914 Bacteria 1306
483 Ga0496112_0004838 3300048915 Bacteria 11498
484 Ga0496112_0041520 3300048915 Bacteria 4502
485 Ga0496112_1443687 3300048915 Bacteria 602
486 Ga0496113_0079583 3300048916 Bacteria 2509
487 Ga0496113_0116180 3300048916 Bacteria 2088
488 Ga0496113_0177151 3300048916 Bacteria 1690
489 Ga0496114_0158981 3300048917 Bacteria 1963
490 Ga0496114_0841534 3300048917 Bacteria 797
491 Ga0496114_0858066 3300048917 Bacteria 788
492 Ga0496115_0023701 3300048918 Bacteria 4763
493 Ga0496115_0181690 3300048918 Bacteria 1739
494 Ga0496115_0283082 3300048918 Bacteria 1361
495 Ga0496126_0031359 3300048929 Bacteria 5024
496 Ga0501032_0785685 3300049569 Bacteria 602
497 Ga0501033_0007435 3300049570 Bacteria 8532
498 Ga0501034_0017302 3300049571 Bacteria 7396
499 Ga0501036_0014064 3300049572 Bacteria 6650
500 Ga0501037_0002025 3300049573 Bacteria 14680
501 Ga0501038_0010354 3300049574 Bacteria 8532
502 Ga0501039_0002776 3300049575 Bacteria 13069
503 Ga0501042_0144029 3300049578 Bacteria 1718
504 Ga0501043_0054818 3300049579 Bacteria 3131
505 Ga0501046_0014727 3300049580 Bacteria 6582
506 Ga0501046_0566197 3300049580 Bacteria 809
507 Ga0501046_0758556 3300049580 Bacteria 681
508 Ga0501047_0022270 3300049581 Bacteria 6087
509 Ga0501048_0018796 3300049582 Bacteria 5080
510 Ga0501068_0008094 3300049584 Bacteria 5834
511 Ga0501069_0041048 3300049585 Bacteria 2556
512 Ga0501070_0106904 3300049586 Bacteria 2312
513 Ga0501071_0010906 3300049587 Bacteria 6099
514 Ga0501072_0506868 3300049588 Bacteria 954
515 Ga0501073_0006120 3300049589 Bacteria 8980
516 Ga0501074_0003316 3300049590 Bacteria 11391
517 Ga0501074_0940091 3300049590 Bacteria 608
518 Ga0501076_0283849 3300049592 Bacteria 1356
519 Ga0501076_0834567 3300049592 Bacteria 760
520 Ga0501076_1100818 3300049592 Bacteria 654
521 Ga0501079_0025134 3300049741 Bacteria 4569
522 Ga0501079_0434901 3300049741 Bacteria 1030
523 Ga0501080_0009127 3300049742 Bacteria 9027
524 Ga0501080_0655279 3300049742 Bacteria 929
525 Ga0501081_0970304 3300049743 Bacteria 642
526 Ga0501083_0003903 3300049744 Bacteria 10472
527 Ga0501083_0009945 3300049744 Bacteria 6715
528 Ga0501083_0017002 3300049744 Bacteria 5079
529 Ga0501083_0652089 3300049744 Bacteria 685
530 Ga0501035_0018689 3300049822 Bacteria 6383
531 Ga0501044_0000212 3300049823 Bacteria 73807
532 Ga0501045_0011177 3300049824 Bacteria 6294
533 nmdc:mga03683_20229_c1 3300050489 Bacteria 2552
534 nmdc:mga03683_23186_c1 3300050489 Bacteria 2415
535 nmdc:mga03683_57227_c1 3300050489 Bacteria 1641
536 nmdc:mga03683_77595_c1 3300050489 Bacteria 1429
537 nmdc:mga03683_96481_c1 3300050489 Bacteria 1295
538 nmdc:mga03n38_93750_c1 3300050490 Bacteria 1435
539 nmdc:mga00v17_27998_c1 3300050491 Bacteria 3296
540 nmdc:mga00v17_537840_c1 3300050491 Bacteria 756
541 nmdc:mga00v17_627880_c1 3300050491 Bacteria 692
542 nmdc:mga0yw44_157330_c1 3300050492 Bacteria 1486
543 nmdc:mga0yw44_58008_c1 3300050492 Bacteria 2364
544 nmdc:mga0yw44_741642_c1 3300050492 Bacteria 667
545 nmdc:mga0k408_56700_c1 3300050493 Bacteria 2274
546 nmdc:mga06z11_132440_c1 3300050494 Bacteria 1401
547 nmdc:mga06z11_31445_c1 3300050494 Bacteria 2579
548 nmdc:mga06z11_485157_c1 3300050494 Bacteria 748
549 nmdc:mga04h51_102752_c1 3300050495 Bacteria 1044
550 nmdc:mga07m45_321514_c1 3300050496 Bacteria 899
551 nmdc:mga07m45_49532_c1 3300050496 Bacteria 2365
552 nmdc:mga07m45_69401_c1 3300050496 Bacteria 2004
553 nmdc:mga06r32_1633706_c1 3300050510 Bacteria 582
554 nmdc:mga06r32_27746_c1 3300050510 Bacteria 5292
555 nmdc:mga06r32_486317_c1 3300050510 Bacteria 1212
556 nmdc:mga08y16_2044_c1 3300050511 Bacteria 20676
557 nmdc:mga08y16_34615_c1 3300050511 Bacteria 5306
558 nmdc:mga0n895_1428043_c1 3300050512 Bacteria 660
559 nmdc:mga0n895_15857_c1 3300050512 Bacteria 6891
560 nmdc:mga0n895_41004_c1 3300050512 Bacteria 4499
561 nmdc:mga0n895_749134_c1 3300050512 Bacteria 970
562 nmdc:mga0rr50_169369_c1 3300050513 Bacteria 1778
563 nmdc:mga0rr50_198465_c1 3300050513 Bacteria 1648
564 nmdc:mga0rr50_32948_c1 3300050513 Bacteria 3697
565 nmdc:mga0rr50_3950_c1 3300050513 Bacteria 8624
566 nmdc:mga0rr50_712287_c1 3300050513 Bacteria 857
567 nmdc:mga08x19_167341_c1 3300050514 Bacteria 1495
568 nmdc:mga08x19_173119_c1 3300050514 Bacteria 1471
569 nmdc:mga08x19_60864_c1 3300050514 Bacteria 2446
570 nmdc:mga08x19_8963_c1 3300050514 Bacteria 5970
571 nmdc:mga0a205_141340_c1 3300050515 Bacteria 2307
572 nmdc:mga0a205_603175_c1 3300050515 Bacteria 951
573 Ga0495601_0000023 3300053077 Bacteria 140141
574 Ga0495601_0000164 3300053077 Bacteria 35933
575 Ga0495601_0037132 3300053077 Bacteria 3045
576 Ga0495601_0115758 3300053077 Bacteria 1738
577 Ga0495612_0000005 3300053078 Bacteria 286943
578 Ga0495655_0003498 3300053083 Bacteria 2598
579 Ga0495595_0000013 3300053084 Bacteria 160811
580 Ga0495595_0168802 3300053084 Bacteria 1082
581 Ga0495619_0000003 3300053085 Bacteria 515784
582 Ga0495619_0006012 3300053085 Bacteria 7689
583 Ga0495619_0076214 3300053085 Bacteria 2251
584 Ga0495619_0189377 3300053085 Bacteria 1424
585 Ga0495619_0493759 3300053085 Bacteria 842
586 Ga0495619_0584517 3300053085 Bacteria 765
587 Ga0500641_0001359 3300053096 Bacteria 8700
588 Ga0500641_0127910 3300053096 Bacteria 1096
589 Ga0500562_055008 3300053108 Bacteria 1067
590 Ga0500595_010357 3300053119 Bacteria 3709
591 Ga0500642_0002277 3300053130 Bacteria 5602
592 Ga0501084_0101125 3300054114 Bacteria 2421
593 Ga0501084_0202167 3300054114 Bacteria 1676
594 Ga0501084_0779803 3300054114 Bacteria 805
595 Ga0501082_0012786 3300060353 Bacteria 7214
596 Ga0501082_0046964 3300060353 Bacteria 3721
597 Ga0501082_0141673 3300060353 Bacteria 2087
598 Ga0501082_0347714 3300060353 Bacteria 1292
599 Ga0436361_0525705
600 2214772973
601 ARSoilYngRDRAFT_c00271
602 ARcpr5yngRDRAFT_c000144
603 ARSoilOldRDRAFT_c000251
604 ARCol0yngRDRAFT_1000173
605 JGI25404J52841_10001640
606 Ga0065716_1001617
607 Ga0065704_10014826
608 Ga0070658_10042629
609 Ga0070683_100135213
610 Ga0070683_100741943
611 Ga0070690_100523942
612 Ga0070690_100540983
613 Ga0068869_101202756
614 Ga0070666_10388823
615 Ga0070680_100081266
616 Ga0070682_100023469
617 Ga0070660_100011386
618 Ga0070660_100040763
619 Ga0070689_100012758
620 Ga0070689_100680566
621 Ga0070687_100601139
622 Ga0070668_100052214
623 Ga0070669_100025035
624 Ga0070669_100212667
625 Ga0070669_101072474
626 Ga0070675_100193576
627 Ga0070675_100546476
628 Ga0070675_100555137
629 Ga0070674_100047420
630 Ga0070673_100592147
631 Ga0070688_100097846
632 Ga0070688_100107368
633 Ga0070667_100028081
634 Ga0070667_100273204
635 Ga0070709_11182060
636 Ga0070714_100368120
637 Ga0070713_100284837
638 Ga0070711_100426220
639 Ga0070705_100203246
640 Ga0070663_100014235
641 Ga0070663_100081651
642 Ga0070678_100048719
643 Ga0070678_100433656
644 Ga0070662_100768524
645 Ga0070681_10026770
646 Ga0070681_10060026
647 Ga0070681_11196550
648 Ga0068867_100004534
649 Ga0070685_10015350
650 Ga0070685_10875760
651 Ga0070679_100190779
652 Ga0070684_100451359
653 Ga0070697_100080048
654 Ga0070697_100383978
655 Ga0070697_100567508
656 Ga0068853_100059919
657 Ga0070672_100107080
658 Ga0070672_100114792
659 Ga0070686_100106041
660 Ga0070696_100000817
661 Ga0070693_100374229
662 Ga0070665_100038838
663 Ga0070665_100190808
664 Ga0068855_100136549
665 Ga0068854_100048208
666 Ga0068856_100238555
667 Ga0068852_100146859
668 Ga0068852_101433170
669 Ga0068859_100023458
670 Ga0068859_100367563
671 Ga0068864_100024729
672 Ga0068864_101052129
673 Ga0068864_101491575
674 Ga0068861_100757215
675 Ga0068863_100213110
676 Ga0068858_100452125
677 Ga0068860_100075810
678 Ga0068860_100260287
679 Ga0068862_100614674
680 Ga0068862_101113190
681 Ga0081455_10002722
682 Ga0081538_10140186
683 Ga0081540_1000140
684 Ga0081539_10027712
685 Ga0075365_10148438
686 Ga0075368_10066212
687 Ga0075363_100129228
688 Ga0075363_100415477
689 Ga0075364_10156435
690 Ga0070716_100097946
691 Ga0070716_100255139
692 Ga0070716_100481128
693 Ga0070712_100417191
694 Ga0070712_100662745
695 Ga0075362_10015104
696 Ga0075362_10098367
697 Ga0075362_10162195
698 Ga0075362_10271320
699 Ga0075362_10353772
700 Ga0075367_10162300
701 Ga0075367_10236007
702 Ga0075367_10418033
703 Ga0075369_10051730
704 Ga0075369_10150656
705 Ga0075366_10145992
706 Ga0097621_100770346
707 Ga0075370_10146961
708 Ga0075370_10353526
709 Ga0068871_100686959
710 Ga0075430_100075097
711 Ga0075433_10119436
712 Ga0075433_10847623
713 Ga0075434_100000519
714 Ga0075434_100160574
715 Ga0068865_100472118
716 Ga0068865_101090232
717 Ga0075436_100041538
718 Ga0075436_100244833
719 Ga0097620_100023457
720 Ga0097620_100367553
721 Ga0075435_100004741
722 Ga0075435_100065102
723 Ga0075435_100093857
724 Ga0075435_100192522
725 Ga0075435_100481043
726 Ga0075435_100505545
727 Ga0099794_10025507
728 Ga0099795_10045144
729 Ga0099795_10498745
730 Ga0105240_10013204
731 Ga0105240_10020195
732 Ga0105240_10428922
733 Ga0105240_11262889
734 Ga0111539_10012295
735 Ga0111539_10015669
736 Ga0105245_10001061
737 Ga0105245_10626162
738 Ga0105243_10101445
739 Ga0105243_10260632
740 Ga0105243_10475689
741 Ga0105241_10082987
742 Ga0105242_10794087
743 Ga0105248_10010127
744 Ga0105248_10099607
745 Ga0105248_11321747
746 Ga0105248_11508556
747 Ga0105237_10083693
748 Ga0105237_10560154
749 Ga0105238_10598417
750 Ga0105238_11671007
751 Ga0099796_10070733
752 Ga0105239_10001550
753 Ga0105239_10143367
754 Ga0105239_10596174
755 Ga0105239_11616508
756 Ga0105246_10417862
757 Ga0105246_11424020
758 Ga0157321_1005149
759 Ga0157347_1013325
760 Ga0157339_1001407
761 Ga0157327_1002381
762 Ga0157338_1002315
763 Ga0157369_10006059
764 Ga0157374_10351102
765 Ga0157374_10966956
766 Ga0157378_10331170
767 Ga0157378_10960703
768 Ga0163162_10147098
769 Ga0163162_10175987
770 Ga0163162_10527821
771 Ga0157372_10293457
772 Ga0157375_10348844
773 Ga0163163_10558397
774 Ga0163163_11081720
775 Ga0157380_10860238
776 Ga0157379_10006642
777 Ga0157379_10734467
778 Ga0157376_10014414
779 Ga0213872_10077981
780 Ga0213876_10114856
781 Ga0213871_10016854
782 Ga0209758_1000628
783 Ga0209758_1037101
784 Ga0207426_1041783
785 Ga0207656_10282497
786 Ga0207653_10144950
787 Ga0207688_10140376
788 Ga0207680_10358013
789 Ga0207645_10021004
790 Ga0207705_10180002
791 Ga0207654_10058002
792 Ga0207707_10009349
793 Ga0207707_10037100
794 Ga0207707_10989265
795 Ga0207695_10447428
796 Ga0207695_10724050
797 Ga0207695_11257288
798 Ga0207671_10075226
799 Ga0207671_10413670
800 Ga0207671_10686101
801 Ga0207693_10052638
802 Ga0207693_10375485
803 Ga0207693_10903811
804 Ga0207660_10072675
805 Ga0207662_10027784
806 Ga0207657_10006914
807 Ga0207657_10014412
808 Ga0207652_10059292
809 Ga0207652_10558200
810 Ga0207681_10034997
811 Ga0207681_10366734
812 Ga0207681_11458756
813 Ga0207659_10315727
814 Ga0207659_11098806
815 Ga0207664_10521571
816 Ga0207644_10682455
817 Ga0207686_10531371
818 Ga0207709_10202184
819 Ga0207709_10262542
820 Ga0207670_10009110
821 Ga0207670_10049143
822 Ga0207670_10643928
823 Ga0207669_10110930
824 Ga0207669_10548517
825 Ga0207704_10001901
826 Ga0207704_10276827
827 Ga0207665_10095691
828 Ga0207665_10177613
829 Ga0207691_10031610
830 Ga0207691_10053009
831 Ga0207691_10075557
832 Ga0207711_10002162
833 Ga0207711_10018267
834 Ga0207661_10420540
835 Ga0207679_10964215
836 Ga0207667_10249290
837 Ga0207667_10427675
838 Ga0207651_10297997
839 Ga0207651_10369857
840 Ga0207668_10021325
841 Ga0207668_10439026
842 Ga0207668_10687864
843 Ga0207658_10053056
844 Ga0207658_10772815
845 Ga0207658_11295361
846 Ga0207703_10089229
847 Ga0207678_10005453
848 Ga0207678_10184880
849 Ga0207702_10192476
850 Ga0207641_10698296
851 Ga0207648_10076441
852 Ga0207676_10018138
853 Ga0207676_10964632
854 Ga0207674_10491834
855 Ga0207675_100572420
856 Ga0207683_10040765
857 Ga0207683_10082698
858 Ga0207698_11201416
859 Ga0209995_1041075
860 Ga0209588_1043860
861 Ga0209813_10036435
862 Ga0207428_10000617
863 Ga0207428_10137888
864 Ga0268266_10034328
865 Ga0268266_10038487
866 Ga0268266_10334429
867 Ga0268266_10830652
868 Ga0268265_10530172
869 Ga0268265_10574841
870 Ga0268265_10899658
871 Ga0268265_11098486
872 Ga0268264_11112946
873 Ga0268264_11404224
874 Ga0265338_10334602
875 Ga0265332_10000641
876 Ga0265340_10004511
877 Ga0265331_10037460
878 Ga0307408_100677508
879 Ga0265342_10000282
880 Ga0307412_10230941
881 Ga0373930_0000008
882 Ga0373948_0032258
883 Ga0373950_0000251
884 Ga0373958_0001093
885 Ga0373938_0002210
886 Ga0373938_0103131
887 Ga0373926_0252489
888 Ga0373928_0000087
889 Ga0373928_0087199
890 Ga0373929_0001483
891 Ga0373940_0001880
892 Ga0373944_0118878
893 Ga0373949_0001679
894 Ga0373951_0000363
895 Ga0373952_0001136
896 Ga0373923_0003601
897 Ga0373923_0200087
898 Ga0373932_0000746
899 Ga0373936_0000762
900 Ga0373936_0057658
901 Ga0373936_0059258
902 Ga0373939_0000794
903 Ga0373939_0006840
904 Ga0373941_0000224
905 Ga0373945_0005484
906 Ga0373945_0136832
907 Ga0373953_0133104
908 Ga0373954_0000950
909 Ga0373956_0090608
910 Ga0373960_0001070
911 Ga0373960_0017827
912 Ga0373943_0050661
913 Ga0373943_0117518
914 Ga0373943_0175543
915 Ga0373946_0001576
916 Ga0373955_0000473
917 Ga0373955_0069750
918 Ga0373955_0147741
919 Ga0373955_0699492
920 Ga0373961_0012313
921 Ga0373962_0004934
922 Ga0373924_0003209
923 Ga0373924_0151686
924 Ga0373924_0328122
925 Ga0373931_0068439
926 Ga0373931_0148429
927 Ga0373935_0000096
928 Ga0373935_0077453
929 Ga0373935_0245566
930 Ga0373935_0453464
931 Ga0373935_0683792
932 Ga0373927_0063388
933 Ga0373927_0232452
934 Ga0373927_0568747
935 Ga0373927_0636432
936 Ga0373933_0189355
937 Ga0373933_0276455
938 Ga0373933_0439060
939 Ga0373947_0000081
940 Ga0373947_0032148
941 Ga0373947_0698047
942 Ga0373937_0000515
943 Ga0373937_0038458
944 Ga0373937_0047767
945 Ga0373937_0197216
946 Ga0373937_0663084
947 Ga0373937_0726604
948 Ga0373937_0750103
949 Ga0316582_0012895
950 Ga0316584_0034649
951 Ga0373925_0000011
952 Ga0373925_0022050
953 Ga0373925_0155467
954 Ga0373925_0472278
955 Ga0373925_1385464
956 Ga0395899_0010421
957 Ga0395900_0198343
958 Ga0316581_0012869
959 Ga0436364_0473443
960 Ga0395901_0005716
961 Ga0242420_021997
962 Ga0436365_0599441
963 Ga0436365_0671084
964 Ga0436360_0162963
965 Ga0436360_0284301
966 Ga0436360_0348412
967 Ga0436360_0355072
968 Ga0436360_0467137
969 Ga0436360_0529284
970 Ga0436360_1182028
971 Ga0436361_0173801
972 Ga0436361_0638520
973 Ga0436361_0866137
974 Ga0439453_0018592
975 Ga0439466_0062005
976 Ga0439435_0035723
977 Ga0451577_0047744
978 Ga0451577_0049365
979 Ga0453684_0299156
980 Ga0451576_0000056
981 Ga0451576_0066897
982 Ga0495592_0000493
983 Ga0495592_0089479
984 Ga0495592_0685343
985 Ga0495603_0127665
986 Ga0495629_0009691
987 Ga0495651_0000364
988 Ga0495651_0100558
989 Ga0495653_0000398
990 Ga0495580_0098850
991 Ga0495639_0360206
992 Ga0495662_0002976
993 Ga0495662_0215126
994 Ga0495664_0000019
995 Ga0495664_0205980
996 Ga0495608_0000026
997 Ga0495618_0000015
998 Ga0495618_0143961
999 Ga0495618_0203411
1000 Ga0495628_0000006
1001 Ga0495630_0041469
1002 Ga0495630_0491786
1003 Ga0495666_0195923
1004 Ga0495652_0000030
1005 Ga0495665_0213740
1006 Ga0495640_0000246
1007 Ga0495640_0026370
1008 Ga0495640_0074059
1009 Ga0495640_0123612
1010 Ga0495586_0303140
1011 Ga0495587_0000021
1012 Ga0495587_0307957
1013 Ga0495587_0316710
1014 Ga0495645_0000001
1015 Ga0495645_0236860
1016 Ga0495622_0114263
1017 Ga0495667_0000027
1018 Ga0495634_0000008
1019 Ga0495634_0110209
1020 Ga0495635_0000028
1021 Ga0495635_0347361
1022 Ga0495657_0003276
1023 Ga0495657_0342651
1024 Ga0495599_0000232
1025 Ga0495599_0333320
1026 Ga0495623_0000448
1027 Ga0495646_0000148
1028 Ga0495647_0298673
1029 Ga0495658_0022212
1030 Ga0495613_0016339
1031 Ga0495613_0409183
1032 Ga0495613_0430720
1033 Ga0495624_0016986
1034 Ga0495624_0821381
1035 Ga0495600_0000195
1036 Ga0495600_0078969
1037 Ga0495600_0256686
1038 Ga0495581_0021665
1039 Ga0495604_0000002
1040 Ga0495674_0000004
1041 Ga0495674_0021189
1042 Ga0495674_0120182
1043 Ga0495674_0196276
1044 Ga0495674_0273635
1045 Ga0495680_0003584
1046 Ga0495680_0058661
1047 Ga0495675_0000351
1048 Ga0495684_0000004
1049 Ga0495684_0218078
1050 Ga0495684_0550892
1051 Ga0495593_0007024
1052 Ga0495602_0000001
1053 Ga0495602_0038308
1054 Ga0495602_0123484
1055 Ga0495602_0230317
1056 Ga0495614_0254624
1057 Ga0496100_0513340
1058 Ga0496101_0073275
1059 Ga0496102_0096276
1060 Ga0496104_0032753
1061 Ga0496104_0151891
1062 Ga0496104_0199591
1063 Ga0496104_0250177
1064 Ga0496105_0016668
1065 Ga0496105_0020406
1066 Ga0496105_0416923
1067 Ga0496106_0042085
1068 Ga0496106_0523949
1069 Ga0496106_0568989
1070 Ga0496106_0694010
1071 Ga0496107_0027934
1072 Ga0496108_0037502
1073 Ga0496108_0062234
1074 Ga0496109_0009555
1075 Ga0496109_0039477
1076 Ga0496109_0373040
1077 Ga0496109_0490711
1078 Ga0496109_1382678
1079 Ga0496110_0128921
1080 Ga0496111_0253461
1081 Ga0496112_0004838
1082 Ga0496112_0041520
1083 Ga0496112_1443687
1084 Ga0496113_0079583
1085 Ga0496113_0116180
1086 Ga0496113_0177151
1087 Ga0496114_0158981
1088 Ga0496114_0841534
1089 Ga0496114_0858066
1090 Ga0496115_0023701
1091 Ga0496115_0181690
1092 Ga0496115_0283082
1093 Ga0496126_0031359
1094 Ga0501032_0785685
1095 Ga0501033_0007435
1096 Ga0501034_0017302
1097 Ga0501036_0014064
1098 Ga0501037_0002025
1099 Ga0501038_0010354
1100 Ga0501039_0002776
1101 Ga0501042_0144029
1102 Ga0501043_0054818
1103 Ga0501046_0014727
1104 Ga0501046_0566197
1105 Ga0501046_0758556
1106 Ga0501047_0022270
1107 Ga0501048_0018796
1108 Ga0501068_0008094
1109 Ga0501069_0041048
1110 Ga0501070_0106904
1111 Ga0501071_0010906
1112 Ga0501072_0506868
1113 Ga0501073_0006120
1114 Ga0501074_0003316
1115 Ga0501074_0940091
1116 Ga0501076_0283849
1117 Ga0501076_0834567
1118 Ga0501076_1100818
1119 Ga0501079_0025134
1120 Ga0501079_0434901
1121 Ga0501080_0009127
1122 Ga0501080_0655279
1123 Ga0501081_0970304
1124 Ga0501083_0003903
1125 Ga0501083_0009945
1126 Ga0501083_0017002
1127 Ga0501083_0652089
1128 Ga0501035_0018689
1129 Ga0501044_0000212
1130 Ga0501045_0011177
1131 nmdc:mga03683_20229_c1
1132 nmdc:mga03683_23186_c1
1133 nmdc:mga03683_57227_c1
1134 nmdc:mga03683_77595_c1
1135 nmdc:mga03683_96481_c1
1136 nmdc:mga03n38_93750_c1
1137 nmdc:mga00v17_27998_c1
1138 nmdc:mga00v17_537840_c1
1139 nmdc:mga00v17_627880_c1
1140 nmdc:mga0yw44_157330_c1
1141 nmdc:mga0yw44_58008_c1
1142 nmdc:mga0yw44_741642_c1
1143 nmdc:mga0k408_56700_c1
1144 nmdc:mga06z11_132440_c1
1145 nmdc:mga06z11_31445_c1
1146 nmdc:mga06z11_485157_c1
1147 nmdc:mga04h51_102752_c1
1148 nmdc:mga07m45_321514_c1
1149 nmdc:mga07m45_49532_c1
1150 nmdc:mga07m45_69401_c1
1151 nmdc:mga06r32_1633706_c1
1152 nmdc:mga06r32_27746_c1
1153 nmdc:mga06r32_486317_c1
1154 nmdc:mga08y16_2044_c1
1155 nmdc:mga08y16_34615_c1
1156 nmdc:mga0n895_1428043_c1
1157 nmdc:mga0n895_15857_c1
1158 nmdc:mga0n895_41004_c1
1159 nmdc:mga0n895_749134_c1
1160 nmdc:mga0rr50_169369_c1
1161 nmdc:mga0rr50_198465_c1
1162 nmdc:mga0rr50_32948_c1
1163 nmdc:mga0rr50_3950_c1
1164 nmdc:mga0rr50_712287_c1
1165 nmdc:mga08x19_167341_c1
1166 nmdc:mga08x19_173119_c1
1167 nmdc:mga08x19_60864_c1
1168 nmdc:mga08x19_8963_c1
1169 nmdc:mga0a205_141340_c1
1170 nmdc:mga0a205_603175_c1
1171 Ga0495601_0000023
1172 Ga0495601_0000164
1173 Ga0495601_0037132
1174 Ga0495601_0115758
1175 Ga0495612_0000005
1176 Ga0495655_0003498
1177 Ga0495595_0000013
1178 Ga0495595_0168802
1179 Ga0495619_0000003
1180 Ga0495619_0006012
1181 Ga0495619_0076214
1182 Ga0495619_0189377
1183 Ga0495619_0493759
1184 Ga0495619_0584517
1185 Ga0500641_0001359
1186 Ga0500641_0127910
1187 Ga0500562_055008
1188 Ga0500595_010357
1189 Ga0500642_0002277
1190 Ga0501084_0101125
1191 Ga0501084_0202167
1192 Ga0501084_0779803
1193 Ga0501082_0012786
1194 Ga0501082_0046964
1195 Ga0501082_0141673
1196 Ga0501082_0347714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

54

121

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cfw-assembly1.cif.gz_J cryoem structure of a respiratory membrane-bound hydrogenase 0.9217 38 168
7nz1-assembly1.cif.gz_B respiratory complex i from escherichia coli - focused refinement of cytoplasmic arm 0.8999 49 170
6zjn-assembly1.cif.gz_6 respiratory complex i from thermus thermophilus, nadh dataset, minor state 0.8613 32 168
7q5y-assembly4.cif.gz_X structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus 0.8555 42 171
7awt-assembly1.cif.gz_B e. coli nadh quinone oxidoreductase hydrophilic arm 0.8498 43 172
ID Description Score Start End Superfamily
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9335 44 168 3.40.50.12280
6cfwJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9217 38 168 3.40.50.12280
af_Q57936_1_148_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.911 37 169 3.40.50.12280
af_P77668_14_171_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.881 28 172 3.40.50.12280
6cfwJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8425 38 168 3.40.50.12280
ID Description Score Start End GO Terms
AF-A0A522X701-F1-model_v4 NADH-quinone oxidoreductase subunit NuoB (EC 1.6.5.11) 0.97 18 171 GO:0016491
GO:0051539
AF-A0A7C6H4C7-F1-model_v4 NADH-quinone oxidoreductase subunit B family protein 0.961 25 168 GO:0051539
AF-A0A2C6MH50-F1-model_v4 NADH dehydrogenase 0.9595 22 168 GO:0051539
AF-A0A2T2X5G5-F1-model_v4 4Fe-4S ferredoxin 0.9542 43 168 GO:0051539
AF-A0A850SI50-F1-model_v4 NADH-quinone oxidoreductase subunit NuoB (EC 1.6.5.11) 0.9525 29 170 GO:0008137
GO:0048038
GO:0051539

Map