F467809

General Info

Members Datasets Scaffolds Average Seq Length
598 262 1196 217

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0267596|Ga0466960_0267596_10_642
Length 210
Sequence MSTHPDVPKFMTMGPVLPVMVIPSLDQAVPLAEALIKGGIKVLEITLRTDCALASIEAIAKAFPEAVVGAGTVLSPDDAKAAADHGARFAVSPGLTEKLAGQTSLPLLPGVATSSEVMRALEWGFTHLKFFPAVPAGGVPALKGIGGPLAAAKFCPTGGIDQKNAADFLALPNVLCVGGSWVAPAAAMNEGRWDEVTRLAAEAVATFGEK

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
74 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
158 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
162 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
163 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
245 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
246 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
247 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
248 2739367700 Dyella sp. YR388 Isolate Unclassified
249 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
250 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
251 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
252 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
253 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
254 2919085039 Luteibacter sp. 1214 Isolate Unclassified
255 2919404418 Luteibacter sp. 3190 Isolate Unclassified
256 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
257 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
258 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
259 2928963466 Dyella japonica 1073 Isolate Unclassified
260 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
261 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
262 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 1.51
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.54
Nodule 0
Rhizoplane 2.84
Rhizosphere 73.41
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0267596 3300044901 Bacteria 954
2 JGI24741J21665_1000527 3300001915 Bacteria 11685
3 JGI24741J21665_1022688 3300001915 Bacteria 972
4 JGI24740J21852_10000025 3300001979 Bacteria 49637
5 JGI24737J22298_10006940 3300001990 Bacteria 3842
6 JGI24735J21928_10040825 3300002067 Bacteria 1353
7 JGI24735J21928_10082934 3300002067 Bacteria 919
8 JGI24738J21930_10001231 3300002075 Bacteria 7193
9 JGI25156J39149_1000251 3300002705 Bacteria 36996
10 JGI25156J39149_1014166 3300002705 Bacteria 1657
11 JGI25156J39149_1018401 3300002705 Bacteria 1292
12 JGI25156J39149_1027051 3300002705 Bacteria 901
13 JGI25162J39368_1001521 3300002737 Bacteria 12007
14 JGI25162J39368_1001749 3300002737 Bacteria 10397
15 JGI25162J39368_1002711 3300002737 Bacteria 6403
16 JGI25157J39369_1000288 3300002741 Bacteria 36723
17 JGI25157J39369_1001779 3300002741 Bacteria 7002
18 JGI25157J39369_1015349 3300002741 Bacteria 943
19 JGI25157J39369_1018853 3300002741 Bacteria 830
20 JGI25164J39214_1000105 3300002772 Bacteria 81222
21 JGI25164J39214_1000473 3300002772 Bacteria 19954
22 JGI25164J39214_1002318 3300002772 Bacteria 3043
23 JGI25165J46597_1000155 3300003214 Bacteria 109705
24 JGI25165J46597_1001813 3300003214 Bacteria 8988
25 JGI25153J46596_10019219 3300003215 Bacteria 2624
26 rootH1_10026611 3300003316 Bacteria 8739
27 rootH2_10077984 3300003320 Bacteria 2339
28 rootH2_10094176 3300003320 Bacteria 1132
29 Ga0006562J51391_1011837 3300003578 Bacteria 15120
30 Ga0006562J51391_1011840 3300003578 Bacteria 13440
31 Ga0055539_1001091 3300003752 Bacteria 5681
32 Ga0055527_1000037 3300003760 Bacteria 124590
33 Ga0055535_1000059 3300003761 Bacteria 124595
34 Ga0055535_1000211 3300003761 Bacteria 61694
35 Ga0055535_1000367 3300003761 Bacteria 43516
36 Ga0055542_1000086 3300003762 Bacteria 124594
37 Ga0055542_1000117 3300003762 Bacteria 105560
38 Ga0055542_1000288 3300003762 Bacteria 56246
39 Ga0055542_1001245 3300003762 Bacteria 14078
40 Ga0055529_1000212 3300003763 Bacteria 76463
41 Ga0055529_1000307 3300003763 Bacteria 56246
42 Ga0055524_1011072 3300003775 Bacteria 3547
43 Ga0055531_10014643 3300003794 Bacteria 3517
44 Ga0065165_1000343 3300005262 Bacteria 76286
45 Ga0065165_1002670 3300005262 Bacteria 14404
46 Ga0065715_10108317 3300005293 Bacteria 2708
47 Ga0070658_10652884 3300005327 Bacteria 913
48 Ga0070658_10744417 3300005327 Bacteria 851
49 Ga0070683_100610066 3300005329 Bacteria 1044
50 Ga0070670_100041832 3300005331 Bacteria 3938
51 Ga0070680_100000150 3300005336 Bacteria 43056
52 Ga0070680_100000429 3300005336 Bacteria 28658
53 Ga0070682_100001327 3300005337 Bacteria 13996
54 Ga0070682_100059551 3300005337 Bacteria 2412
55 Ga0070682_100062357 3300005337 Bacteria 2361
56 Ga0070660_100271390 3300005339 Bacteria 1386
57 Ga0070689_100003901 3300005340 Bacteria 9997
58 Ga0070691_10001084 3300005341 Bacteria 11278
59 Ga0070691_10013828 3300005341 Bacteria 3704
60 Ga0070661_100028277 3300005344 Bacteria 4043
61 Ga0070661_100042592 3300005344 Bacteria 3314
62 Ga0070661_100104058 3300005344 Bacteria 2115
63 Ga0070661_100237190 3300005344 Bacteria 1403
64 Ga0070661_100297415 3300005344 Bacteria 1256
65 Ga0070692_10003181 3300005345 Bacteria 6601
66 Ga0070692_10004779 3300005345 Bacteria 5691
67 Ga0070692_10020287 3300005345 Bacteria 3222
68 Ga0070692_10083100 3300005345 Bacteria 1728
69 Ga0070659_100021824 3300005366 Bacteria 4882
70 Ga0070659_100039724 3300005366 Bacteria 3675
71 Ga0070659_100233473 3300005366 Bacteria 1520
72 Ga0070714_100000055 3300005435 Bacteria 103321
73 Ga0070714_100031357 3300005435 Bacteria 4434
74 Ga0070713_100022992 3300005436 Bacteria 4828
75 Ga0070694_100031712 3300005444 Bacteria 3466
76 Ga0070694_100054655 3300005444 Bacteria 2705
77 Ga0070694_100556418 3300005444 Bacteria 919
78 Ga0070708_100451751 3300005445 Bacteria 1212
79 Ga0070663_100014903 3300005455 Bacteria 5000
80 Ga0070663_100087968 3300005455 Bacteria 2296
81 Ga0070663_100090252 3300005455 Bacteria 2269
82 Ga0070663_100412323 3300005455 Bacteria 1106
83 Ga0070662_100037955 3300005457 Bacteria 3419
84 Ga0070681_10000082 3300005458 Bacteria 71460
85 Ga0070681_10028349 3300005458 Bacteria 5628
86 Ga0070707_100024364 3300005468 Bacteria 5731
87 Ga0070707_100046258 3300005468 Bacteria 4164
88 Ga0070698_100120638 3300005471 Bacteria 2582
89 Ga0070699_100067925 3300005518 Bacteria 3095
90 Ga0070699_100156450 3300005518 Bacteria 2017
91 Ga0070679_100000166 3300005530 Bacteria 53376
92 Ga0070679_100160539 3300005530 Bacteria 2222
93 Ga0070679_100221378 3300005530 Bacteria 1853
94 Ga0070679_100312160 3300005530 Bacteria 1522
95 Ga0070679_100726816 3300005530 Bacteria 936
96 Ga0070684_100028303 3300005535 Bacteria 4739
97 Ga0068853_100024814 3300005539 Bacteria 5029
98 Ga0068853_100099567 3300005539 Bacteria 2568
99 Ga0068853_100229071 3300005539 Bacteria 1699
100 Ga0070696_100005544 3300005546 Bacteria 8428
101 Ga0070696_100037550 3300005546 Bacteria 3342
102 Ga0070696_100144196 3300005546 Bacteria 1743
103 Ga0070693_100000680 3300005547 Bacteria 15077
104 Ga0070693_100024242 3300005547 Bacteria 3252
105 Ga0068855_100005319 3300005563 Bacteria 15724
106 Ga0068855_100010220 3300005563 Bacteria 11312
107 Ga0068855_100065211 3300005563 Bacteria 4246
108 Ga0068855_100076467 3300005563 Bacteria 3885
109 Ga0068855_100093997 3300005563 Bacteria 3457
110 Ga0070664_100028080 3300005564 Bacteria 4679
111 Ga0070664_100146272 3300005564 Bacteria 2084
112 Ga0068857_100000241 3300005577 Bacteria 36495
113 Ga0068857_100118246 3300005577 Bacteria 2385
114 Ga0068857_100213871 3300005577 Bacteria 1759
115 Ga0068854_100002387 3300005578 Bacteria 11594
116 Ga0068854_100004331 3300005578 Bacteria 8945
117 Ga0068854_100025011 3300005578 Bacteria 4096
118 Ga0068854_100026609 3300005578 Bacteria 3978
119 Ga0068854_100065003 3300005578 Bacteria 2651
120 Ga0068856_100004861 3300005614 Bacteria 13307
121 Ga0068856_100029617 3300005614 Bacteria 5348
122 Ga0068856_100149214 3300005614 Bacteria 2346
123 Ga0068856_100747158 3300005614 Bacteria 998
124 Ga0068856_100906937 3300005614 Bacteria 900
125 Ga0068852_100002474 3300005616 Bacteria 12720
126 Ga0068852_100003494 3300005616 Bacteria 10989
127 Ga0068852_100071762 3300005616 Bacteria 3041
128 Ga0068851_10002340 3300005834 Bacteria 8342
129 Ga0068851_10048466 3300005834 Bacteria 2153
130 Ga0068860_100154588 3300005843 Bacteria 2210
131 Ga0068862_100140428 3300005844 Bacteria 2143
132 Ga0075368_10037529 3300006042 Bacteria 1895
133 Ga0070712_100223857 3300006175 Bacteria 1491
134 Ga0075362_10004645 3300006177 Bacteria 4951
135 Ga0075367_10007898 3300006178 Bacteria 5480
136 Ga0075369_10075689 3300006186 Bacteria 1487
137 Ga0075366_10042527 3300006195 Bacteria 2690
138 Ga0105251_10000057 3300009011 Bacteria 104178
139 Ga0105250_10000784 3300009092 Bacteria 19143
140 Ga0105250_10238491 3300009092 Bacteria 775
141 Ga0105240_10000197 3300009093 Bacteria 123221
142 Ga0105240_10000199 3300009093 Bacteria 122191
143 Ga0105240_10009428 3300009093 Bacteria 13818
144 Ga0105240_10011697 3300009093 Bacteria 12194
145 Ga0105240_10033751 3300009093 Bacteria 6607
146 Ga0105240_10215520 3300009093 Bacteria 2240
147 Ga0105240_10248726 3300009093 Bacteria 2057
148 Ga0105240_10381873 3300009093 Bacteria 1591
149 Ga0105240_10505039 3300009093 Bacteria 1344
150 Ga0105237_10000212 3300009545 Bacteria 82465
151 Ga0105237_10041079 3300009545 Bacteria 4665
152 Ga0105237_10127409 3300009545 Bacteria 2540
153 Ga0105237_10809385 3300009545 Unclassified 944
154 Ga0105238_10001210 3300009551 Bacteria 25999
155 Ga0105238_10032581 3300009551 Bacteria 5303
156 Ga0105238_10034811 3300009551 Bacteria 5122
157 Ga0105238_10057703 3300009551 Bacteria 3892
158 Ga0105238_10082334 3300009551 Bacteria 3208
159 Ga0105238_10248642 3300009551 Bacteria 1756
160 Ga0105249_10583659 3300009553 Bacteria 1171
161 Ga0105249_10630309 3300009553 Bacteria 1129
162 Ga0105239_10000110 3300010375 Bacteria 115508
163 Ga0105239_10006357 3300010375 Bacteria 13728
164 Ga0105239_10030736 3300010375 Bacteria 5906
165 Ga0105239_10051528 3300010375 Bacteria 4512
166 Ga0157314_1000004 3300012500 Bacteria 31907
167 Ga0157347_1010097 3300012502 Bacteria 986
168 Ga0157373_10016625 3300013100 Bacteria 5363
169 Ga0157373_10126035 3300013100 Bacteria 1801
170 Ga0157373_10141615 3300013100 Bacteria 1691
171 Ga0157371_10000389 3300013102 Bacteria 55195
172 Ga0157371_10013629 3300013102 Bacteria 6169
173 Ga0157371_10022058 3300013102 Bacteria 4671
174 Ga0157371_10032896 3300013102 Bacteria 3729
175 Ga0157371_10116409 3300013102 Bacteria 1899
176 Ga0157370_10006195 3300013104 Bacteria 13264
177 Ga0157370_10014378 3300013104 Bacteria 8093
178 Ga0157370_10027198 3300013104 Bacteria 5640
179 Ga0157370_10036755 3300013104 Bacteria 4751
180 Ga0157370_10056630 3300013104 Bacteria 3731
181 Ga0157370_10062095 3300013104 Bacteria 3544
182 Ga0157370_10151877 3300013104 Bacteria 2155
183 Ga0157370_10479238 3300013104 Bacteria 1143
184 Ga0157369_10018809 3300013105 Bacteria 7743
185 Ga0157369_10086649 3300013105 Bacteria 3345
186 Ga0157369_10115360 3300013105 Bacteria 2852
187 Ga0157369_10501388 3300013105 Bacteria 1256
188 Ga0157369_10599455 3300013105 Bacteria 1137
189 Ga0157372_10009339 3300013307 Bacteria 10436
190 Ga0157372_10045284 3300013307 Bacteria 4879
191 Ga0157372_10082206 3300013307 Bacteria 3646
192 Ga0157372_10117003 3300013307 Bacteria 3057
193 Ga0157372_10139505 3300013307 Bacteria 2792
194 Ga0157372_10146151 3300013307 Bacteria 2726
195 Ga0182008_10006961 3300014497 Bacteria 6274
196 Ga0182008_10026987 3300014497 Bacteria 2911
197 Ga0182008_10108975 3300014497 Bacteria 1371
198 Ga0157376_10009453 3300014969 Bacteria 7080
199 Ga0182006_1000200 3300015261 Bacteria 61593
200 Ga0182005_1000019 3300015265 Bacteria 296232
201 Ga0182005_1010470 3300015265 Bacteria 2667
202 Ga0206356_10062314 3300020070 Bacteria 11613
203 Ga0206356_10716613 3300020070 Bacteria 1266
204 Ga0206356_11169423 3300020070 Bacteria 1362
205 Ga0206354_10316166 3300020081 Bacteria 15956
206 Ga0206354_10904655 3300020081 Bacteria 2415
207 Ga0206353_10400454 3300020082 Bacteria 3523
208 Ga0206353_11125515 3300020082 Bacteria 12423
209 Ga0213872_10000051 3300021361 Bacteria 107261
210 Ga0209435_105297 3300025206 Bacteria 1446
211 Ga0209566_102664 3300025225 Bacteria 3139
212 Ga0209674_100134 3300025226 Bacteria 114123
213 Ga0209674_100400 3300025226 Bacteria 21810
214 Ga0209674_101350 3300025226 Bacteria 6689
215 Ga0209674_108288 3300025226 Bacteria 1242
216 Ga0209672_100008 3300025228 Bacteria 946876
217 Ga0209672_100074 3300025228 Bacteria 159792
218 Ga0209672_100501 3300025228 Bacteria 21740
219 Ga0209672_100537 3300025228 Bacteria 20579
220 Ga0207427_100044 3300025231 Bacteria 242623
221 Ga0207427_100045 3300025231 Bacteria 241857
222 Ga0207427_100132 3300025231 Bacteria 92962
223 Ga0207427_102913 3300025231 Bacteria 4036
224 Ga0209437_100005 3300025233 Bacteria 1071596
225 Ga0209437_100118 3300025233 Bacteria 207534
226 Ga0209437_100140 3300025233 Bacteria 171696
227 Ga0209437_100365 3300025233 Bacteria 49166
228 Ga0209437_101582 3300025233 Bacteria 5270
229 Ga0209258_100004 3300025242 Bacteria 1376422
230 Ga0209258_100008 3300025242 Bacteria 1009355
231 Ga0209258_100148 3300025242 Bacteria 162743
232 Ga0209258_100229 3300025242 Bacteria 105671
233 Ga0209258_102228 3300025242 Bacteria 5252
234 Ga0209646_1001015 3300025246 Bacteria 8565
235 Ga0209646_1001085 3300025246 Bacteria 8123
236 Ga0209026_1000010 3300025250 Bacteria 511986
237 Ga0209026_1000061 3300025250 Bacteria 219572
238 Ga0209026_1000088 3300025250 Bacteria 177275
239 Ga0209026_1000743 3300025250 Bacteria 18648
240 Ga0209026_1003877 3300025250 Bacteria 4709
241 Ga0209148_1000002 3300025254 Bacteria 2399500
242 Ga0209148_1000041 3300025254 Bacteria 469323
243 Ga0209148_1000138 3300025254 Bacteria 167277
244 Ga0209148_1000191 3300025254 Bacteria 115847
245 Ga0209148_1000626 3300025254 Bacteria 31299
246 Ga0209759_1000259 3300025256 Bacteria 76638
247 Ga0209759_1000364 3300025256 Bacteria 57603
248 Ga0209759_1000853 3300025256 Bacteria 23718
249 Ga0209759_1023526 3300025256 Bacteria 1354
250 Ga0209759_1028944 3300025256 Bacteria 1119
251 Ga0209759_1028966 3300025256 Bacteria 1118
252 Ga0209129_1006347 3300025258 Bacteria 3855
253 Ga0209129_1006836 3300025258 Bacteria 3562
254 Ga0209233_1000011 3300025261 Bacteria 1071611
255 Ga0209233_1000046 3300025261 Bacteria 470971
256 Ga0209233_1000116 3300025261 Bacteria 241857
257 Ga0209455_1000007 3300025272 Bacteria 1157983
258 Ga0209455_1000111 3300025272 Bacteria 188820
259 Ga0209455_1000124 3300025272 Bacteria 167073
260 Ga0209455_1017039 3300025272 Bacteria 1540
261 Ga0209758_1001002 3300025297 Bacteria 37583
262 Ga0209758_1012534 3300025297 Bacteria 4730
263 Ga0209256_1000053 3300025299 Bacteria 298731
264 Ga0209256_1082780 3300025299 Bacteria 697
265 Ga0209257_1000372 3300025304 Bacteria 90110
266 Ga0207656_10000893 3300025321 Bacteria 9732
267 Ga0207696_1000112 3300025711 Bacteria 154384
268 Ga0207655_1024444 3300025728 Bacteria 2961
269 Ga0207713_1000014 3300025735 Bacteria 432450
270 Ga0207647_10000992 3300025904 Bacteria 22010
271 Ga0207647_10001759 3300025904 Bacteria 16623
272 Ga0207647_10002879 3300025904 Bacteria 12965
273 Ga0207705_10000029 3300025909 Bacteria 239897
274 Ga0207705_10000287 3300025909 Bacteria 47411
275 Ga0207705_10001167 3300025909 Bacteria 21405
276 Ga0207705_10061270 3300025909 Bacteria 2718
277 Ga0207705_10491543 3300025909 Bacteria 953
278 Ga0207684_10023526 3300025910 Bacteria 5261
279 Ga0207654_10119412 3300025911 Bacteria 1653
280 Ga0207707_10000042 3300025912 Bacteria 126050
281 Ga0207707_10000049 3300025912 Bacteria 117480
282 Ga0207707_10000593 3300025912 Bacteria 36498
283 Ga0207707_10001410 3300025912 Bacteria 22263
284 Ga0207707_10016123 3300025912 Bacteria 6516
285 Ga0207707_10365520 3300025912 Bacteria 1242
286 Ga0207695_10000207 3300025913 Bacteria 160390
287 Ga0207695_10001055 3300025913 Bacteria 48329
288 Ga0207695_10001939 3300025913 Bacteria 32146
289 Ga0207695_10002014 3300025913 Bacteria 31286
290 Ga0207695_10002579 3300025913 Bacteria 26579
291 Ga0207695_10006926 3300025913 Bacteria 14565
292 Ga0207695_10056970 3300025913 Bacteria 4063
293 Ga0207695_10061185 3300025913 Bacteria 3893
294 Ga0207695_10339334 3300025913 Bacteria 1390
295 Ga0207671_10000009 3300025914 Bacteria 724862
296 Ga0207671_10121423 3300025914 Bacteria 1997
297 Ga0207693_10031845 3300025915 Bacteria 4166
298 Ga0207663_10132001 3300025916 Bacteria 1727
299 Ga0207660_10000206 3300025917 Bacteria 37525
300 Ga0207660_10007024 3300025917 Bacteria 7291
301 Ga0207660_10060647 3300025917 Bacteria 2721
302 Ga0207660_10379896 3300025917 Bacteria 1135
303 Ga0207657_10000915 3300025919 Bacteria 31217
304 Ga0207657_10002290 3300025919 Bacteria 20745
305 Ga0207657_10037493 3300025919 Bacteria 4327
306 Ga0207657_10132155 3300025919 Bacteria 2045
307 Ga0207649_10000219 3300025920 Bacteria 46974
308 Ga0207649_10152140 3300025920 Bacteria 1595
309 Ga0207652_10000014 3300025921 Bacteria 196569
310 Ga0207652_10000099 3300025921 Bacteria 93755
311 Ga0207652_10000530 3300025921 Bacteria 38813
312 Ga0207652_10001294 3300025921 Bacteria 22263
313 Ga0207652_10299460 3300025921 Bacteria 1451
314 Ga0207652_10315163 3300025921 Bacteria 1412
315 Ga0207652_10333290 3300025921 Bacteria 1370
316 Ga0207646_10050463 3300025922 Bacteria 3723
317 Ga0207646_10069117 3300025922 Bacteria 3155
318 Ga0207694_10015820 3300025924 Bacteria 5692
319 Ga0207694_10046714 3300025924 Bacteria 3347
320 Ga0207694_10049776 3300025924 Bacteria 3243
321 Ga0207694_10109688 3300025924 Bacteria 2194
322 Ga0207694_10156175 3300025924 Bacteria 1840
323 Ga0207694_10169738 3300025924 Bacteria 1766
324 Ga0207650_10021670 3300025925 Bacteria 4542
325 Ga0207659_10174796 3300025926 Bacteria 1697
326 Ga0207664_10000030 3300025929 Bacteria 179903
327 Ga0207664_10006402 3300025929 Bacteria 8099
328 Ga0207664_10027244 3300025929 Bacteria 4330
329 Ga0207690_10000096 3300025932 Bacteria 72704
330 Ga0207690_10000645 3300025932 Bacteria 22382
331 Ga0207690_10001295 3300025932 Bacteria 15794
332 Ga0207690_10027620 3300025932 Bacteria 3588
333 Ga0207690_10030825 3300025932 Bacteria 3425
334 Ga0207690_10639399 3300025932 Bacteria 871
335 Ga0207706_10041666 3300025933 Bacteria 4070
336 Ga0207706_10253489 3300025933 Bacteria 1537
337 Ga0207706_10446857 3300025933 Bacteria 1118
338 Ga0207670_10001961 3300025936 Bacteria 10795
339 Ga0207661_10003106 3300025944 Bacteria 11494
340 Ga0207661_10303880 3300025944 Bacteria 1431
341 Ga0207679_10007358 3300025945 Bacteria 6981
342 Ga0207679_10083942 3300025945 Bacteria 2443
343 Ga0207667_10000063 3300025949 Bacteria 188281
344 Ga0207667_10000075 3300025949 Bacteria 169836
345 Ga0207667_10000632 3300025949 Bacteria 45561
346 Ga0207667_10001316 3300025949 Bacteria 31151
347 Ga0207667_10002093 3300025949 Bacteria 25017
348 Ga0207667_10003345 3300025949 Bacteria 19793
349 Ga0207667_10079470 3300025949 Bacteria 3399
350 Ga0207667_10136269 3300025949 Bacteria 2528
351 Ga0207667_10163526 3300025949 Bacteria 2288
352 Ga0207667_10197523 3300025949 Bacteria 2064
353 Ga0207712_10366075 3300025961 Bacteria 1202
354 Ga0207640_10000688 3300025981 Bacteria 19683
355 Ga0207640_10001363 3300025981 Bacteria 13207
356 Ga0207640_10010165 3300025981 Bacteria 5290
357 Ga0207640_10010866 3300025981 Bacteria 5139
358 Ga0207640_10104222 3300025981 Bacteria 1996
359 Ga0207658_11080817 3300025986 Bacteria 733
360 Ga0207703_10127666 3300026035 Bacteria 2192
361 Ga0207639_10000382 3300026041 Bacteria 30487
362 Ga0207639_10002253 3300026041 Bacteria 12968
363 Ga0207639_10089690 3300026041 Bacteria 2457
364 Ga0207639_10213894 3300026041 Bacteria 1661
365 Ga0207639_10252911 3300026041 Bacteria 1537
366 Ga0207678_10001323 3300026067 Bacteria 22871
367 Ga0207678_10001825 3300026067 Bacteria 19516
368 Ga0207678_10042229 3300026067 Bacteria 3952
369 Ga0207678_10077646 3300026067 Bacteria 2844
370 Ga0207678_10133021 3300026067 Bacteria 2122
371 Ga0207702_10001267 3300026078 Bacteria 25378
372 Ga0207702_10007397 3300026078 Bacteria 9374
373 Ga0207702_10335499 3300026078 Bacteria 1443
374 Ga0207702_10417920 3300026078 Bacteria 1296
375 Ga0207702_10767968 3300026078 Bacteria 952
376 Ga0207674_10000123 3300026116 Bacteria 89456
377 Ga0207674_10004272 3300026116 Bacteria 17227
378 Ga0207674_10026119 3300026116 Bacteria 6212
379 Ga0207674_10043271 3300026116 Bacteria 4644
380 Ga0207674_10062532 3300026116 Bacteria 3760
381 Ga0207698_10000152 3300026142 Bacteria 44402
382 Ga0207698_10020563 3300026142 Bacteria 4546
383 Ga0209813_10030995 3300027866 Bacteria 1576
384 Ga0307408_100218658 3300031548 Bacteria 1553
385 Ga0307514_10002825 3300031649 Bacteria 17404
386 Ga0307405_10895387 3300031731 Bacteria 750
387 Ga0307412_10000340 3300031911 Bacteria 29344
388 Ga0307409_100638772 3300031995 Bacteria 1057
389 Ga0373925_0215671 3300037068 Bacteria 1530
390 Ga0395899_0000051 3300037312 Bacteria 222620
391 Ga0395899_0020714 3300037312 Bacteria 4986
392 Ga0395899_0072369 3300037312 Bacteria 2522
393 Ga0395899_0436214 3300037312 Bacteria 860
394 Ga0395900_0000047 3300037418 Bacteria 230039
395 Ga0395900_0001206 3300037418 Bacteria 31971
396 Ga0395900_0003339 3300037418 Bacteria 17336
397 Ga0395900_0246871 3300037418 Bacteria 1788
398 Ga0395900_1049944 3300037418 Bacteria 733
399 Ga0395898_0000045 3300037466 Bacteria 297127
400 Ga0395898_0000090 3300037466 Bacteria 237876
401 Ga0395898_0009199 3300037466 Bacteria 10399
402 Ga0395898_0015954 3300037466 Bacteria 7695
403 Ga0395905_0001415 3300037471 Bacteria 28991
404 Ga0395905_0014901 3300037471 Bacteria 7418
405 Ga0395905_0036614 3300037471 Bacteria 4609
406 Ga0395901_0002065 3300038443 Bacteria 20602
407 Ga0395901_0057457 3300038443 Bacteria 4046
408 Ga0395901_0110379 3300038443 Bacteria 2887
409 Ga0395901_0130255 3300038443 Bacteria 2643
410 Ga0395901_0154620 3300038443 Bacteria 2409
411 Ga0395901_0201435 3300038443 Bacteria 2086
412 Ga0395901_0299605 3300038443 Bacteria 1667
413 Ga0395901_0347048 3300038443 Bacteria 1532
414 Ga0395901_0359511 3300038443 Bacteria 1501
415 Ga0395901_0362844 3300038443 Bacteria 1493
416 Ga0395901_0918248 3300038443 Bacteria 856
417 Ga0436361_0939166 3300039447 Bacteria 85026
418 Ga0436361_0971268 3300039447 Bacteria 3158
419 Ga0439436_0000002 3300041404 Bacteria 248787
420 Ga0439465_0000242 3300041413 Bacteria 14969
421 Ga0451793_0204049 3300041452 Bacteria 3268
422 Ga0439433_0041246 3300041999 Bacteria 1075
423 Ga0439432_090235 3300042006 Bacteria 923
424 Ga0439463_042958 3300042016 Bacteria 1150
425 Ga0450890_000920 3300042127 Bacteria 4254
426 Ga0450897_008653 3300042128 Bacteria 950
427 Ga0439459_0098872 3300042438 Bacteria 711
428 Ga0466969_0001223 3300044656 Bacteria 13874
429 Ga0466969_0013974 3300044656 Bacteria 4226
430 Ga0466982_0000006 3300044672 Bacteria 333931
431 Ga0466982_0000297 3300044672 Bacteria 13627
432 Ga0466965_0016400 3300044683 Bacteria 3525
433 Ga0466965_0056866 3300044683 Bacteria 1948
434 Ga0466966_0004763 3300044684 Bacteria 8932
435 Ga0466966_0012514 3300044684 Bacteria 5619
436 Ga0466961_0000281 3300044693 Bacteria 33824
437 Ga0466961_0000682 3300044693 Bacteria 21417
438 Ga0466961_0165753 3300044693 Bacteria 1375
439 Ga0466963_0276530 3300044694 Bacteria 1180
440 Ga0466963_0473166 3300044694 Bacteria 884
441 Ga0466964_0008994 3300044706 Bacteria 3759
442 Ga0466971_0001522 3300044719 Bacteria 9778
443 Ga0466968_0030703 3300044735 Bacteria 2227
444 Ga0466970_0070255 3300044765 Bacteria 1882
445 Ga0466970_0128371 3300044765 Bacteria 1392
446 Ga0466970_0199715 3300044765 Bacteria 1112
447 Ga0466957_0072880 3300044842 Bacteria 2127
448 Ga0466960_0117430 3300044901 Bacteria 1389
449 Ga0466959_0000081 3300045049 Bacteria 59780
450 Ga0466959_0010702 3300045049 Bacteria 6569
451 Ga0466959_0038964 3300045049 Bacteria 3511
452 Ga0466959_0094125 3300045049 Bacteria 2149
453 Ga0466959_0132810 3300045049 Bacteria 1763
454 Ga0466958_0042735 3300045836 Bacteria 2729
455 Ga0466958_0080410 3300045836 Bacteria 2005
456 Ga0466967_0125692 3300045976 Bacteria 2375
457 Ga0495627_002353 3300046453 Bacteria 9233
458 Ga0495590_0006140 3300046457 Bacteria 4708
459 Ga0495638_0000272 3300046460 Bacteria 69973
460 Ga0495638_0000290 3300046460 Bacteria 66116
461 Ga0495650_0000210 3300046471 Bacteria 125249
462 Ga0495650_0077467 3300046471 Bacteria 1290
463 Ga0495607_0000809 3300046501 Bacteria 29653
464 Ga0495607_0078275 3300046501 Bacteria 1824
465 Ga0495606_0000016 3300046507 Bacteria 284865
466 Ga0495606_0002764 3300046507 Bacteria 19666
467 Ga0495610_0000909 3300046512 Bacteria 27543
468 Ga0495616_0181732 3300046513 Bacteria 934
469 Ga0495631_0015568 3300046518 Bacteria 3641
470 Ga0495632_0040960 3300046519 Bacteria 2329
471 Ga0495632_0087237 3300046519 Bacteria 1483
472 Ga0495654_0015932 3300046530 Bacteria 3983
473 Ga0495622_0010379 3300046557 Bacteria 4306
474 Ga0495625_0043348 3300046660 Bacteria 3263
475 Ga0495625_0129926 3300046660 Bacteria 1707
476 Ga0495670_0001325 3300046691 Bacteria 12075
477 Ga0495671_0021722 3300046692 Bacteria 3367
478 Ga0495649_0001640 3300046694 Bacteria 16636
479 Ga0495660_0103897 3300046810 Bacteria 1459
480 Ga0495636_0001686 3300047318 Bacteria 8417
481 Ga0495672_0006102 3300047320 Bacteria 9410
482 Ga0496100_0045795 3300048903 Bacteria 2809
483 Ga0496104_0319482 3300048907 Bacteria 1465
484 Ga0496105_0002754 3300048908 Bacteria 12835
485 Ga0496105_0290199 3300048908 Bacteria 1317
486 Ga0496107_0111166 3300048910 Bacteria 2014
487 Ga0496107_0535092 3300048910 Bacteria 868
488 Ga0496108_0205104 3300048911 Bacteria 1711
489 Ga0496109_0027610 3300048912 Bacteria 5070
490 Ga0496110_0075502 3300048913 Bacteria 2995
491 Ga0496110_0159988 3300048913 Bacteria 2041
492 Ga0496113_0300007 3300048916 Bacteria 1286
493 Ga0496113_0411710 3300048916 Bacteria 1086
494 Ga0496114_0035070 3300048917 Bacteria 4142
495 Ga0496115_0000089 3300048918 Bacteria 85894
496 Ga0496115_0092346 3300048918 Bacteria 2474
497 Ga0496115_0501530 3300048918 Bacteria 975
498 Ga0496116_0082189 3300048919 Bacteria 1994
499 Ga0496116_0140565 3300048919 Bacteria 1359
500 Ga0496117_0031116 3300048920 Bacteria 4081
501 Ga0496117_0042327 3300048920 Bacteria 3324
502 Ga0496118_0004450 3300048921 Bacteria 16613
503 Ga0496118_0030229 3300048921 Bacteria 4524
504 Ga0496119_0000029 3300048922 Bacteria 243194
505 Ga0496119_0005785 3300048922 Bacteria 11704
506 Ga0496120_0000015 3300048923 Bacteria 310795
507 Ga0496120_0000039 3300048923 Bacteria 202237
508 Ga0496121_0000408 3300048924 Bacteria 85494
509 Ga0496121_0047674 3300048924 Bacteria 3653
510 Ga0496122_0018751 3300048925 Bacteria 6366
511 Ga0496123_0006068 3300048926 Bacteria 11858
512 Ga0496124_0000079 3300048927 Bacteria 212057
513 Ga0496124_0001305 3300048927 Bacteria 37694
514 Ga0496125_0003327 3300048928 Bacteria 19631
515 Ga0496125_0004803 3300048928 Bacteria 15364
516 Ga0496126_0000259 3300048929 Bacteria 113443
517 Ga0496126_0004791 3300048929 Bacteria 15901
518 Ga0496126_0060183 3300048929 Bacteria 3417
519 Ga0496126_0507032 3300048929 Bacteria 963
520 Ga0495678_027331 3300049459 Bacteria 2421
521 Ga0495678_044819 3300049459 Bacteria 1748
522 Ga0495682_0002725 3300049460 Bacteria 8195
523 Ga0501031_0578765 3300049568 Bacteria 723
524 Ga0501033_0000901 3300049570 Bacteria 27178
525 Ga0501033_0109401 3300049570 Bacteria 2012
526 Ga0501033_0397010 3300049570 Bacteria 962
527 Ga0501034_0013667 3300049571 Bacteria 8348
528 Ga0501034_0072017 3300049571 Bacteria 3465
529 Ga0501034_0372378 3300049571 Bacteria 1354
530 Ga0501036_0027525 3300049572 Bacteria 4803
531 Ga0501036_0043612 3300049572 Bacteria 3799
532 Ga0501036_0295222 3300049572 Bacteria 1356
533 Ga0501037_0006677 3300049573 Bacteria 8437
534 Ga0501037_0032496 3300049573 Bacteria 3853
535 Ga0501037_0202432 3300049573 Bacteria 1402
536 Ga0501037_0244428 3300049573 Bacteria 1257
537 Ga0501038_0271609 3300049574 Bacteria 1337
538 Ga0501039_0333759 3300049575 Bacteria 1191
539 Ga0501043_0035242 3300049579 Bacteria 3936
540 Ga0501043_0036445 3300049579 Bacteria 3869
541 Ga0501043_0113113 3300049579 Bacteria 2131
542 Ga0501043_0143225 3300049579 Bacteria 1871
543 Ga0501043_0200649 3300049579 Bacteria 1548
544 Ga0501046_0034157 3300049580 Bacteria 4106
545 Ga0501047_0007115 3300049581 Bacteria 10508
546 Ga0501047_0061711 3300049581 Bacteria 3617
547 Ga0501047_0096278 3300049581 Bacteria 2838
548 Ga0501047_0411551 3300049581 Bacteria 1184
549 Ga0501048_0076246 3300049582 Bacteria 2366
550 Ga0501068_0097438 3300049584 Bacteria 1820
551 Ga0501068_0286234 3300049584 Bacteria 1054
552 Ga0501069_0062944 3300049585 Bacteria 2072
553 Ga0501070_0026229 3300049586 Bacteria 4891
554 Ga0501070_0042963 3300049586 Bacteria 3763
555 Ga0501070_0061444 3300049586 Bacteria 3112
556 Ga0501070_0130715 3300049586 Bacteria 2074
557 Ga0501070_0130787 3300049586 Bacteria 2074
558 Ga0501073_0008516 3300049589 Bacteria 7607
559 Ga0501074_0089029 3300049590 Bacteria 2210
560 Ga0501074_0726170 3300049590 Bacteria 701
561 Ga0501077_0002614 3300049593 Bacteria 10784
562 Ga0501080_1031589 3300049742 Bacteria 712
563 Ga0501035_0023863 3300049822 Bacteria 5612
564 Ga0501035_0031715 3300049822 Bacteria 4812
565 Ga0501035_0082523 3300049822 Bacteria 2836
566 Ga0501035_0106864 3300049822 Bacteria 2453
567 Ga0501035_0133393 3300049822 Bacteria 2163
568 Ga0501035_0276917 3300049822 Bacteria 1419
569 Ga0501044_0006314 3300049823 Bacteria 13106
570 Ga0501044_0046674 3300049823 Bacteria 4484
571 Ga0501044_0055054 3300049823 Bacteria 4086
572 Ga0501044_0066239 3300049823 Bacteria 3683
573 Ga0501044_0121603 3300049823 Bacteria 2611
574 nmdc:mga0k408_59608_c1 3300050493 Bacteria 2218
575 nmdc:mga06z11_9203_c1 3300050494 Bacteria 4152
576 nmdc:mga04h51_29884_c1 3300050495 Bacteria 1711
577 Ga0466962_0000256 3300061719 Bacteria 22473
578 Ga0466962_0017645 3300061719 Bacteria 3437
579 Ga0466962_0051596 3300061719 Bacteria 1967
580 2538833535 2537561836 Bacteria 3910579
581 2595448562 2593339238 Bacteria 4182970
582 2643828639 2643221562 Bacteria 4048635
583 2687584938 2687453130 Bacteria 4227172
584 2739733280 2739367700 Bacteria 4747630
585 2819564592 2818991440 Bacteria 4774720
586 2842921291 2842918807 Bacteria 4289178
587 2886853471 2886848708 Bacteria 5632523
588 2895397988 2895395659 Bacteria 3983269
589 2904465239 2904463128 Bacteria 4775606
590 2919088744 2919085039 Bacteria 4532964
591 2919407354 2919404418 Bacteria 4232372
592 2919496437 2919493220 Bacteria 4598500
593 2919546972 2919543075 Bacteria 4728703
594 2923526618 2923525760 Bacteria 4472324
595 2928967017 2928963466 Bacteria 5165703
596 2939613549 2939611941 Bacteria 3892017
597 2953996534 2953994433 Bacteria 4303959
598 2987607018 2987605356 Bacteria 4187822
599 Ga0466960_0267596
600 JGI24741J21665_1000527
601 JGI24741J21665_1022688
602 JGI24740J21852_10000025
603 JGI24737J22298_10006940
604 JGI24735J21928_10040825
605 JGI24735J21928_10082934
606 JGI24738J21930_10001231
607 JGI25156J39149_1000251
608 JGI25156J39149_1014166
609 JGI25156J39149_1018401
610 JGI25156J39149_1027051
611 JGI25162J39368_1001521
612 JGI25162J39368_1001749
613 JGI25162J39368_1002711
614 JGI25157J39369_1000288
615 JGI25157J39369_1001779
616 JGI25157J39369_1015349
617 JGI25157J39369_1018853
618 JGI25164J39214_1000105
619 JGI25164J39214_1000473
620 JGI25164J39214_1002318
621 JGI25165J46597_1000155
622 JGI25165J46597_1001813
623 JGI25153J46596_10019219
624 rootH1_10026611
625 rootH2_10077984
626 rootH2_10094176
627 Ga0006562J51391_1011837
628 Ga0006562J51391_1011840
629 Ga0055539_1001091
630 Ga0055527_1000037
631 Ga0055535_1000059
632 Ga0055535_1000211
633 Ga0055535_1000367
634 Ga0055542_1000086
635 Ga0055542_1000117
636 Ga0055542_1000288
637 Ga0055542_1001245
638 Ga0055529_1000212
639 Ga0055529_1000307
640 Ga0055524_1011072
641 Ga0055531_10014643
642 Ga0065165_1000343
643 Ga0065165_1002670
644 Ga0065715_10108317
645 Ga0070658_10652884
646 Ga0070658_10744417
647 Ga0070683_100610066
648 Ga0070670_100041832
649 Ga0070680_100000150
650 Ga0070680_100000429
651 Ga0070682_100001327
652 Ga0070682_100059551
653 Ga0070682_100062357
654 Ga0070660_100271390
655 Ga0070689_100003901
656 Ga0070691_10001084
657 Ga0070691_10013828
658 Ga0070661_100028277
659 Ga0070661_100042592
660 Ga0070661_100104058
661 Ga0070661_100237190
662 Ga0070661_100297415
663 Ga0070692_10003181
664 Ga0070692_10004779
665 Ga0070692_10020287
666 Ga0070692_10083100
667 Ga0070659_100021824
668 Ga0070659_100039724
669 Ga0070659_100233473
670 Ga0070714_100000055
671 Ga0070714_100031357
672 Ga0070713_100022992
673 Ga0070694_100031712
674 Ga0070694_100054655
675 Ga0070694_100556418
676 Ga0070708_100451751
677 Ga0070663_100014903
678 Ga0070663_100087968
679 Ga0070663_100090252
680 Ga0070663_100412323
681 Ga0070662_100037955
682 Ga0070681_10000082
683 Ga0070681_10028349
684 Ga0070707_100024364
685 Ga0070707_100046258
686 Ga0070698_100120638
687 Ga0070699_100067925
688 Ga0070699_100156450
689 Ga0070679_100000166
690 Ga0070679_100160539
691 Ga0070679_100221378
692 Ga0070679_100312160
693 Ga0070679_100726816
694 Ga0070684_100028303
695 Ga0068853_100024814
696 Ga0068853_100099567
697 Ga0068853_100229071
698 Ga0070696_100005544
699 Ga0070696_100037550
700 Ga0070696_100144196
701 Ga0070693_100000680
702 Ga0070693_100024242
703 Ga0068855_100005319
704 Ga0068855_100010220
705 Ga0068855_100065211
706 Ga0068855_100076467
707 Ga0068855_100093997
708 Ga0070664_100028080
709 Ga0070664_100146272
710 Ga0068857_100000241
711 Ga0068857_100118246
712 Ga0068857_100213871
713 Ga0068854_100002387
714 Ga0068854_100004331
715 Ga0068854_100025011
716 Ga0068854_100026609
717 Ga0068854_100065003
718 Ga0068856_100004861
719 Ga0068856_100029617
720 Ga0068856_100149214
721 Ga0068856_100747158
722 Ga0068856_100906937
723 Ga0068852_100002474
724 Ga0068852_100003494
725 Ga0068852_100071762
726 Ga0068851_10002340
727 Ga0068851_10048466
728 Ga0068860_100154588
729 Ga0068862_100140428
730 Ga0075368_10037529
731 Ga0070712_100223857
732 Ga0075362_10004645
733 Ga0075367_10007898
734 Ga0075369_10075689
735 Ga0075366_10042527
736 Ga0105251_10000057
737 Ga0105250_10000784
738 Ga0105250_10238491
739 Ga0105240_10000197
740 Ga0105240_10000199
741 Ga0105240_10009428
742 Ga0105240_10011697
743 Ga0105240_10033751
744 Ga0105240_10215520
745 Ga0105240_10248726
746 Ga0105240_10381873
747 Ga0105240_10505039
748 Ga0105237_10000212
749 Ga0105237_10041079
750 Ga0105237_10127409
751 Ga0105237_10809385
752 Ga0105238_10001210
753 Ga0105238_10032581
754 Ga0105238_10034811
755 Ga0105238_10057703
756 Ga0105238_10082334
757 Ga0105238_10248642
758 Ga0105249_10583659
759 Ga0105249_10630309
760 Ga0105239_10000110
761 Ga0105239_10006357
762 Ga0105239_10030736
763 Ga0105239_10051528
764 Ga0157314_1000004
765 Ga0157347_1010097
766 Ga0157373_10016625
767 Ga0157373_10126035
768 Ga0157373_10141615
769 Ga0157371_10000389
770 Ga0157371_10013629
771 Ga0157371_10022058
772 Ga0157371_10032896
773 Ga0157371_10116409
774 Ga0157370_10006195
775 Ga0157370_10014378
776 Ga0157370_10027198
777 Ga0157370_10036755
778 Ga0157370_10056630
779 Ga0157370_10062095
780 Ga0157370_10151877
781 Ga0157370_10479238
782 Ga0157369_10018809
783 Ga0157369_10086649
784 Ga0157369_10115360
785 Ga0157369_10501388
786 Ga0157369_10599455
787 Ga0157372_10009339
788 Ga0157372_10045284
789 Ga0157372_10082206
790 Ga0157372_10117003
791 Ga0157372_10139505
792 Ga0157372_10146151
793 Ga0182008_10006961
794 Ga0182008_10026987
795 Ga0182008_10108975
796 Ga0157376_10009453
797 Ga0182006_1000200
798 Ga0182005_1000019
799 Ga0182005_1010470
800 Ga0206356_10062314
801 Ga0206356_10716613
802 Ga0206356_11169423
803 Ga0206354_10316166
804 Ga0206354_10904655
805 Ga0206353_10400454
806 Ga0206353_11125515
807 Ga0213872_10000051
808 Ga0209435_105297
809 Ga0209566_102664
810 Ga0209674_100134
811 Ga0209674_100400
812 Ga0209674_101350
813 Ga0209674_108288
814 Ga0209672_100008
815 Ga0209672_100074
816 Ga0209672_100501
817 Ga0209672_100537
818 Ga0207427_100044
819 Ga0207427_100045
820 Ga0207427_100132
821 Ga0207427_102913
822 Ga0209437_100005
823 Ga0209437_100118
824 Ga0209437_100140
825 Ga0209437_100365
826 Ga0209437_101582
827 Ga0209258_100004
828 Ga0209258_100008
829 Ga0209258_100148
830 Ga0209258_100229
831 Ga0209258_102228
832 Ga0209646_1001015
833 Ga0209646_1001085
834 Ga0209026_1000010
835 Ga0209026_1000061
836 Ga0209026_1000088
837 Ga0209026_1000743
838 Ga0209026_1003877
839 Ga0209148_1000002
840 Ga0209148_1000041
841 Ga0209148_1000138
842 Ga0209148_1000191
843 Ga0209148_1000626
844 Ga0209759_1000259
845 Ga0209759_1000364
846 Ga0209759_1000853
847 Ga0209759_1023526
848 Ga0209759_1028944
849 Ga0209759_1028966
850 Ga0209129_1006347
851 Ga0209129_1006836
852 Ga0209233_1000011
853 Ga0209233_1000046
854 Ga0209233_1000116
855 Ga0209455_1000007
856 Ga0209455_1000111
857 Ga0209455_1000124
858 Ga0209455_1017039
859 Ga0209758_1001002
860 Ga0209758_1012534
861 Ga0209256_1000053
862 Ga0209256_1082780
863 Ga0209257_1000372
864 Ga0207656_10000893
865 Ga0207696_1000112
866 Ga0207655_1024444
867 Ga0207713_1000014
868 Ga0207647_10000992
869 Ga0207647_10001759
870 Ga0207647_10002879
871 Ga0207705_10000029
872 Ga0207705_10000287
873 Ga0207705_10001167
874 Ga0207705_10061270
875 Ga0207705_10491543
876 Ga0207684_10023526
877 Ga0207654_10119412
878 Ga0207707_10000042
879 Ga0207707_10000049
880 Ga0207707_10000593
881 Ga0207707_10001410
882 Ga0207707_10016123
883 Ga0207707_10365520
884 Ga0207695_10000207
885 Ga0207695_10001055
886 Ga0207695_10001939
887 Ga0207695_10002014
888 Ga0207695_10002579
889 Ga0207695_10006926
890 Ga0207695_10056970
891 Ga0207695_10061185
892 Ga0207695_10339334
893 Ga0207671_10000009
894 Ga0207671_10121423
895 Ga0207693_10031845
896 Ga0207663_10132001
897 Ga0207660_10000206
898 Ga0207660_10007024
899 Ga0207660_10060647
900 Ga0207660_10379896
901 Ga0207657_10000915
902 Ga0207657_10002290
903 Ga0207657_10037493
904 Ga0207657_10132155
905 Ga0207649_10000219
906 Ga0207649_10152140
907 Ga0207652_10000014
908 Ga0207652_10000099
909 Ga0207652_10000530
910 Ga0207652_10001294
911 Ga0207652_10299460
912 Ga0207652_10315163
913 Ga0207652_10333290
914 Ga0207646_10050463
915 Ga0207646_10069117
916 Ga0207694_10015820
917 Ga0207694_10046714
918 Ga0207694_10049776
919 Ga0207694_10109688
920 Ga0207694_10156175
921 Ga0207694_10169738
922 Ga0207650_10021670
923 Ga0207659_10174796
924 Ga0207664_10000030
925 Ga0207664_10006402
926 Ga0207664_10027244
927 Ga0207690_10000096
928 Ga0207690_10000645
929 Ga0207690_10001295
930 Ga0207690_10027620
931 Ga0207690_10030825
932 Ga0207690_10639399
933 Ga0207706_10041666
934 Ga0207706_10253489
935 Ga0207706_10446857
936 Ga0207670_10001961
937 Ga0207661_10003106
938 Ga0207661_10303880
939 Ga0207679_10007358
940 Ga0207679_10083942
941 Ga0207667_10000063
942 Ga0207667_10000075
943 Ga0207667_10000632
944 Ga0207667_10001316
945 Ga0207667_10002093
946 Ga0207667_10003345
947 Ga0207667_10079470
948 Ga0207667_10136269
949 Ga0207667_10163526
950 Ga0207667_10197523
951 Ga0207712_10366075
952 Ga0207640_10000688
953 Ga0207640_10001363
954 Ga0207640_10010165
955 Ga0207640_10010866
956 Ga0207640_10104222
957 Ga0207658_11080817
958 Ga0207703_10127666
959 Ga0207639_10000382
960 Ga0207639_10002253
961 Ga0207639_10089690
962 Ga0207639_10213894
963 Ga0207639_10252911
964 Ga0207678_10001323
965 Ga0207678_10001825
966 Ga0207678_10042229
967 Ga0207678_10077646
968 Ga0207678_10133021
969 Ga0207702_10001267
970 Ga0207702_10007397
971 Ga0207702_10335499
972 Ga0207702_10417920
973 Ga0207702_10767968
974 Ga0207674_10000123
975 Ga0207674_10004272
976 Ga0207674_10026119
977 Ga0207674_10043271
978 Ga0207674_10062532
979 Ga0207698_10000152
980 Ga0207698_10020563
981 Ga0209813_10030995
982 Ga0307408_100218658
983 Ga0307514_10002825
984 Ga0307405_10895387
985 Ga0307412_10000340
986 Ga0307409_100638772
987 Ga0373925_0215671
988 Ga0395899_0000051
989 Ga0395899_0020714
990 Ga0395899_0072369
991 Ga0395899_0436214
992 Ga0395900_0000047
993 Ga0395900_0001206
994 Ga0395900_0003339
995 Ga0395900_0246871
996 Ga0395900_1049944
997 Ga0395898_0000045
998 Ga0395898_0000090
999 Ga0395898_0009199
1000 Ga0395898_0015954
1001 Ga0395905_0001415
1002 Ga0395905_0014901
1003 Ga0395905_0036614
1004 Ga0395901_0002065
1005 Ga0395901_0057457
1006 Ga0395901_0110379
1007 Ga0395901_0130255
1008 Ga0395901_0154620
1009 Ga0395901_0201435
1010 Ga0395901_0299605
1011 Ga0395901_0347048
1012 Ga0395901_0359511
1013 Ga0395901_0362844
1014 Ga0395901_0918248
1015 Ga0436361_0939166
1016 Ga0436361_0971268
1017 Ga0439436_0000002
1018 Ga0439465_0000242
1019 Ga0451793_0204049
1020 Ga0439433_0041246
1021 Ga0439432_090235
1022 Ga0439463_042958
1023 Ga0450890_000920
1024 Ga0450897_008653
1025 Ga0439459_0098872
1026 Ga0466969_0001223
1027 Ga0466969_0013974
1028 Ga0466982_0000006
1029 Ga0466982_0000297
1030 Ga0466965_0016400
1031 Ga0466965_0056866
1032 Ga0466966_0004763
1033 Ga0466966_0012514
1034 Ga0466961_0000281
1035 Ga0466961_0000682
1036 Ga0466961_0165753
1037 Ga0466963_0276530
1038 Ga0466963_0473166
1039 Ga0466964_0008994
1040 Ga0466971_0001522
1041 Ga0466968_0030703
1042 Ga0466970_0070255
1043 Ga0466970_0128371
1044 Ga0466970_0199715
1045 Ga0466957_0072880
1046 Ga0466960_0117430
1047 Ga0466959_0000081
1048 Ga0466959_0010702
1049 Ga0466959_0038964
1050 Ga0466959_0094125
1051 Ga0466959_0132810
1052 Ga0466958_0042735
1053 Ga0466958_0080410
1054 Ga0466967_0125692
1055 Ga0495627_002353
1056 Ga0495590_0006140
1057 Ga0495638_0000272
1058 Ga0495638_0000290
1059 Ga0495650_0000210
1060 Ga0495650_0077467
1061 Ga0495607_0000809
1062 Ga0495607_0078275
1063 Ga0495606_0000016
1064 Ga0495606_0002764
1065 Ga0495610_0000909
1066 Ga0495616_0181732
1067 Ga0495631_0015568
1068 Ga0495632_0040960
1069 Ga0495632_0087237
1070 Ga0495654_0015932
1071 Ga0495622_0010379
1072 Ga0495625_0043348
1073 Ga0495625_0129926
1074 Ga0495670_0001325
1075 Ga0495671_0021722
1076 Ga0495649_0001640
1077 Ga0495660_0103897
1078 Ga0495636_0001686
1079 Ga0495672_0006102
1080 Ga0496100_0045795
1081 Ga0496104_0319482
1082 Ga0496105_0002754
1083 Ga0496105_0290199
1084 Ga0496107_0111166
1085 Ga0496107_0535092
1086 Ga0496108_0205104
1087 Ga0496109_0027610
1088 Ga0496110_0075502
1089 Ga0496110_0159988
1090 Ga0496113_0300007
1091 Ga0496113_0411710
1092 Ga0496114_0035070
1093 Ga0496115_0000089
1094 Ga0496115_0092346
1095 Ga0496115_0501530
1096 Ga0496116_0082189
1097 Ga0496116_0140565
1098 Ga0496117_0031116
1099 Ga0496117_0042327
1100 Ga0496118_0004450
1101 Ga0496118_0030229
1102 Ga0496119_0000029
1103 Ga0496119_0005785
1104 Ga0496120_0000015
1105 Ga0496120_0000039
1106 Ga0496121_0000408
1107 Ga0496121_0047674
1108 Ga0496122_0018751
1109 Ga0496123_0006068
1110 Ga0496124_0000079
1111 Ga0496124_0001305
1112 Ga0496125_0003327
1113 Ga0496125_0004803
1114 Ga0496126_0000259
1115 Ga0496126_0004791
1116 Ga0496126_0060183
1117 Ga0496126_0507032
1118 Ga0495678_027331
1119 Ga0495678_044819
1120 Ga0495682_0002725
1121 Ga0501031_0578765
1122 Ga0501033_0000901
1123 Ga0501033_0109401
1124 Ga0501033_0397010
1125 Ga0501034_0013667
1126 Ga0501034_0072017
1127 Ga0501034_0372378
1128 Ga0501036_0027525
1129 Ga0501036_0043612
1130 Ga0501036_0295222
1131 Ga0501037_0006677
1132 Ga0501037_0032496
1133 Ga0501037_0202432
1134 Ga0501037_0244428
1135 Ga0501038_0271609
1136 Ga0501039_0333759
1137 Ga0501043_0035242
1138 Ga0501043_0036445
1139 Ga0501043_0113113
1140 Ga0501043_0143225
1141 Ga0501043_0200649
1142 Ga0501046_0034157
1143 Ga0501047_0007115
1144 Ga0501047_0061711
1145 Ga0501047_0096278
1146 Ga0501047_0411551
1147 Ga0501048_0076246
1148 Ga0501068_0097438
1149 Ga0501068_0286234
1150 Ga0501069_0062944
1151 Ga0501070_0026229
1152 Ga0501070_0042963
1153 Ga0501070_0061444
1154 Ga0501070_0130715
1155 Ga0501070_0130787
1156 Ga0501073_0008516
1157 Ga0501074_0089029
1158 Ga0501074_0726170
1159 Ga0501077_0002614
1160 Ga0501080_1031589
1161 Ga0501035_0023863
1162 Ga0501035_0031715
1163 Ga0501035_0082523
1164 Ga0501035_0106864
1165 Ga0501035_0133393
1166 Ga0501035_0276917
1167 Ga0501044_0006314
1168 Ga0501044_0046674
1169 Ga0501044_0055054
1170 Ga0501044_0066239
1171 Ga0501044_0121603
1172 nmdc:mga0k408_59608_c1
1173 nmdc:mga06z11_9203_c1
1174 nmdc:mga04h51_29884_c1
1175 Ga0466962_0000256
1176 Ga0466962_0017645
1177 Ga0466962_0051596
1178 2538833535
1179 2595448562
1180 2643828639
1181 2687584938
1182 2739733280
1183 2819564592
1184 2842921291
1185 2886853471
1186 2895397988
1187 2904465239
1188 2919088744
1189 2919407354
1190 2919496437
1191 2919546972
1192 2923526618
1193 2928967017
1194 2939613549
1195 2953996534
1196 2987607018

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

7

199

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c0a-assembly1.cif.gz_B mechanism of the class i kdpg aldolase 0.9824 13 213
1eua-assembly1.cif.gz_B schiff base intermediate in kdpg aldolase from escherichia coli 0.9819 13 213
1fwr-assembly1.cif.gz_C crystal structure of kdpg aldolase double mutant k133q/t161k 0.9792 13 213
6ovi-assembly1.cif.gz_B crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate 0.9791 12 210
4e38-assembly1.cif.gz_B crystal structure of probable keto-hydroxyglutarate-aldolase from vibrionales bacterium swat-3 (target efi-502156) 0.9698 9 208
ID Description Score Start End Superfamily
1mxsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9697 4 212 3.20.20.70
4bk9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9639 11 216 3.20.20.70
3vcrA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9492 9 212 3.20.20.70
1vhcB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9459 7 214 3.20.20.70
4bk9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9412 11 216 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0M6Y348-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9958 9 210 GO:0008675
AF-K5YTA1-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9954 8 209 GO:0008675
AF-A0A545TGF3-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9954 7 213 GO:0008675
AF-A0A2A4NPC3-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9942 7 210 GO:0008675
AF-A0A2N2SKB0-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9939 5 213 GO:0008675

Map