F467809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 598 | 262 | 1196 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0267596|Ga0466960_0267596_10_642 |
| Length | 210 |
| Sequence | MSTHPDVPKFMTMGPVLPVMVIPSLDQAVPLAEALIKGGIKVLEITLRTDCALASIEAIAKAFPEAVVGAGTVLSPDDAKAAADHGARFAVSPGLTEKLAGQTSLPLLPGVATSSEVMRALEWGFTHLKFFPAVPAGGVPALKGIGGPLAAAKFCPTGGIDQKNAADFLALPNVLCVGGSWVAPAAAMNEGRWDEVTRLAAEAVATFGEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 74 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 155 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 156 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 157 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 159 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 160 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 161 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 162 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 163 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 164 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 165 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 166 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 167 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 168 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 169 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 170 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 171 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 172 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 173 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 176 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 177 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 178 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 200 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 208 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 209 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 210 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 211 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 212 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 213 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 214 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 215 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 218 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 241 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 242 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 243 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 244 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 245 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 246 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 247 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 248 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 249 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 250 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 251 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 252 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 253 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 254 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 255 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 256 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 257 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 258 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 259 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 260 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 261 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 262 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.32 |
| Metatranscriptomes | 1.51 |
| Isolates | 3.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.54 |
| Nodule | 0 |
| Rhizoplane | 2.84 |
| Rhizosphere | 73.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466960_0267596 | 3300044901 | Bacteria | 954 |
| 2 | JGI24741J21665_1000527 | 3300001915 | Bacteria | 11685 |
| 3 | JGI24741J21665_1022688 | 3300001915 | Bacteria | 972 |
| 4 | JGI24740J21852_10000025 | 3300001979 | Bacteria | 49637 |
| 5 | JGI24737J22298_10006940 | 3300001990 | Bacteria | 3842 |
| 6 | JGI24735J21928_10040825 | 3300002067 | Bacteria | 1353 |
| 7 | JGI24735J21928_10082934 | 3300002067 | Bacteria | 919 |
| 8 | JGI24738J21930_10001231 | 3300002075 | Bacteria | 7193 |
| 9 | JGI25156J39149_1000251 | 3300002705 | Bacteria | 36996 |
| 10 | JGI25156J39149_1014166 | 3300002705 | Bacteria | 1657 |
| 11 | JGI25156J39149_1018401 | 3300002705 | Bacteria | 1292 |
| 12 | JGI25156J39149_1027051 | 3300002705 | Bacteria | 901 |
| 13 | JGI25162J39368_1001521 | 3300002737 | Bacteria | 12007 |
| 14 | JGI25162J39368_1001749 | 3300002737 | Bacteria | 10397 |
| 15 | JGI25162J39368_1002711 | 3300002737 | Bacteria | 6403 |
| 16 | JGI25157J39369_1000288 | 3300002741 | Bacteria | 36723 |
| 17 | JGI25157J39369_1001779 | 3300002741 | Bacteria | 7002 |
| 18 | JGI25157J39369_1015349 | 3300002741 | Bacteria | 943 |
| 19 | JGI25157J39369_1018853 | 3300002741 | Bacteria | 830 |
| 20 | JGI25164J39214_1000105 | 3300002772 | Bacteria | 81222 |
| 21 | JGI25164J39214_1000473 | 3300002772 | Bacteria | 19954 |
| 22 | JGI25164J39214_1002318 | 3300002772 | Bacteria | 3043 |
| 23 | JGI25165J46597_1000155 | 3300003214 | Bacteria | 109705 |
| 24 | JGI25165J46597_1001813 | 3300003214 | Bacteria | 8988 |
| 25 | JGI25153J46596_10019219 | 3300003215 | Bacteria | 2624 |
| 26 | rootH1_10026611 | 3300003316 | Bacteria | 8739 |
| 27 | rootH2_10077984 | 3300003320 | Bacteria | 2339 |
| 28 | rootH2_10094176 | 3300003320 | Bacteria | 1132 |
| 29 | Ga0006562J51391_1011837 | 3300003578 | Bacteria | 15120 |
| 30 | Ga0006562J51391_1011840 | 3300003578 | Bacteria | 13440 |
| 31 | Ga0055539_1001091 | 3300003752 | Bacteria | 5681 |
| 32 | Ga0055527_1000037 | 3300003760 | Bacteria | 124590 |
| 33 | Ga0055535_1000059 | 3300003761 | Bacteria | 124595 |
| 34 | Ga0055535_1000211 | 3300003761 | Bacteria | 61694 |
| 35 | Ga0055535_1000367 | 3300003761 | Bacteria | 43516 |
| 36 | Ga0055542_1000086 | 3300003762 | Bacteria | 124594 |
| 37 | Ga0055542_1000117 | 3300003762 | Bacteria | 105560 |
| 38 | Ga0055542_1000288 | 3300003762 | Bacteria | 56246 |
| 39 | Ga0055542_1001245 | 3300003762 | Bacteria | 14078 |
| 40 | Ga0055529_1000212 | 3300003763 | Bacteria | 76463 |
| 41 | Ga0055529_1000307 | 3300003763 | Bacteria | 56246 |
| 42 | Ga0055524_1011072 | 3300003775 | Bacteria | 3547 |
| 43 | Ga0055531_10014643 | 3300003794 | Bacteria | 3517 |
| 44 | Ga0065165_1000343 | 3300005262 | Bacteria | 76286 |
| 45 | Ga0065165_1002670 | 3300005262 | Bacteria | 14404 |
| 46 | Ga0065715_10108317 | 3300005293 | Bacteria | 2708 |
| 47 | Ga0070658_10652884 | 3300005327 | Bacteria | 913 |
| 48 | Ga0070658_10744417 | 3300005327 | Bacteria | 851 |
| 49 | Ga0070683_100610066 | 3300005329 | Bacteria | 1044 |
| 50 | Ga0070670_100041832 | 3300005331 | Bacteria | 3938 |
| 51 | Ga0070680_100000150 | 3300005336 | Bacteria | 43056 |
| 52 | Ga0070680_100000429 | 3300005336 | Bacteria | 28658 |
| 53 | Ga0070682_100001327 | 3300005337 | Bacteria | 13996 |
| 54 | Ga0070682_100059551 | 3300005337 | Bacteria | 2412 |
| 55 | Ga0070682_100062357 | 3300005337 | Bacteria | 2361 |
| 56 | Ga0070660_100271390 | 3300005339 | Bacteria | 1386 |
| 57 | Ga0070689_100003901 | 3300005340 | Bacteria | 9997 |
| 58 | Ga0070691_10001084 | 3300005341 | Bacteria | 11278 |
| 59 | Ga0070691_10013828 | 3300005341 | Bacteria | 3704 |
| 60 | Ga0070661_100028277 | 3300005344 | Bacteria | 4043 |
| 61 | Ga0070661_100042592 | 3300005344 | Bacteria | 3314 |
| 62 | Ga0070661_100104058 | 3300005344 | Bacteria | 2115 |
| 63 | Ga0070661_100237190 | 3300005344 | Bacteria | 1403 |
| 64 | Ga0070661_100297415 | 3300005344 | Bacteria | 1256 |
| 65 | Ga0070692_10003181 | 3300005345 | Bacteria | 6601 |
| 66 | Ga0070692_10004779 | 3300005345 | Bacteria | 5691 |
| 67 | Ga0070692_10020287 | 3300005345 | Bacteria | 3222 |
| 68 | Ga0070692_10083100 | 3300005345 | Bacteria | 1728 |
| 69 | Ga0070659_100021824 | 3300005366 | Bacteria | 4882 |
| 70 | Ga0070659_100039724 | 3300005366 | Bacteria | 3675 |
| 71 | Ga0070659_100233473 | 3300005366 | Bacteria | 1520 |
| 72 | Ga0070714_100000055 | 3300005435 | Bacteria | 103321 |
| 73 | Ga0070714_100031357 | 3300005435 | Bacteria | 4434 |
| 74 | Ga0070713_100022992 | 3300005436 | Bacteria | 4828 |
| 75 | Ga0070694_100031712 | 3300005444 | Bacteria | 3466 |
| 76 | Ga0070694_100054655 | 3300005444 | Bacteria | 2705 |
| 77 | Ga0070694_100556418 | 3300005444 | Bacteria | 919 |
| 78 | Ga0070708_100451751 | 3300005445 | Bacteria | 1212 |
| 79 | Ga0070663_100014903 | 3300005455 | Bacteria | 5000 |
| 80 | Ga0070663_100087968 | 3300005455 | Bacteria | 2296 |
| 81 | Ga0070663_100090252 | 3300005455 | Bacteria | 2269 |
| 82 | Ga0070663_100412323 | 3300005455 | Bacteria | 1106 |
| 83 | Ga0070662_100037955 | 3300005457 | Bacteria | 3419 |
| 84 | Ga0070681_10000082 | 3300005458 | Bacteria | 71460 |
| 85 | Ga0070681_10028349 | 3300005458 | Bacteria | 5628 |
| 86 | Ga0070707_100024364 | 3300005468 | Bacteria | 5731 |
| 87 | Ga0070707_100046258 | 3300005468 | Bacteria | 4164 |
| 88 | Ga0070698_100120638 | 3300005471 | Bacteria | 2582 |
| 89 | Ga0070699_100067925 | 3300005518 | Bacteria | 3095 |
| 90 | Ga0070699_100156450 | 3300005518 | Bacteria | 2017 |
| 91 | Ga0070679_100000166 | 3300005530 | Bacteria | 53376 |
| 92 | Ga0070679_100160539 | 3300005530 | Bacteria | 2222 |
| 93 | Ga0070679_100221378 | 3300005530 | Bacteria | 1853 |
| 94 | Ga0070679_100312160 | 3300005530 | Bacteria | 1522 |
| 95 | Ga0070679_100726816 | 3300005530 | Bacteria | 936 |
| 96 | Ga0070684_100028303 | 3300005535 | Bacteria | 4739 |
| 97 | Ga0068853_100024814 | 3300005539 | Bacteria | 5029 |
| 98 | Ga0068853_100099567 | 3300005539 | Bacteria | 2568 |
| 99 | Ga0068853_100229071 | 3300005539 | Bacteria | 1699 |
| 100 | Ga0070696_100005544 | 3300005546 | Bacteria | 8428 |
| 101 | Ga0070696_100037550 | 3300005546 | Bacteria | 3342 |
| 102 | Ga0070696_100144196 | 3300005546 | Bacteria | 1743 |
| 103 | Ga0070693_100000680 | 3300005547 | Bacteria | 15077 |
| 104 | Ga0070693_100024242 | 3300005547 | Bacteria | 3252 |
| 105 | Ga0068855_100005319 | 3300005563 | Bacteria | 15724 |
| 106 | Ga0068855_100010220 | 3300005563 | Bacteria | 11312 |
| 107 | Ga0068855_100065211 | 3300005563 | Bacteria | 4246 |
| 108 | Ga0068855_100076467 | 3300005563 | Bacteria | 3885 |
| 109 | Ga0068855_100093997 | 3300005563 | Bacteria | 3457 |
| 110 | Ga0070664_100028080 | 3300005564 | Bacteria | 4679 |
| 111 | Ga0070664_100146272 | 3300005564 | Bacteria | 2084 |
| 112 | Ga0068857_100000241 | 3300005577 | Bacteria | 36495 |
| 113 | Ga0068857_100118246 | 3300005577 | Bacteria | 2385 |
| 114 | Ga0068857_100213871 | 3300005577 | Bacteria | 1759 |
| 115 | Ga0068854_100002387 | 3300005578 | Bacteria | 11594 |
| 116 | Ga0068854_100004331 | 3300005578 | Bacteria | 8945 |
| 117 | Ga0068854_100025011 | 3300005578 | Bacteria | 4096 |
| 118 | Ga0068854_100026609 | 3300005578 | Bacteria | 3978 |
| 119 | Ga0068854_100065003 | 3300005578 | Bacteria | 2651 |
| 120 | Ga0068856_100004861 | 3300005614 | Bacteria | 13307 |
| 121 | Ga0068856_100029617 | 3300005614 | Bacteria | 5348 |
| 122 | Ga0068856_100149214 | 3300005614 | Bacteria | 2346 |
| 123 | Ga0068856_100747158 | 3300005614 | Bacteria | 998 |
| 124 | Ga0068856_100906937 | 3300005614 | Bacteria | 900 |
| 125 | Ga0068852_100002474 | 3300005616 | Bacteria | 12720 |
| 126 | Ga0068852_100003494 | 3300005616 | Bacteria | 10989 |
| 127 | Ga0068852_100071762 | 3300005616 | Bacteria | 3041 |
| 128 | Ga0068851_10002340 | 3300005834 | Bacteria | 8342 |
| 129 | Ga0068851_10048466 | 3300005834 | Bacteria | 2153 |
| 130 | Ga0068860_100154588 | 3300005843 | Bacteria | 2210 |
| 131 | Ga0068862_100140428 | 3300005844 | Bacteria | 2143 |
| 132 | Ga0075368_10037529 | 3300006042 | Bacteria | 1895 |
| 133 | Ga0070712_100223857 | 3300006175 | Bacteria | 1491 |
| 134 | Ga0075362_10004645 | 3300006177 | Bacteria | 4951 |
| 135 | Ga0075367_10007898 | 3300006178 | Bacteria | 5480 |
| 136 | Ga0075369_10075689 | 3300006186 | Bacteria | 1487 |
| 137 | Ga0075366_10042527 | 3300006195 | Bacteria | 2690 |
| 138 | Ga0105251_10000057 | 3300009011 | Bacteria | 104178 |
| 139 | Ga0105250_10000784 | 3300009092 | Bacteria | 19143 |
| 140 | Ga0105250_10238491 | 3300009092 | Bacteria | 775 |
| 141 | Ga0105240_10000197 | 3300009093 | Bacteria | 123221 |
| 142 | Ga0105240_10000199 | 3300009093 | Bacteria | 122191 |
| 143 | Ga0105240_10009428 | 3300009093 | Bacteria | 13818 |
| 144 | Ga0105240_10011697 | 3300009093 | Bacteria | 12194 |
| 145 | Ga0105240_10033751 | 3300009093 | Bacteria | 6607 |
| 146 | Ga0105240_10215520 | 3300009093 | Bacteria | 2240 |
| 147 | Ga0105240_10248726 | 3300009093 | Bacteria | 2057 |
| 148 | Ga0105240_10381873 | 3300009093 | Bacteria | 1591 |
| 149 | Ga0105240_10505039 | 3300009093 | Bacteria | 1344 |
| 150 | Ga0105237_10000212 | 3300009545 | Bacteria | 82465 |
| 151 | Ga0105237_10041079 | 3300009545 | Bacteria | 4665 |
| 152 | Ga0105237_10127409 | 3300009545 | Bacteria | 2540 |
| 153 | Ga0105237_10809385 | 3300009545 | Unclassified | 944 |
| 154 | Ga0105238_10001210 | 3300009551 | Bacteria | 25999 |
| 155 | Ga0105238_10032581 | 3300009551 | Bacteria | 5303 |
| 156 | Ga0105238_10034811 | 3300009551 | Bacteria | 5122 |
| 157 | Ga0105238_10057703 | 3300009551 | Bacteria | 3892 |
| 158 | Ga0105238_10082334 | 3300009551 | Bacteria | 3208 |
| 159 | Ga0105238_10248642 | 3300009551 | Bacteria | 1756 |
| 160 | Ga0105249_10583659 | 3300009553 | Bacteria | 1171 |
| 161 | Ga0105249_10630309 | 3300009553 | Bacteria | 1129 |
| 162 | Ga0105239_10000110 | 3300010375 | Bacteria | 115508 |
| 163 | Ga0105239_10006357 | 3300010375 | Bacteria | 13728 |
| 164 | Ga0105239_10030736 | 3300010375 | Bacteria | 5906 |
| 165 | Ga0105239_10051528 | 3300010375 | Bacteria | 4512 |
| 166 | Ga0157314_1000004 | 3300012500 | Bacteria | 31907 |
| 167 | Ga0157347_1010097 | 3300012502 | Bacteria | 986 |
| 168 | Ga0157373_10016625 | 3300013100 | Bacteria | 5363 |
| 169 | Ga0157373_10126035 | 3300013100 | Bacteria | 1801 |
| 170 | Ga0157373_10141615 | 3300013100 | Bacteria | 1691 |
| 171 | Ga0157371_10000389 | 3300013102 | Bacteria | 55195 |
| 172 | Ga0157371_10013629 | 3300013102 | Bacteria | 6169 |
| 173 | Ga0157371_10022058 | 3300013102 | Bacteria | 4671 |
| 174 | Ga0157371_10032896 | 3300013102 | Bacteria | 3729 |
| 175 | Ga0157371_10116409 | 3300013102 | Bacteria | 1899 |
| 176 | Ga0157370_10006195 | 3300013104 | Bacteria | 13264 |
| 177 | Ga0157370_10014378 | 3300013104 | Bacteria | 8093 |
| 178 | Ga0157370_10027198 | 3300013104 | Bacteria | 5640 |
| 179 | Ga0157370_10036755 | 3300013104 | Bacteria | 4751 |
| 180 | Ga0157370_10056630 | 3300013104 | Bacteria | 3731 |
| 181 | Ga0157370_10062095 | 3300013104 | Bacteria | 3544 |
| 182 | Ga0157370_10151877 | 3300013104 | Bacteria | 2155 |
| 183 | Ga0157370_10479238 | 3300013104 | Bacteria | 1143 |
| 184 | Ga0157369_10018809 | 3300013105 | Bacteria | 7743 |
| 185 | Ga0157369_10086649 | 3300013105 | Bacteria | 3345 |
| 186 | Ga0157369_10115360 | 3300013105 | Bacteria | 2852 |
| 187 | Ga0157369_10501388 | 3300013105 | Bacteria | 1256 |
| 188 | Ga0157369_10599455 | 3300013105 | Bacteria | 1137 |
| 189 | Ga0157372_10009339 | 3300013307 | Bacteria | 10436 |
| 190 | Ga0157372_10045284 | 3300013307 | Bacteria | 4879 |
| 191 | Ga0157372_10082206 | 3300013307 | Bacteria | 3646 |
| 192 | Ga0157372_10117003 | 3300013307 | Bacteria | 3057 |
| 193 | Ga0157372_10139505 | 3300013307 | Bacteria | 2792 |
| 194 | Ga0157372_10146151 | 3300013307 | Bacteria | 2726 |
| 195 | Ga0182008_10006961 | 3300014497 | Bacteria | 6274 |
| 196 | Ga0182008_10026987 | 3300014497 | Bacteria | 2911 |
| 197 | Ga0182008_10108975 | 3300014497 | Bacteria | 1371 |
| 198 | Ga0157376_10009453 | 3300014969 | Bacteria | 7080 |
| 199 | Ga0182006_1000200 | 3300015261 | Bacteria | 61593 |
| 200 | Ga0182005_1000019 | 3300015265 | Bacteria | 296232 |
| 201 | Ga0182005_1010470 | 3300015265 | Bacteria | 2667 |
| 202 | Ga0206356_10062314 | 3300020070 | Bacteria | 11613 |
| 203 | Ga0206356_10716613 | 3300020070 | Bacteria | 1266 |
| 204 | Ga0206356_11169423 | 3300020070 | Bacteria | 1362 |
| 205 | Ga0206354_10316166 | 3300020081 | Bacteria | 15956 |
| 206 | Ga0206354_10904655 | 3300020081 | Bacteria | 2415 |
| 207 | Ga0206353_10400454 | 3300020082 | Bacteria | 3523 |
| 208 | Ga0206353_11125515 | 3300020082 | Bacteria | 12423 |
| 209 | Ga0213872_10000051 | 3300021361 | Bacteria | 107261 |
| 210 | Ga0209435_105297 | 3300025206 | Bacteria | 1446 |
| 211 | Ga0209566_102664 | 3300025225 | Bacteria | 3139 |
| 212 | Ga0209674_100134 | 3300025226 | Bacteria | 114123 |
| 213 | Ga0209674_100400 | 3300025226 | Bacteria | 21810 |
| 214 | Ga0209674_101350 | 3300025226 | Bacteria | 6689 |
| 215 | Ga0209674_108288 | 3300025226 | Bacteria | 1242 |
| 216 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 217 | Ga0209672_100074 | 3300025228 | Bacteria | 159792 |
| 218 | Ga0209672_100501 | 3300025228 | Bacteria | 21740 |
| 219 | Ga0209672_100537 | 3300025228 | Bacteria | 20579 |
| 220 | Ga0207427_100044 | 3300025231 | Bacteria | 242623 |
| 221 | Ga0207427_100045 | 3300025231 | Bacteria | 241857 |
| 222 | Ga0207427_100132 | 3300025231 | Bacteria | 92962 |
| 223 | Ga0207427_102913 | 3300025231 | Bacteria | 4036 |
| 224 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 225 | Ga0209437_100118 | 3300025233 | Bacteria | 207534 |
| 226 | Ga0209437_100140 | 3300025233 | Bacteria | 171696 |
| 227 | Ga0209437_100365 | 3300025233 | Bacteria | 49166 |
| 228 | Ga0209437_101582 | 3300025233 | Bacteria | 5270 |
| 229 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 230 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 231 | Ga0209258_100148 | 3300025242 | Bacteria | 162743 |
| 232 | Ga0209258_100229 | 3300025242 | Bacteria | 105671 |
| 233 | Ga0209258_102228 | 3300025242 | Bacteria | 5252 |
| 234 | Ga0209646_1001015 | 3300025246 | Bacteria | 8565 |
| 235 | Ga0209646_1001085 | 3300025246 | Bacteria | 8123 |
| 236 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 237 | Ga0209026_1000061 | 3300025250 | Bacteria | 219572 |
| 238 | Ga0209026_1000088 | 3300025250 | Bacteria | 177275 |
| 239 | Ga0209026_1000743 | 3300025250 | Bacteria | 18648 |
| 240 | Ga0209026_1003877 | 3300025250 | Bacteria | 4709 |
| 241 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 242 | Ga0209148_1000041 | 3300025254 | Bacteria | 469323 |
| 243 | Ga0209148_1000138 | 3300025254 | Bacteria | 167277 |
| 244 | Ga0209148_1000191 | 3300025254 | Bacteria | 115847 |
| 245 | Ga0209148_1000626 | 3300025254 | Bacteria | 31299 |
| 246 | Ga0209759_1000259 | 3300025256 | Bacteria | 76638 |
| 247 | Ga0209759_1000364 | 3300025256 | Bacteria | 57603 |
| 248 | Ga0209759_1000853 | 3300025256 | Bacteria | 23718 |
| 249 | Ga0209759_1023526 | 3300025256 | Bacteria | 1354 |
| 250 | Ga0209759_1028944 | 3300025256 | Bacteria | 1119 |
| 251 | Ga0209759_1028966 | 3300025256 | Bacteria | 1118 |
| 252 | Ga0209129_1006347 | 3300025258 | Bacteria | 3855 |
| 253 | Ga0209129_1006836 | 3300025258 | Bacteria | 3562 |
| 254 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 255 | Ga0209233_1000046 | 3300025261 | Bacteria | 470971 |
| 256 | Ga0209233_1000116 | 3300025261 | Bacteria | 241857 |
| 257 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 258 | Ga0209455_1000111 | 3300025272 | Bacteria | 188820 |
| 259 | Ga0209455_1000124 | 3300025272 | Bacteria | 167073 |
| 260 | Ga0209455_1017039 | 3300025272 | Bacteria | 1540 |
| 261 | Ga0209758_1001002 | 3300025297 | Bacteria | 37583 |
| 262 | Ga0209758_1012534 | 3300025297 | Bacteria | 4730 |
| 263 | Ga0209256_1000053 | 3300025299 | Bacteria | 298731 |
| 264 | Ga0209256_1082780 | 3300025299 | Bacteria | 697 |
| 265 | Ga0209257_1000372 | 3300025304 | Bacteria | 90110 |
| 266 | Ga0207656_10000893 | 3300025321 | Bacteria | 9732 |
| 267 | Ga0207696_1000112 | 3300025711 | Bacteria | 154384 |
| 268 | Ga0207655_1024444 | 3300025728 | Bacteria | 2961 |
| 269 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 270 | Ga0207647_10000992 | 3300025904 | Bacteria | 22010 |
| 271 | Ga0207647_10001759 | 3300025904 | Bacteria | 16623 |
| 272 | Ga0207647_10002879 | 3300025904 | Bacteria | 12965 |
| 273 | Ga0207705_10000029 | 3300025909 | Bacteria | 239897 |
| 274 | Ga0207705_10000287 | 3300025909 | Bacteria | 47411 |
| 275 | Ga0207705_10001167 | 3300025909 | Bacteria | 21405 |
| 276 | Ga0207705_10061270 | 3300025909 | Bacteria | 2718 |
| 277 | Ga0207705_10491543 | 3300025909 | Bacteria | 953 |
| 278 | Ga0207684_10023526 | 3300025910 | Bacteria | 5261 |
| 279 | Ga0207654_10119412 | 3300025911 | Bacteria | 1653 |
| 280 | Ga0207707_10000042 | 3300025912 | Bacteria | 126050 |
| 281 | Ga0207707_10000049 | 3300025912 | Bacteria | 117480 |
| 282 | Ga0207707_10000593 | 3300025912 | Bacteria | 36498 |
| 283 | Ga0207707_10001410 | 3300025912 | Bacteria | 22263 |
| 284 | Ga0207707_10016123 | 3300025912 | Bacteria | 6516 |
| 285 | Ga0207707_10365520 | 3300025912 | Bacteria | 1242 |
| 286 | Ga0207695_10000207 | 3300025913 | Bacteria | 160390 |
| 287 | Ga0207695_10001055 | 3300025913 | Bacteria | 48329 |
| 288 | Ga0207695_10001939 | 3300025913 | Bacteria | 32146 |
| 289 | Ga0207695_10002014 | 3300025913 | Bacteria | 31286 |
| 290 | Ga0207695_10002579 | 3300025913 | Bacteria | 26579 |
| 291 | Ga0207695_10006926 | 3300025913 | Bacteria | 14565 |
| 292 | Ga0207695_10056970 | 3300025913 | Bacteria | 4063 |
| 293 | Ga0207695_10061185 | 3300025913 | Bacteria | 3893 |
| 294 | Ga0207695_10339334 | 3300025913 | Bacteria | 1390 |
| 295 | Ga0207671_10000009 | 3300025914 | Bacteria | 724862 |
| 296 | Ga0207671_10121423 | 3300025914 | Bacteria | 1997 |
| 297 | Ga0207693_10031845 | 3300025915 | Bacteria | 4166 |
| 298 | Ga0207663_10132001 | 3300025916 | Bacteria | 1727 |
| 299 | Ga0207660_10000206 | 3300025917 | Bacteria | 37525 |
| 300 | Ga0207660_10007024 | 3300025917 | Bacteria | 7291 |
| 301 | Ga0207660_10060647 | 3300025917 | Bacteria | 2721 |
| 302 | Ga0207660_10379896 | 3300025917 | Bacteria | 1135 |
| 303 | Ga0207657_10000915 | 3300025919 | Bacteria | 31217 |
| 304 | Ga0207657_10002290 | 3300025919 | Bacteria | 20745 |
| 305 | Ga0207657_10037493 | 3300025919 | Bacteria | 4327 |
| 306 | Ga0207657_10132155 | 3300025919 | Bacteria | 2045 |
| 307 | Ga0207649_10000219 | 3300025920 | Bacteria | 46974 |
| 308 | Ga0207649_10152140 | 3300025920 | Bacteria | 1595 |
| 309 | Ga0207652_10000014 | 3300025921 | Bacteria | 196569 |
| 310 | Ga0207652_10000099 | 3300025921 | Bacteria | 93755 |
| 311 | Ga0207652_10000530 | 3300025921 | Bacteria | 38813 |
| 312 | Ga0207652_10001294 | 3300025921 | Bacteria | 22263 |
| 313 | Ga0207652_10299460 | 3300025921 | Bacteria | 1451 |
| 314 | Ga0207652_10315163 | 3300025921 | Bacteria | 1412 |
| 315 | Ga0207652_10333290 | 3300025921 | Bacteria | 1370 |
| 316 | Ga0207646_10050463 | 3300025922 | Bacteria | 3723 |
| 317 | Ga0207646_10069117 | 3300025922 | Bacteria | 3155 |
| 318 | Ga0207694_10015820 | 3300025924 | Bacteria | 5692 |
| 319 | Ga0207694_10046714 | 3300025924 | Bacteria | 3347 |
| 320 | Ga0207694_10049776 | 3300025924 | Bacteria | 3243 |
| 321 | Ga0207694_10109688 | 3300025924 | Bacteria | 2194 |
| 322 | Ga0207694_10156175 | 3300025924 | Bacteria | 1840 |
| 323 | Ga0207694_10169738 | 3300025924 | Bacteria | 1766 |
| 324 | Ga0207650_10021670 | 3300025925 | Bacteria | 4542 |
| 325 | Ga0207659_10174796 | 3300025926 | Bacteria | 1697 |
| 326 | Ga0207664_10000030 | 3300025929 | Bacteria | 179903 |
| 327 | Ga0207664_10006402 | 3300025929 | Bacteria | 8099 |
| 328 | Ga0207664_10027244 | 3300025929 | Bacteria | 4330 |
| 329 | Ga0207690_10000096 | 3300025932 | Bacteria | 72704 |
| 330 | Ga0207690_10000645 | 3300025932 | Bacteria | 22382 |
| 331 | Ga0207690_10001295 | 3300025932 | Bacteria | 15794 |
| 332 | Ga0207690_10027620 | 3300025932 | Bacteria | 3588 |
| 333 | Ga0207690_10030825 | 3300025932 | Bacteria | 3425 |
| 334 | Ga0207690_10639399 | 3300025932 | Bacteria | 871 |
| 335 | Ga0207706_10041666 | 3300025933 | Bacteria | 4070 |
| 336 | Ga0207706_10253489 | 3300025933 | Bacteria | 1537 |
| 337 | Ga0207706_10446857 | 3300025933 | Bacteria | 1118 |
| 338 | Ga0207670_10001961 | 3300025936 | Bacteria | 10795 |
| 339 | Ga0207661_10003106 | 3300025944 | Bacteria | 11494 |
| 340 | Ga0207661_10303880 | 3300025944 | Bacteria | 1431 |
| 341 | Ga0207679_10007358 | 3300025945 | Bacteria | 6981 |
| 342 | Ga0207679_10083942 | 3300025945 | Bacteria | 2443 |
| 343 | Ga0207667_10000063 | 3300025949 | Bacteria | 188281 |
| 344 | Ga0207667_10000075 | 3300025949 | Bacteria | 169836 |
| 345 | Ga0207667_10000632 | 3300025949 | Bacteria | 45561 |
| 346 | Ga0207667_10001316 | 3300025949 | Bacteria | 31151 |
| 347 | Ga0207667_10002093 | 3300025949 | Bacteria | 25017 |
| 348 | Ga0207667_10003345 | 3300025949 | Bacteria | 19793 |
| 349 | Ga0207667_10079470 | 3300025949 | Bacteria | 3399 |
| 350 | Ga0207667_10136269 | 3300025949 | Bacteria | 2528 |
| 351 | Ga0207667_10163526 | 3300025949 | Bacteria | 2288 |
| 352 | Ga0207667_10197523 | 3300025949 | Bacteria | 2064 |
| 353 | Ga0207712_10366075 | 3300025961 | Bacteria | 1202 |
| 354 | Ga0207640_10000688 | 3300025981 | Bacteria | 19683 |
| 355 | Ga0207640_10001363 | 3300025981 | Bacteria | 13207 |
| 356 | Ga0207640_10010165 | 3300025981 | Bacteria | 5290 |
| 357 | Ga0207640_10010866 | 3300025981 | Bacteria | 5139 |
| 358 | Ga0207640_10104222 | 3300025981 | Bacteria | 1996 |
| 359 | Ga0207658_11080817 | 3300025986 | Bacteria | 733 |
| 360 | Ga0207703_10127666 | 3300026035 | Bacteria | 2192 |
| 361 | Ga0207639_10000382 | 3300026041 | Bacteria | 30487 |
| 362 | Ga0207639_10002253 | 3300026041 | Bacteria | 12968 |
| 363 | Ga0207639_10089690 | 3300026041 | Bacteria | 2457 |
| 364 | Ga0207639_10213894 | 3300026041 | Bacteria | 1661 |
| 365 | Ga0207639_10252911 | 3300026041 | Bacteria | 1537 |
| 366 | Ga0207678_10001323 | 3300026067 | Bacteria | 22871 |
| 367 | Ga0207678_10001825 | 3300026067 | Bacteria | 19516 |
| 368 | Ga0207678_10042229 | 3300026067 | Bacteria | 3952 |
| 369 | Ga0207678_10077646 | 3300026067 | Bacteria | 2844 |
| 370 | Ga0207678_10133021 | 3300026067 | Bacteria | 2122 |
| 371 | Ga0207702_10001267 | 3300026078 | Bacteria | 25378 |
| 372 | Ga0207702_10007397 | 3300026078 | Bacteria | 9374 |
| 373 | Ga0207702_10335499 | 3300026078 | Bacteria | 1443 |
| 374 | Ga0207702_10417920 | 3300026078 | Bacteria | 1296 |
| 375 | Ga0207702_10767968 | 3300026078 | Bacteria | 952 |
| 376 | Ga0207674_10000123 | 3300026116 | Bacteria | 89456 |
| 377 | Ga0207674_10004272 | 3300026116 | Bacteria | 17227 |
| 378 | Ga0207674_10026119 | 3300026116 | Bacteria | 6212 |
| 379 | Ga0207674_10043271 | 3300026116 | Bacteria | 4644 |
| 380 | Ga0207674_10062532 | 3300026116 | Bacteria | 3760 |
| 381 | Ga0207698_10000152 | 3300026142 | Bacteria | 44402 |
| 382 | Ga0207698_10020563 | 3300026142 | Bacteria | 4546 |
| 383 | Ga0209813_10030995 | 3300027866 | Bacteria | 1576 |
| 384 | Ga0307408_100218658 | 3300031548 | Bacteria | 1553 |
| 385 | Ga0307514_10002825 | 3300031649 | Bacteria | 17404 |
| 386 | Ga0307405_10895387 | 3300031731 | Bacteria | 750 |
| 387 | Ga0307412_10000340 | 3300031911 | Bacteria | 29344 |
| 388 | Ga0307409_100638772 | 3300031995 | Bacteria | 1057 |
| 389 | Ga0373925_0215671 | 3300037068 | Bacteria | 1530 |
| 390 | Ga0395899_0000051 | 3300037312 | Bacteria | 222620 |
| 391 | Ga0395899_0020714 | 3300037312 | Bacteria | 4986 |
| 392 | Ga0395899_0072369 | 3300037312 | Bacteria | 2522 |
| 393 | Ga0395899_0436214 | 3300037312 | Bacteria | 860 |
| 394 | Ga0395900_0000047 | 3300037418 | Bacteria | 230039 |
| 395 | Ga0395900_0001206 | 3300037418 | Bacteria | 31971 |
| 396 | Ga0395900_0003339 | 3300037418 | Bacteria | 17336 |
| 397 | Ga0395900_0246871 | 3300037418 | Bacteria | 1788 |
| 398 | Ga0395900_1049944 | 3300037418 | Bacteria | 733 |
| 399 | Ga0395898_0000045 | 3300037466 | Bacteria | 297127 |
| 400 | Ga0395898_0000090 | 3300037466 | Bacteria | 237876 |
| 401 | Ga0395898_0009199 | 3300037466 | Bacteria | 10399 |
| 402 | Ga0395898_0015954 | 3300037466 | Bacteria | 7695 |
| 403 | Ga0395905_0001415 | 3300037471 | Bacteria | 28991 |
| 404 | Ga0395905_0014901 | 3300037471 | Bacteria | 7418 |
| 405 | Ga0395905_0036614 | 3300037471 | Bacteria | 4609 |
| 406 | Ga0395901_0002065 | 3300038443 | Bacteria | 20602 |
| 407 | Ga0395901_0057457 | 3300038443 | Bacteria | 4046 |
| 408 | Ga0395901_0110379 | 3300038443 | Bacteria | 2887 |
| 409 | Ga0395901_0130255 | 3300038443 | Bacteria | 2643 |
| 410 | Ga0395901_0154620 | 3300038443 | Bacteria | 2409 |
| 411 | Ga0395901_0201435 | 3300038443 | Bacteria | 2086 |
| 412 | Ga0395901_0299605 | 3300038443 | Bacteria | 1667 |
| 413 | Ga0395901_0347048 | 3300038443 | Bacteria | 1532 |
| 414 | Ga0395901_0359511 | 3300038443 | Bacteria | 1501 |
| 415 | Ga0395901_0362844 | 3300038443 | Bacteria | 1493 |
| 416 | Ga0395901_0918248 | 3300038443 | Bacteria | 856 |
| 417 | Ga0436361_0939166 | 3300039447 | Bacteria | 85026 |
| 418 | Ga0436361_0971268 | 3300039447 | Bacteria | 3158 |
| 419 | Ga0439436_0000002 | 3300041404 | Bacteria | 248787 |
| 420 | Ga0439465_0000242 | 3300041413 | Bacteria | 14969 |
| 421 | Ga0451793_0204049 | 3300041452 | Bacteria | 3268 |
| 422 | Ga0439433_0041246 | 3300041999 | Bacteria | 1075 |
| 423 | Ga0439432_090235 | 3300042006 | Bacteria | 923 |
| 424 | Ga0439463_042958 | 3300042016 | Bacteria | 1150 |
| 425 | Ga0450890_000920 | 3300042127 | Bacteria | 4254 |
| 426 | Ga0450897_008653 | 3300042128 | Bacteria | 950 |
| 427 | Ga0439459_0098872 | 3300042438 | Bacteria | 711 |
| 428 | Ga0466969_0001223 | 3300044656 | Bacteria | 13874 |
| 429 | Ga0466969_0013974 | 3300044656 | Bacteria | 4226 |
| 430 | Ga0466982_0000006 | 3300044672 | Bacteria | 333931 |
| 431 | Ga0466982_0000297 | 3300044672 | Bacteria | 13627 |
| 432 | Ga0466965_0016400 | 3300044683 | Bacteria | 3525 |
| 433 | Ga0466965_0056866 | 3300044683 | Bacteria | 1948 |
| 434 | Ga0466966_0004763 | 3300044684 | Bacteria | 8932 |
| 435 | Ga0466966_0012514 | 3300044684 | Bacteria | 5619 |
| 436 | Ga0466961_0000281 | 3300044693 | Bacteria | 33824 |
| 437 | Ga0466961_0000682 | 3300044693 | Bacteria | 21417 |
| 438 | Ga0466961_0165753 | 3300044693 | Bacteria | 1375 |
| 439 | Ga0466963_0276530 | 3300044694 | Bacteria | 1180 |
| 440 | Ga0466963_0473166 | 3300044694 | Bacteria | 884 |
| 441 | Ga0466964_0008994 | 3300044706 | Bacteria | 3759 |
| 442 | Ga0466971_0001522 | 3300044719 | Bacteria | 9778 |
| 443 | Ga0466968_0030703 | 3300044735 | Bacteria | 2227 |
| 444 | Ga0466970_0070255 | 3300044765 | Bacteria | 1882 |
| 445 | Ga0466970_0128371 | 3300044765 | Bacteria | 1392 |
| 446 | Ga0466970_0199715 | 3300044765 | Bacteria | 1112 |
| 447 | Ga0466957_0072880 | 3300044842 | Bacteria | 2127 |
| 448 | Ga0466960_0117430 | 3300044901 | Bacteria | 1389 |
| 449 | Ga0466959_0000081 | 3300045049 | Bacteria | 59780 |
| 450 | Ga0466959_0010702 | 3300045049 | Bacteria | 6569 |
| 451 | Ga0466959_0038964 | 3300045049 | Bacteria | 3511 |
| 452 | Ga0466959_0094125 | 3300045049 | Bacteria | 2149 |
| 453 | Ga0466959_0132810 | 3300045049 | Bacteria | 1763 |
| 454 | Ga0466958_0042735 | 3300045836 | Bacteria | 2729 |
| 455 | Ga0466958_0080410 | 3300045836 | Bacteria | 2005 |
| 456 | Ga0466967_0125692 | 3300045976 | Bacteria | 2375 |
| 457 | Ga0495627_002353 | 3300046453 | Bacteria | 9233 |
| 458 | Ga0495590_0006140 | 3300046457 | Bacteria | 4708 |
| 459 | Ga0495638_0000272 | 3300046460 | Bacteria | 69973 |
| 460 | Ga0495638_0000290 | 3300046460 | Bacteria | 66116 |
| 461 | Ga0495650_0000210 | 3300046471 | Bacteria | 125249 |
| 462 | Ga0495650_0077467 | 3300046471 | Bacteria | 1290 |
| 463 | Ga0495607_0000809 | 3300046501 | Bacteria | 29653 |
| 464 | Ga0495607_0078275 | 3300046501 | Bacteria | 1824 |
| 465 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 466 | Ga0495606_0002764 | 3300046507 | Bacteria | 19666 |
| 467 | Ga0495610_0000909 | 3300046512 | Bacteria | 27543 |
| 468 | Ga0495616_0181732 | 3300046513 | Bacteria | 934 |
| 469 | Ga0495631_0015568 | 3300046518 | Bacteria | 3641 |
| 470 | Ga0495632_0040960 | 3300046519 | Bacteria | 2329 |
| 471 | Ga0495632_0087237 | 3300046519 | Bacteria | 1483 |
| 472 | Ga0495654_0015932 | 3300046530 | Bacteria | 3983 |
| 473 | Ga0495622_0010379 | 3300046557 | Bacteria | 4306 |
| 474 | Ga0495625_0043348 | 3300046660 | Bacteria | 3263 |
| 475 | Ga0495625_0129926 | 3300046660 | Bacteria | 1707 |
| 476 | Ga0495670_0001325 | 3300046691 | Bacteria | 12075 |
| 477 | Ga0495671_0021722 | 3300046692 | Bacteria | 3367 |
| 478 | Ga0495649_0001640 | 3300046694 | Bacteria | 16636 |
| 479 | Ga0495660_0103897 | 3300046810 | Bacteria | 1459 |
| 480 | Ga0495636_0001686 | 3300047318 | Bacteria | 8417 |
| 481 | Ga0495672_0006102 | 3300047320 | Bacteria | 9410 |
| 482 | Ga0496100_0045795 | 3300048903 | Bacteria | 2809 |
| 483 | Ga0496104_0319482 | 3300048907 | Bacteria | 1465 |
| 484 | Ga0496105_0002754 | 3300048908 | Bacteria | 12835 |
| 485 | Ga0496105_0290199 | 3300048908 | Bacteria | 1317 |
| 486 | Ga0496107_0111166 | 3300048910 | Bacteria | 2014 |
| 487 | Ga0496107_0535092 | 3300048910 | Bacteria | 868 |
| 488 | Ga0496108_0205104 | 3300048911 | Bacteria | 1711 |
| 489 | Ga0496109_0027610 | 3300048912 | Bacteria | 5070 |
| 490 | Ga0496110_0075502 | 3300048913 | Bacteria | 2995 |
| 491 | Ga0496110_0159988 | 3300048913 | Bacteria | 2041 |
| 492 | Ga0496113_0300007 | 3300048916 | Bacteria | 1286 |
| 493 | Ga0496113_0411710 | 3300048916 | Bacteria | 1086 |
| 494 | Ga0496114_0035070 | 3300048917 | Bacteria | 4142 |
| 495 | Ga0496115_0000089 | 3300048918 | Bacteria | 85894 |
| 496 | Ga0496115_0092346 | 3300048918 | Bacteria | 2474 |
| 497 | Ga0496115_0501530 | 3300048918 | Bacteria | 975 |
| 498 | Ga0496116_0082189 | 3300048919 | Bacteria | 1994 |
| 499 | Ga0496116_0140565 | 3300048919 | Bacteria | 1359 |
| 500 | Ga0496117_0031116 | 3300048920 | Bacteria | 4081 |
| 501 | Ga0496117_0042327 | 3300048920 | Bacteria | 3324 |
| 502 | Ga0496118_0004450 | 3300048921 | Bacteria | 16613 |
| 503 | Ga0496118_0030229 | 3300048921 | Bacteria | 4524 |
| 504 | Ga0496119_0000029 | 3300048922 | Bacteria | 243194 |
| 505 | Ga0496119_0005785 | 3300048922 | Bacteria | 11704 |
| 506 | Ga0496120_0000015 | 3300048923 | Bacteria | 310795 |
| 507 | Ga0496120_0000039 | 3300048923 | Bacteria | 202237 |
| 508 | Ga0496121_0000408 | 3300048924 | Bacteria | 85494 |
| 509 | Ga0496121_0047674 | 3300048924 | Bacteria | 3653 |
| 510 | Ga0496122_0018751 | 3300048925 | Bacteria | 6366 |
| 511 | Ga0496123_0006068 | 3300048926 | Bacteria | 11858 |
| 512 | Ga0496124_0000079 | 3300048927 | Bacteria | 212057 |
| 513 | Ga0496124_0001305 | 3300048927 | Bacteria | 37694 |
| 514 | Ga0496125_0003327 | 3300048928 | Bacteria | 19631 |
| 515 | Ga0496125_0004803 | 3300048928 | Bacteria | 15364 |
| 516 | Ga0496126_0000259 | 3300048929 | Bacteria | 113443 |
| 517 | Ga0496126_0004791 | 3300048929 | Bacteria | 15901 |
| 518 | Ga0496126_0060183 | 3300048929 | Bacteria | 3417 |
| 519 | Ga0496126_0507032 | 3300048929 | Bacteria | 963 |
| 520 | Ga0495678_027331 | 3300049459 | Bacteria | 2421 |
| 521 | Ga0495678_044819 | 3300049459 | Bacteria | 1748 |
| 522 | Ga0495682_0002725 | 3300049460 | Bacteria | 8195 |
| 523 | Ga0501031_0578765 | 3300049568 | Bacteria | 723 |
| 524 | Ga0501033_0000901 | 3300049570 | Bacteria | 27178 |
| 525 | Ga0501033_0109401 | 3300049570 | Bacteria | 2012 |
| 526 | Ga0501033_0397010 | 3300049570 | Bacteria | 962 |
| 527 | Ga0501034_0013667 | 3300049571 | Bacteria | 8348 |
| 528 | Ga0501034_0072017 | 3300049571 | Bacteria | 3465 |
| 529 | Ga0501034_0372378 | 3300049571 | Bacteria | 1354 |
| 530 | Ga0501036_0027525 | 3300049572 | Bacteria | 4803 |
| 531 | Ga0501036_0043612 | 3300049572 | Bacteria | 3799 |
| 532 | Ga0501036_0295222 | 3300049572 | Bacteria | 1356 |
| 533 | Ga0501037_0006677 | 3300049573 | Bacteria | 8437 |
| 534 | Ga0501037_0032496 | 3300049573 | Bacteria | 3853 |
| 535 | Ga0501037_0202432 | 3300049573 | Bacteria | 1402 |
| 536 | Ga0501037_0244428 | 3300049573 | Bacteria | 1257 |
| 537 | Ga0501038_0271609 | 3300049574 | Bacteria | 1337 |
| 538 | Ga0501039_0333759 | 3300049575 | Bacteria | 1191 |
| 539 | Ga0501043_0035242 | 3300049579 | Bacteria | 3936 |
| 540 | Ga0501043_0036445 | 3300049579 | Bacteria | 3869 |
| 541 | Ga0501043_0113113 | 3300049579 | Bacteria | 2131 |
| 542 | Ga0501043_0143225 | 3300049579 | Bacteria | 1871 |
| 543 | Ga0501043_0200649 | 3300049579 | Bacteria | 1548 |
| 544 | Ga0501046_0034157 | 3300049580 | Bacteria | 4106 |
| 545 | Ga0501047_0007115 | 3300049581 | Bacteria | 10508 |
| 546 | Ga0501047_0061711 | 3300049581 | Bacteria | 3617 |
| 547 | Ga0501047_0096278 | 3300049581 | Bacteria | 2838 |
| 548 | Ga0501047_0411551 | 3300049581 | Bacteria | 1184 |
| 549 | Ga0501048_0076246 | 3300049582 | Bacteria | 2366 |
| 550 | Ga0501068_0097438 | 3300049584 | Bacteria | 1820 |
| 551 | Ga0501068_0286234 | 3300049584 | Bacteria | 1054 |
| 552 | Ga0501069_0062944 | 3300049585 | Bacteria | 2072 |
| 553 | Ga0501070_0026229 | 3300049586 | Bacteria | 4891 |
| 554 | Ga0501070_0042963 | 3300049586 | Bacteria | 3763 |
| 555 | Ga0501070_0061444 | 3300049586 | Bacteria | 3112 |
| 556 | Ga0501070_0130715 | 3300049586 | Bacteria | 2074 |
| 557 | Ga0501070_0130787 | 3300049586 | Bacteria | 2074 |
| 558 | Ga0501073_0008516 | 3300049589 | Bacteria | 7607 |
| 559 | Ga0501074_0089029 | 3300049590 | Bacteria | 2210 |
| 560 | Ga0501074_0726170 | 3300049590 | Bacteria | 701 |
| 561 | Ga0501077_0002614 | 3300049593 | Bacteria | 10784 |
| 562 | Ga0501080_1031589 | 3300049742 | Bacteria | 712 |
| 563 | Ga0501035_0023863 | 3300049822 | Bacteria | 5612 |
| 564 | Ga0501035_0031715 | 3300049822 | Bacteria | 4812 |
| 565 | Ga0501035_0082523 | 3300049822 | Bacteria | 2836 |
| 566 | Ga0501035_0106864 | 3300049822 | Bacteria | 2453 |
| 567 | Ga0501035_0133393 | 3300049822 | Bacteria | 2163 |
| 568 | Ga0501035_0276917 | 3300049822 | Bacteria | 1419 |
| 569 | Ga0501044_0006314 | 3300049823 | Bacteria | 13106 |
| 570 | Ga0501044_0046674 | 3300049823 | Bacteria | 4484 |
| 571 | Ga0501044_0055054 | 3300049823 | Bacteria | 4086 |
| 572 | Ga0501044_0066239 | 3300049823 | Bacteria | 3683 |
| 573 | Ga0501044_0121603 | 3300049823 | Bacteria | 2611 |
| 574 | nmdc:mga0k408_59608_c1 | 3300050493 | Bacteria | 2218 |
| 575 | nmdc:mga06z11_9203_c1 | 3300050494 | Bacteria | 4152 |
| 576 | nmdc:mga04h51_29884_c1 | 3300050495 | Bacteria | 1711 |
| 577 | Ga0466962_0000256 | 3300061719 | Bacteria | 22473 |
| 578 | Ga0466962_0017645 | 3300061719 | Bacteria | 3437 |
| 579 | Ga0466962_0051596 | 3300061719 | Bacteria | 1967 |
| 580 | 2538833535 | 2537561836 | Bacteria | 3910579 |
| 581 | 2595448562 | 2593339238 | Bacteria | 4182970 |
| 582 | 2643828639 | 2643221562 | Bacteria | 4048635 |
| 583 | 2687584938 | 2687453130 | Bacteria | 4227172 |
| 584 | 2739733280 | 2739367700 | Bacteria | 4747630 |
| 585 | 2819564592 | 2818991440 | Bacteria | 4774720 |
| 586 | 2842921291 | 2842918807 | Bacteria | 4289178 |
| 587 | 2886853471 | 2886848708 | Bacteria | 5632523 |
| 588 | 2895397988 | 2895395659 | Bacteria | 3983269 |
| 589 | 2904465239 | 2904463128 | Bacteria | 4775606 |
| 590 | 2919088744 | 2919085039 | Bacteria | 4532964 |
| 591 | 2919407354 | 2919404418 | Bacteria | 4232372 |
| 592 | 2919496437 | 2919493220 | Bacteria | 4598500 |
| 593 | 2919546972 | 2919543075 | Bacteria | 4728703 |
| 594 | 2923526618 | 2923525760 | Bacteria | 4472324 |
| 595 | 2928967017 | 2928963466 | Bacteria | 5165703 |
| 596 | 2939613549 | 2939611941 | Bacteria | 3892017 |
| 597 | 2953996534 | 2953994433 | Bacteria | 4303959 |
| 598 | 2987607018 | 2987605356 | Bacteria | 4187822 |
| 599 | Ga0466960_0267596 | |||
| 600 | JGI24741J21665_1000527 | |||
| 601 | JGI24741J21665_1022688 | |||
| 602 | JGI24740J21852_10000025 | |||
| 603 | JGI24737J22298_10006940 | |||
| 604 | JGI24735J21928_10040825 | |||
| 605 | JGI24735J21928_10082934 | |||
| 606 | JGI24738J21930_10001231 | |||
| 607 | JGI25156J39149_1000251 | |||
| 608 | JGI25156J39149_1014166 | |||
| 609 | JGI25156J39149_1018401 | |||
| 610 | JGI25156J39149_1027051 | |||
| 611 | JGI25162J39368_1001521 | |||
| 612 | JGI25162J39368_1001749 | |||
| 613 | JGI25162J39368_1002711 | |||
| 614 | JGI25157J39369_1000288 | |||
| 615 | JGI25157J39369_1001779 | |||
| 616 | JGI25157J39369_1015349 | |||
| 617 | JGI25157J39369_1018853 | |||
| 618 | JGI25164J39214_1000105 | |||
| 619 | JGI25164J39214_1000473 | |||
| 620 | JGI25164J39214_1002318 | |||
| 621 | JGI25165J46597_1000155 | |||
| 622 | JGI25165J46597_1001813 | |||
| 623 | JGI25153J46596_10019219 | |||
| 624 | rootH1_10026611 | |||
| 625 | rootH2_10077984 | |||
| 626 | rootH2_10094176 | |||
| 627 | Ga0006562J51391_1011837 | |||
| 628 | Ga0006562J51391_1011840 | |||
| 629 | Ga0055539_1001091 | |||
| 630 | Ga0055527_1000037 | |||
| 631 | Ga0055535_1000059 | |||
| 632 | Ga0055535_1000211 | |||
| 633 | Ga0055535_1000367 | |||
| 634 | Ga0055542_1000086 | |||
| 635 | Ga0055542_1000117 | |||
| 636 | Ga0055542_1000288 | |||
| 637 | Ga0055542_1001245 | |||
| 638 | Ga0055529_1000212 | |||
| 639 | Ga0055529_1000307 | |||
| 640 | Ga0055524_1011072 | |||
| 641 | Ga0055531_10014643 | |||
| 642 | Ga0065165_1000343 | |||
| 643 | Ga0065165_1002670 | |||
| 644 | Ga0065715_10108317 | |||
| 645 | Ga0070658_10652884 | |||
| 646 | Ga0070658_10744417 | |||
| 647 | Ga0070683_100610066 | |||
| 648 | Ga0070670_100041832 | |||
| 649 | Ga0070680_100000150 | |||
| 650 | Ga0070680_100000429 | |||
| 651 | Ga0070682_100001327 | |||
| 652 | Ga0070682_100059551 | |||
| 653 | Ga0070682_100062357 | |||
| 654 | Ga0070660_100271390 | |||
| 655 | Ga0070689_100003901 | |||
| 656 | Ga0070691_10001084 | |||
| 657 | Ga0070691_10013828 | |||
| 658 | Ga0070661_100028277 | |||
| 659 | Ga0070661_100042592 | |||
| 660 | Ga0070661_100104058 | |||
| 661 | Ga0070661_100237190 | |||
| 662 | Ga0070661_100297415 | |||
| 663 | Ga0070692_10003181 | |||
| 664 | Ga0070692_10004779 | |||
| 665 | Ga0070692_10020287 | |||
| 666 | Ga0070692_10083100 | |||
| 667 | Ga0070659_100021824 | |||
| 668 | Ga0070659_100039724 | |||
| 669 | Ga0070659_100233473 | |||
| 670 | Ga0070714_100000055 | |||
| 671 | Ga0070714_100031357 | |||
| 672 | Ga0070713_100022992 | |||
| 673 | Ga0070694_100031712 | |||
| 674 | Ga0070694_100054655 | |||
| 675 | Ga0070694_100556418 | |||
| 676 | Ga0070708_100451751 | |||
| 677 | Ga0070663_100014903 | |||
| 678 | Ga0070663_100087968 | |||
| 679 | Ga0070663_100090252 | |||
| 680 | Ga0070663_100412323 | |||
| 681 | Ga0070662_100037955 | |||
| 682 | Ga0070681_10000082 | |||
| 683 | Ga0070681_10028349 | |||
| 684 | Ga0070707_100024364 | |||
| 685 | Ga0070707_100046258 | |||
| 686 | Ga0070698_100120638 | |||
| 687 | Ga0070699_100067925 | |||
| 688 | Ga0070699_100156450 | |||
| 689 | Ga0070679_100000166 | |||
| 690 | Ga0070679_100160539 | |||
| 691 | Ga0070679_100221378 | |||
| 692 | Ga0070679_100312160 | |||
| 693 | Ga0070679_100726816 | |||
| 694 | Ga0070684_100028303 | |||
| 695 | Ga0068853_100024814 | |||
| 696 | Ga0068853_100099567 | |||
| 697 | Ga0068853_100229071 | |||
| 698 | Ga0070696_100005544 | |||
| 699 | Ga0070696_100037550 | |||
| 700 | Ga0070696_100144196 | |||
| 701 | Ga0070693_100000680 | |||
| 702 | Ga0070693_100024242 | |||
| 703 | Ga0068855_100005319 | |||
| 704 | Ga0068855_100010220 | |||
| 705 | Ga0068855_100065211 | |||
| 706 | Ga0068855_100076467 | |||
| 707 | Ga0068855_100093997 | |||
| 708 | Ga0070664_100028080 | |||
| 709 | Ga0070664_100146272 | |||
| 710 | Ga0068857_100000241 | |||
| 711 | Ga0068857_100118246 | |||
| 712 | Ga0068857_100213871 | |||
| 713 | Ga0068854_100002387 | |||
| 714 | Ga0068854_100004331 | |||
| 715 | Ga0068854_100025011 | |||
| 716 | Ga0068854_100026609 | |||
| 717 | Ga0068854_100065003 | |||
| 718 | Ga0068856_100004861 | |||
| 719 | Ga0068856_100029617 | |||
| 720 | Ga0068856_100149214 | |||
| 721 | Ga0068856_100747158 | |||
| 722 | Ga0068856_100906937 | |||
| 723 | Ga0068852_100002474 | |||
| 724 | Ga0068852_100003494 | |||
| 725 | Ga0068852_100071762 | |||
| 726 | Ga0068851_10002340 | |||
| 727 | Ga0068851_10048466 | |||
| 728 | Ga0068860_100154588 | |||
| 729 | Ga0068862_100140428 | |||
| 730 | Ga0075368_10037529 | |||
| 731 | Ga0070712_100223857 | |||
| 732 | Ga0075362_10004645 | |||
| 733 | Ga0075367_10007898 | |||
| 734 | Ga0075369_10075689 | |||
| 735 | Ga0075366_10042527 | |||
| 736 | Ga0105251_10000057 | |||
| 737 | Ga0105250_10000784 | |||
| 738 | Ga0105250_10238491 | |||
| 739 | Ga0105240_10000197 | |||
| 740 | Ga0105240_10000199 | |||
| 741 | Ga0105240_10009428 | |||
| 742 | Ga0105240_10011697 | |||
| 743 | Ga0105240_10033751 | |||
| 744 | Ga0105240_10215520 | |||
| 745 | Ga0105240_10248726 | |||
| 746 | Ga0105240_10381873 | |||
| 747 | Ga0105240_10505039 | |||
| 748 | Ga0105237_10000212 | |||
| 749 | Ga0105237_10041079 | |||
| 750 | Ga0105237_10127409 | |||
| 751 | Ga0105237_10809385 | |||
| 752 | Ga0105238_10001210 | |||
| 753 | Ga0105238_10032581 | |||
| 754 | Ga0105238_10034811 | |||
| 755 | Ga0105238_10057703 | |||
| 756 | Ga0105238_10082334 | |||
| 757 | Ga0105238_10248642 | |||
| 758 | Ga0105249_10583659 | |||
| 759 | Ga0105249_10630309 | |||
| 760 | Ga0105239_10000110 | |||
| 761 | Ga0105239_10006357 | |||
| 762 | Ga0105239_10030736 | |||
| 763 | Ga0105239_10051528 | |||
| 764 | Ga0157314_1000004 | |||
| 765 | Ga0157347_1010097 | |||
| 766 | Ga0157373_10016625 | |||
| 767 | Ga0157373_10126035 | |||
| 768 | Ga0157373_10141615 | |||
| 769 | Ga0157371_10000389 | |||
| 770 | Ga0157371_10013629 | |||
| 771 | Ga0157371_10022058 | |||
| 772 | Ga0157371_10032896 | |||
| 773 | Ga0157371_10116409 | |||
| 774 | Ga0157370_10006195 | |||
| 775 | Ga0157370_10014378 | |||
| 776 | Ga0157370_10027198 | |||
| 777 | Ga0157370_10036755 | |||
| 778 | Ga0157370_10056630 | |||
| 779 | Ga0157370_10062095 | |||
| 780 | Ga0157370_10151877 | |||
| 781 | Ga0157370_10479238 | |||
| 782 | Ga0157369_10018809 | |||
| 783 | Ga0157369_10086649 | |||
| 784 | Ga0157369_10115360 | |||
| 785 | Ga0157369_10501388 | |||
| 786 | Ga0157369_10599455 | |||
| 787 | Ga0157372_10009339 | |||
| 788 | Ga0157372_10045284 | |||
| 789 | Ga0157372_10082206 | |||
| 790 | Ga0157372_10117003 | |||
| 791 | Ga0157372_10139505 | |||
| 792 | Ga0157372_10146151 | |||
| 793 | Ga0182008_10006961 | |||
| 794 | Ga0182008_10026987 | |||
| 795 | Ga0182008_10108975 | |||
| 796 | Ga0157376_10009453 | |||
| 797 | Ga0182006_1000200 | |||
| 798 | Ga0182005_1000019 | |||
| 799 | Ga0182005_1010470 | |||
| 800 | Ga0206356_10062314 | |||
| 801 | Ga0206356_10716613 | |||
| 802 | Ga0206356_11169423 | |||
| 803 | Ga0206354_10316166 | |||
| 804 | Ga0206354_10904655 | |||
| 805 | Ga0206353_10400454 | |||
| 806 | Ga0206353_11125515 | |||
| 807 | Ga0213872_10000051 | |||
| 808 | Ga0209435_105297 | |||
| 809 | Ga0209566_102664 | |||
| 810 | Ga0209674_100134 | |||
| 811 | Ga0209674_100400 | |||
| 812 | Ga0209674_101350 | |||
| 813 | Ga0209674_108288 | |||
| 814 | Ga0209672_100008 | |||
| 815 | Ga0209672_100074 | |||
| 816 | Ga0209672_100501 | |||
| 817 | Ga0209672_100537 | |||
| 818 | Ga0207427_100044 | |||
| 819 | Ga0207427_100045 | |||
| 820 | Ga0207427_100132 | |||
| 821 | Ga0207427_102913 | |||
| 822 | Ga0209437_100005 | |||
| 823 | Ga0209437_100118 | |||
| 824 | Ga0209437_100140 | |||
| 825 | Ga0209437_100365 | |||
| 826 | Ga0209437_101582 | |||
| 827 | Ga0209258_100004 | |||
| 828 | Ga0209258_100008 | |||
| 829 | Ga0209258_100148 | |||
| 830 | Ga0209258_100229 | |||
| 831 | Ga0209258_102228 | |||
| 832 | Ga0209646_1001015 | |||
| 833 | Ga0209646_1001085 | |||
| 834 | Ga0209026_1000010 | |||
| 835 | Ga0209026_1000061 | |||
| 836 | Ga0209026_1000088 | |||
| 837 | Ga0209026_1000743 | |||
| 838 | Ga0209026_1003877 | |||
| 839 | Ga0209148_1000002 | |||
| 840 | Ga0209148_1000041 | |||
| 841 | Ga0209148_1000138 | |||
| 842 | Ga0209148_1000191 | |||
| 843 | Ga0209148_1000626 | |||
| 844 | Ga0209759_1000259 | |||
| 845 | Ga0209759_1000364 | |||
| 846 | Ga0209759_1000853 | |||
| 847 | Ga0209759_1023526 | |||
| 848 | Ga0209759_1028944 | |||
| 849 | Ga0209759_1028966 | |||
| 850 | Ga0209129_1006347 | |||
| 851 | Ga0209129_1006836 | |||
| 852 | Ga0209233_1000011 | |||
| 853 | Ga0209233_1000046 | |||
| 854 | Ga0209233_1000116 | |||
| 855 | Ga0209455_1000007 | |||
| 856 | Ga0209455_1000111 | |||
| 857 | Ga0209455_1000124 | |||
| 858 | Ga0209455_1017039 | |||
| 859 | Ga0209758_1001002 | |||
| 860 | Ga0209758_1012534 | |||
| 861 | Ga0209256_1000053 | |||
| 862 | Ga0209256_1082780 | |||
| 863 | Ga0209257_1000372 | |||
| 864 | Ga0207656_10000893 | |||
| 865 | Ga0207696_1000112 | |||
| 866 | Ga0207655_1024444 | |||
| 867 | Ga0207713_1000014 | |||
| 868 | Ga0207647_10000992 | |||
| 869 | Ga0207647_10001759 | |||
| 870 | Ga0207647_10002879 | |||
| 871 | Ga0207705_10000029 | |||
| 872 | Ga0207705_10000287 | |||
| 873 | Ga0207705_10001167 | |||
| 874 | Ga0207705_10061270 | |||
| 875 | Ga0207705_10491543 | |||
| 876 | Ga0207684_10023526 | |||
| 877 | Ga0207654_10119412 | |||
| 878 | Ga0207707_10000042 | |||
| 879 | Ga0207707_10000049 | |||
| 880 | Ga0207707_10000593 | |||
| 881 | Ga0207707_10001410 | |||
| 882 | Ga0207707_10016123 | |||
| 883 | Ga0207707_10365520 | |||
| 884 | Ga0207695_10000207 | |||
| 885 | Ga0207695_10001055 | |||
| 886 | Ga0207695_10001939 | |||
| 887 | Ga0207695_10002014 | |||
| 888 | Ga0207695_10002579 | |||
| 889 | Ga0207695_10006926 | |||
| 890 | Ga0207695_10056970 | |||
| 891 | Ga0207695_10061185 | |||
| 892 | Ga0207695_10339334 | |||
| 893 | Ga0207671_10000009 | |||
| 894 | Ga0207671_10121423 | |||
| 895 | Ga0207693_10031845 | |||
| 896 | Ga0207663_10132001 | |||
| 897 | Ga0207660_10000206 | |||
| 898 | Ga0207660_10007024 | |||
| 899 | Ga0207660_10060647 | |||
| 900 | Ga0207660_10379896 | |||
| 901 | Ga0207657_10000915 | |||
| 902 | Ga0207657_10002290 | |||
| 903 | Ga0207657_10037493 | |||
| 904 | Ga0207657_10132155 | |||
| 905 | Ga0207649_10000219 | |||
| 906 | Ga0207649_10152140 | |||
| 907 | Ga0207652_10000014 | |||
| 908 | Ga0207652_10000099 | |||
| 909 | Ga0207652_10000530 | |||
| 910 | Ga0207652_10001294 | |||
| 911 | Ga0207652_10299460 | |||
| 912 | Ga0207652_10315163 | |||
| 913 | Ga0207652_10333290 | |||
| 914 | Ga0207646_10050463 | |||
| 915 | Ga0207646_10069117 | |||
| 916 | Ga0207694_10015820 | |||
| 917 | Ga0207694_10046714 | |||
| 918 | Ga0207694_10049776 | |||
| 919 | Ga0207694_10109688 | |||
| 920 | Ga0207694_10156175 | |||
| 921 | Ga0207694_10169738 | |||
| 922 | Ga0207650_10021670 | |||
| 923 | Ga0207659_10174796 | |||
| 924 | Ga0207664_10000030 | |||
| 925 | Ga0207664_10006402 | |||
| 926 | Ga0207664_10027244 | |||
| 927 | Ga0207690_10000096 | |||
| 928 | Ga0207690_10000645 | |||
| 929 | Ga0207690_10001295 | |||
| 930 | Ga0207690_10027620 | |||
| 931 | Ga0207690_10030825 | |||
| 932 | Ga0207690_10639399 | |||
| 933 | Ga0207706_10041666 | |||
| 934 | Ga0207706_10253489 | |||
| 935 | Ga0207706_10446857 | |||
| 936 | Ga0207670_10001961 | |||
| 937 | Ga0207661_10003106 | |||
| 938 | Ga0207661_10303880 | |||
| 939 | Ga0207679_10007358 | |||
| 940 | Ga0207679_10083942 | |||
| 941 | Ga0207667_10000063 | |||
| 942 | Ga0207667_10000075 | |||
| 943 | Ga0207667_10000632 | |||
| 944 | Ga0207667_10001316 | |||
| 945 | Ga0207667_10002093 | |||
| 946 | Ga0207667_10003345 | |||
| 947 | Ga0207667_10079470 | |||
| 948 | Ga0207667_10136269 | |||
| 949 | Ga0207667_10163526 | |||
| 950 | Ga0207667_10197523 | |||
| 951 | Ga0207712_10366075 | |||
| 952 | Ga0207640_10000688 | |||
| 953 | Ga0207640_10001363 | |||
| 954 | Ga0207640_10010165 | |||
| 955 | Ga0207640_10010866 | |||
| 956 | Ga0207640_10104222 | |||
| 957 | Ga0207658_11080817 | |||
| 958 | Ga0207703_10127666 | |||
| 959 | Ga0207639_10000382 | |||
| 960 | Ga0207639_10002253 | |||
| 961 | Ga0207639_10089690 | |||
| 962 | Ga0207639_10213894 | |||
| 963 | Ga0207639_10252911 | |||
| 964 | Ga0207678_10001323 | |||
| 965 | Ga0207678_10001825 | |||
| 966 | Ga0207678_10042229 | |||
| 967 | Ga0207678_10077646 | |||
| 968 | Ga0207678_10133021 | |||
| 969 | Ga0207702_10001267 | |||
| 970 | Ga0207702_10007397 | |||
| 971 | Ga0207702_10335499 | |||
| 972 | Ga0207702_10417920 | |||
| 973 | Ga0207702_10767968 | |||
| 974 | Ga0207674_10000123 | |||
| 975 | Ga0207674_10004272 | |||
| 976 | Ga0207674_10026119 | |||
| 977 | Ga0207674_10043271 | |||
| 978 | Ga0207674_10062532 | |||
| 979 | Ga0207698_10000152 | |||
| 980 | Ga0207698_10020563 | |||
| 981 | Ga0209813_10030995 | |||
| 982 | Ga0307408_100218658 | |||
| 983 | Ga0307514_10002825 | |||
| 984 | Ga0307405_10895387 | |||
| 985 | Ga0307412_10000340 | |||
| 986 | Ga0307409_100638772 | |||
| 987 | Ga0373925_0215671 | |||
| 988 | Ga0395899_0000051 | |||
| 989 | Ga0395899_0020714 | |||
| 990 | Ga0395899_0072369 | |||
| 991 | Ga0395899_0436214 | |||
| 992 | Ga0395900_0000047 | |||
| 993 | Ga0395900_0001206 | |||
| 994 | Ga0395900_0003339 | |||
| 995 | Ga0395900_0246871 | |||
| 996 | Ga0395900_1049944 | |||
| 997 | Ga0395898_0000045 | |||
| 998 | Ga0395898_0000090 | |||
| 999 | Ga0395898_0009199 | |||
| 1000 | Ga0395898_0015954 | |||
| 1001 | Ga0395905_0001415 | |||
| 1002 | Ga0395905_0014901 | |||
| 1003 | Ga0395905_0036614 | |||
| 1004 | Ga0395901_0002065 | |||
| 1005 | Ga0395901_0057457 | |||
| 1006 | Ga0395901_0110379 | |||
| 1007 | Ga0395901_0130255 | |||
| 1008 | Ga0395901_0154620 | |||
| 1009 | Ga0395901_0201435 | |||
| 1010 | Ga0395901_0299605 | |||
| 1011 | Ga0395901_0347048 | |||
| 1012 | Ga0395901_0359511 | |||
| 1013 | Ga0395901_0362844 | |||
| 1014 | Ga0395901_0918248 | |||
| 1015 | Ga0436361_0939166 | |||
| 1016 | Ga0436361_0971268 | |||
| 1017 | Ga0439436_0000002 | |||
| 1018 | Ga0439465_0000242 | |||
| 1019 | Ga0451793_0204049 | |||
| 1020 | Ga0439433_0041246 | |||
| 1021 | Ga0439432_090235 | |||
| 1022 | Ga0439463_042958 | |||
| 1023 | Ga0450890_000920 | |||
| 1024 | Ga0450897_008653 | |||
| 1025 | Ga0439459_0098872 | |||
| 1026 | Ga0466969_0001223 | |||
| 1027 | Ga0466969_0013974 | |||
| 1028 | Ga0466982_0000006 | |||
| 1029 | Ga0466982_0000297 | |||
| 1030 | Ga0466965_0016400 | |||
| 1031 | Ga0466965_0056866 | |||
| 1032 | Ga0466966_0004763 | |||
| 1033 | Ga0466966_0012514 | |||
| 1034 | Ga0466961_0000281 | |||
| 1035 | Ga0466961_0000682 | |||
| 1036 | Ga0466961_0165753 | |||
| 1037 | Ga0466963_0276530 | |||
| 1038 | Ga0466963_0473166 | |||
| 1039 | Ga0466964_0008994 | |||
| 1040 | Ga0466971_0001522 | |||
| 1041 | Ga0466968_0030703 | |||
| 1042 | Ga0466970_0070255 | |||
| 1043 | Ga0466970_0128371 | |||
| 1044 | Ga0466970_0199715 | |||
| 1045 | Ga0466957_0072880 | |||
| 1046 | Ga0466960_0117430 | |||
| 1047 | Ga0466959_0000081 | |||
| 1048 | Ga0466959_0010702 | |||
| 1049 | Ga0466959_0038964 | |||
| 1050 | Ga0466959_0094125 | |||
| 1051 | Ga0466959_0132810 | |||
| 1052 | Ga0466958_0042735 | |||
| 1053 | Ga0466958_0080410 | |||
| 1054 | Ga0466967_0125692 | |||
| 1055 | Ga0495627_002353 | |||
| 1056 | Ga0495590_0006140 | |||
| 1057 | Ga0495638_0000272 | |||
| 1058 | Ga0495638_0000290 | |||
| 1059 | Ga0495650_0000210 | |||
| 1060 | Ga0495650_0077467 | |||
| 1061 | Ga0495607_0000809 | |||
| 1062 | Ga0495607_0078275 | |||
| 1063 | Ga0495606_0000016 | |||
| 1064 | Ga0495606_0002764 | |||
| 1065 | Ga0495610_0000909 | |||
| 1066 | Ga0495616_0181732 | |||
| 1067 | Ga0495631_0015568 | |||
| 1068 | Ga0495632_0040960 | |||
| 1069 | Ga0495632_0087237 | |||
| 1070 | Ga0495654_0015932 | |||
| 1071 | Ga0495622_0010379 | |||
| 1072 | Ga0495625_0043348 | |||
| 1073 | Ga0495625_0129926 | |||
| 1074 | Ga0495670_0001325 | |||
| 1075 | Ga0495671_0021722 | |||
| 1076 | Ga0495649_0001640 | |||
| 1077 | Ga0495660_0103897 | |||
| 1078 | Ga0495636_0001686 | |||
| 1079 | Ga0495672_0006102 | |||
| 1080 | Ga0496100_0045795 | |||
| 1081 | Ga0496104_0319482 | |||
| 1082 | Ga0496105_0002754 | |||
| 1083 | Ga0496105_0290199 | |||
| 1084 | Ga0496107_0111166 | |||
| 1085 | Ga0496107_0535092 | |||
| 1086 | Ga0496108_0205104 | |||
| 1087 | Ga0496109_0027610 | |||
| 1088 | Ga0496110_0075502 | |||
| 1089 | Ga0496110_0159988 | |||
| 1090 | Ga0496113_0300007 | |||
| 1091 | Ga0496113_0411710 | |||
| 1092 | Ga0496114_0035070 | |||
| 1093 | Ga0496115_0000089 | |||
| 1094 | Ga0496115_0092346 | |||
| 1095 | Ga0496115_0501530 | |||
| 1096 | Ga0496116_0082189 | |||
| 1097 | Ga0496116_0140565 | |||
| 1098 | Ga0496117_0031116 | |||
| 1099 | Ga0496117_0042327 | |||
| 1100 | Ga0496118_0004450 | |||
| 1101 | Ga0496118_0030229 | |||
| 1102 | Ga0496119_0000029 | |||
| 1103 | Ga0496119_0005785 | |||
| 1104 | Ga0496120_0000015 | |||
| 1105 | Ga0496120_0000039 | |||
| 1106 | Ga0496121_0000408 | |||
| 1107 | Ga0496121_0047674 | |||
| 1108 | Ga0496122_0018751 | |||
| 1109 | Ga0496123_0006068 | |||
| 1110 | Ga0496124_0000079 | |||
| 1111 | Ga0496124_0001305 | |||
| 1112 | Ga0496125_0003327 | |||
| 1113 | Ga0496125_0004803 | |||
| 1114 | Ga0496126_0000259 | |||
| 1115 | Ga0496126_0004791 | |||
| 1116 | Ga0496126_0060183 | |||
| 1117 | Ga0496126_0507032 | |||
| 1118 | Ga0495678_027331 | |||
| 1119 | Ga0495678_044819 | |||
| 1120 | Ga0495682_0002725 | |||
| 1121 | Ga0501031_0578765 | |||
| 1122 | Ga0501033_0000901 | |||
| 1123 | Ga0501033_0109401 | |||
| 1124 | Ga0501033_0397010 | |||
| 1125 | Ga0501034_0013667 | |||
| 1126 | Ga0501034_0072017 | |||
| 1127 | Ga0501034_0372378 | |||
| 1128 | Ga0501036_0027525 | |||
| 1129 | Ga0501036_0043612 | |||
| 1130 | Ga0501036_0295222 | |||
| 1131 | Ga0501037_0006677 | |||
| 1132 | Ga0501037_0032496 | |||
| 1133 | Ga0501037_0202432 | |||
| 1134 | Ga0501037_0244428 | |||
| 1135 | Ga0501038_0271609 | |||
| 1136 | Ga0501039_0333759 | |||
| 1137 | Ga0501043_0035242 | |||
| 1138 | Ga0501043_0036445 | |||
| 1139 | Ga0501043_0113113 | |||
| 1140 | Ga0501043_0143225 | |||
| 1141 | Ga0501043_0200649 | |||
| 1142 | Ga0501046_0034157 | |||
| 1143 | Ga0501047_0007115 | |||
| 1144 | Ga0501047_0061711 | |||
| 1145 | Ga0501047_0096278 | |||
| 1146 | Ga0501047_0411551 | |||
| 1147 | Ga0501048_0076246 | |||
| 1148 | Ga0501068_0097438 | |||
| 1149 | Ga0501068_0286234 | |||
| 1150 | Ga0501069_0062944 | |||
| 1151 | Ga0501070_0026229 | |||
| 1152 | Ga0501070_0042963 | |||
| 1153 | Ga0501070_0061444 | |||
| 1154 | Ga0501070_0130715 | |||
| 1155 | Ga0501070_0130787 | |||
| 1156 | Ga0501073_0008516 | |||
| 1157 | Ga0501074_0089029 | |||
| 1158 | Ga0501074_0726170 | |||
| 1159 | Ga0501077_0002614 | |||
| 1160 | Ga0501080_1031589 | |||
| 1161 | Ga0501035_0023863 | |||
| 1162 | Ga0501035_0031715 | |||
| 1163 | Ga0501035_0082523 | |||
| 1164 | Ga0501035_0106864 | |||
| 1165 | Ga0501035_0133393 | |||
| 1166 | Ga0501035_0276917 | |||
| 1167 | Ga0501044_0006314 | |||
| 1168 | Ga0501044_0046674 | |||
| 1169 | Ga0501044_0055054 | |||
| 1170 | Ga0501044_0066239 | |||
| 1171 | Ga0501044_0121603 | |||
| 1172 | nmdc:mga0k408_59608_c1 | |||
| 1173 | nmdc:mga06z11_9203_c1 | |||
| 1174 | nmdc:mga04h51_29884_c1 | |||
| 1175 | Ga0466962_0000256 | |||
| 1176 | Ga0466962_0017645 | |||
| 1177 | Ga0466962_0051596 | |||
| 1178 | 2538833535 | |||
| 1179 | 2595448562 | |||
| 1180 | 2643828639 | |||
| 1181 | 2687584938 | |||
| 1182 | 2739733280 | |||
| 1183 | 2819564592 | |||
| 1184 | 2842921291 | |||
| 1185 | 2886853471 | |||
| 1186 | 2895397988 | |||
| 1187 | 2904465239 | |||
| 1188 | 2919088744 | |||
| 1189 | 2919407354 | |||
| 1190 | 2919496437 | |||
| 1191 | 2919546972 | |||
| 1192 | 2923526618 | |||
| 1193 | 2928967017 | |||
| 1194 | 2939613549 | |||
| 1195 | 2953996534 | |||
| 1196 | 2987607018 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c0a-assembly1.cif.gz_B | mechanism of the class i kdpg aldolase | 0.9824 | 13 | 213 |
| 1eua-assembly1.cif.gz_B | schiff base intermediate in kdpg aldolase from escherichia coli | 0.9819 | 13 | 213 |
| 1fwr-assembly1.cif.gz_C | crystal structure of kdpg aldolase double mutant k133q/t161k | 0.9792 | 13 | 213 |
| 6ovi-assembly1.cif.gz_B | crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate | 0.9791 | 12 | 210 |
| 4e38-assembly1.cif.gz_B | crystal structure of probable keto-hydroxyglutarate-aldolase from vibrionales bacterium swat-3 (target efi-502156) | 0.9698 | 9 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1mxsA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9697 | 4 | 212 | 3.20.20.70 |
| 4bk9A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9639 | 11 | 216 | 3.20.20.70 |
| 3vcrA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9492 | 9 | 212 | 3.20.20.70 |
| 1vhcB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9459 | 7 | 214 | 3.20.20.70 |
| 4bk9A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9412 | 11 | 216 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M6Y348-F1-model_v4 | 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) | 0.9958 | 9 | 210 |
GO:0008675
|
| AF-K5YTA1-F1-model_v4 | 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) | 0.9954 | 8 | 209 |
GO:0008675
|
| AF-A0A545TGF3-F1-model_v4 | 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) | 0.9954 | 7 | 213 |
GO:0008675
|
| AF-A0A2A4NPC3-F1-model_v4 | 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) | 0.9942 | 7 | 210 |
GO:0008675
|
| AF-A0A2N2SKB0-F1-model_v4 | 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) | 0.9939 | 5 | 213 |
GO:0008675
|