F467855

General Info

Members Datasets Scaffolds Average Seq Length
599 318 1198 331

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100143091|Ga0070712_1001430911
Length 388
Sequence MLADKLSAMWGQQVFIENKPGAGNNIGAEYVARSDADGYTVVRPRRHSARAGGGTAMEMRMFGRTGMRLSVLGFGCGAVGGLMVRGDPLDQERTVARAIDAGVNYFDTAVQYGSGESEKNLGSVMQRLKPANVAVGTKVRLPSSDFGRIADAVAKSLEGSLARLRLDRVDIFHLHNAITETGGGEALSVRQVLGDVVPAFERLRQQGKTRFLGLTAIGDTAALHQVIDARVFDSAQVVYNMLNPSAATGLPTNYPAQDYGRLFDYTRAASVGVVGIRVLAGGALSGSAERHPIASPPPEPIGSAMSYAGDVVRARRLMPLVKEGFAASLTEAATRFALSHPVMGTILVGMATPQQFEDALAAVQKGPLPPAALGRLTALQQAFGGEPR

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
163 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
275 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
286 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
287 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
288 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
289 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
290 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
291 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
292 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
293 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
294 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
295 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
298 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
299 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
300 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
301 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
302 2791355199
303 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
304 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
305 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
306 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
307 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
308 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
309 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
310 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
311 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
312 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
313 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
314 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
315 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
316 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
317 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
318 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.82
Metatranscriptomes 0.33
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.68
Nodule 3.17
Rhizoplane 8.01
Rhizosphere 74.46
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100143091 3300006175 Bacteria 1827
2 JGI25406J46586_10000019 3300003203 Bacteria 87589
3 Ga0070658_10047159 3300005327 Bacteria 3487
4 Ga0070683_100046950 3300005329 Bacteria 3990
5 Ga0070683_100048677 3300005329 Bacteria 3919
6 Ga0070683_100093124 3300005329 Bacteria 2830
7 Ga0070690_100109433 3300005330 Bacteria 1842
8 Ga0070670_100194994 3300005331 Bacteria 1759
9 Ga0068869_100184423 3300005334 Bacteria 1637
10 Ga0070666_10111786 3300005335 Bacteria 1889
11 Ga0070666_10222571 3300005335 Bacteria 1331
12 Ga0070680_100047517 3300005336 Bacteria 3495
13 Ga0070680_100108573 3300005336 Bacteria 2308
14 Ga0068868_100165730 3300005338 Bacteria 1828
15 Ga0070660_100015162 3300005339 Bacteria 5560
16 Ga0070687_100205671 3300005343 Bacteria 1196
17 Ga0070661_100243470 3300005344 Bacteria 1386
18 Ga0070661_100343320 3300005344 Bacteria 1170
19 Ga0070668_100093681 3300005347 Bacteria 2371
20 Ga0070668_100141941 3300005347 Bacteria 1936
21 Ga0070668_100185048 3300005347 Bacteria 1703
22 Ga0070669_100068438 3300005353 Bacteria 2620
23 Ga0070669_100240597 3300005353 Bacteria 1438
24 Ga0070675_100099027 3300005354 Bacteria 2453
25 Ga0070675_100117198 3300005354 Bacteria 2260
26 Ga0070671_100159964 3300005355 Bacteria 1904
27 Ga0070674_100052465 3300005356 Bacteria 2813
28 Ga0070674_100077602 3300005356 Bacteria 2365
29 Ga0070673_100009738 3300005364 Bacteria 6467
30 Ga0070673_100059994 3300005364 Bacteria 3013
31 Ga0070673_100179842 3300005364 Bacteria 1810
32 Ga0070709_10008701 3300005434 Bacteria 5584
33 Ga0070709_10100944 3300005434 Bacteria 1922
34 Ga0070709_10201845 3300005434 Bacteria 1409
35 Ga0070714_100142738 3300005435 Bacteria 2151
36 Ga0070714_100162672 3300005435 Bacteria 2020
37 Ga0070714_100201729 3300005435 Bacteria 1820
38 Ga0070714_100229064 3300005435 Bacteria 1711
39 Ga0070713_100013849 3300005436 Bacteria 5968
40 Ga0070713_100019763 3300005436 Bacteria 5153
41 Ga0070713_100034927 3300005436 Bacteria 4044
42 Ga0070713_100104471 3300005436 Bacteria 2459
43 Ga0070713_100138264 3300005436 Bacteria 2155
44 Ga0070713_100242886 3300005436 Bacteria 1640
45 Ga0070710_10015768 3300005437 Bacteria 3831
46 Ga0070701_10017320 3300005438 Bacteria 3366
47 Ga0070701_10160568 3300005438 Bacteria 1301
48 Ga0070711_100004793 3300005439 Bacteria 8020
49 Ga0070711_100009631 3300005439 Bacteria 5954
50 Ga0070711_100020471 3300005439 Bacteria 4264
51 Ga0070711_100075918 3300005439 Bacteria 2381
52 Ga0070663_100093842 3300005455 Bacteria 2227
53 Ga0070663_100225391 3300005455 Bacteria 1473
54 Ga0070663_100324022 3300005455 Bacteria 1240
55 Ga0070678_100263445 3300005456 Bacteria 1451
56 Ga0070662_100030427 3300005457 Bacteria 3777
57 Ga0068867_100026289 3300005459 Bacteria 4179
58 Ga0070706_100062796 3300005467 Bacteria 3432
59 Ga0070707_100003587 3300005468 Bacteria 14635
60 Ga0070707_100208919 3300005468 Bacteria 1903
61 Ga0070707_100344342 3300005468 Bacteria 1448
62 Ga0070698_100031468 3300005471 Bacteria 5501
63 Ga0070698_100034815 3300005471 Bacteria 5210
64 Ga0070698_100220304 3300005471 Bacteria 1831
65 Ga0070698_100252643 3300005471 Bacteria 1695
66 Ga0070699_100004086 3300005518 Bacteria 12901
67 Ga0070699_100007056 3300005518 Bacteria 9759
68 Ga0070679_100034220 3300005530 Bacteria 5035
69 Ga0070679_100076594 3300005530 Bacteria 3334
70 Ga0070679_100079645 3300005530 Bacteria 3265
71 Ga0070679_100142941 3300005530 Bacteria 2371
72 Ga0070684_100008328 3300005535 Bacteria 8098
73 Ga0070684_100025182 3300005535 Bacteria 4999
74 Ga0070684_100033090 3300005535 Bacteria 4411
75 Ga0070697_100034363 3300005536 Bacteria 4087
76 Ga0070697_100206529 3300005536 Bacteria 1671
77 Ga0068853_100003011 3300005539 Bacteria 12861
78 Ga0070665_100306016 3300005548 Bacteria 1593
79 Ga0070665_100379170 3300005548 Bacteria 1421
80 Ga0070665_100396545 3300005548 Bacteria 1388
81 Ga0070665_100416011 3300005548 Bacteria 1353
82 Ga0068855_100024904 3300005563 Bacteria 7160
83 Ga0068855_100284328 3300005563 Bacteria 1836
84 Ga0068855_100405558 3300005563 Bacteria 1493
85 Ga0070664_100029815 3300005564 Bacteria 4549
86 Ga0068857_100003284 3300005577 Bacteria 13438
87 Ga0068857_100326952 3300005577 Bacteria 1417
88 Ga0068854_100075471 3300005578 Bacteria 2476
89 Ga0068856_100000013 3300005614 Bacteria 165611
90 Ga0068856_100385138 3300005614 Bacteria 1422
91 Ga0068852_100027450 3300005616 Bacteria 4640
92 Ga0068859_100045153 3300005617 Bacteria 4427
93 Ga0068859_100336156 3300005617 Bacteria 1605
94 Ga0068864_100016347 3300005618 Bacteria 6176
95 Ga0068864_100399005 3300005618 Bacteria 1306
96 Ga0068861_100070079 3300005719 Bacteria 2714
97 Ga0068861_100269457 3300005719 Bacteria 1461
98 Ga0068861_100349513 3300005719 Bacteria 1296
99 Ga0068861_100478469 3300005719 Bacteria 1121
100 Ga0068851_10013665 3300005834 Bacteria 3844
101 Ga0068870_10134884 3300005840 Bacteria 1438
102 Ga0068863_100022270 3300005841 Bacteria 6050
103 Ga0068858_100197484 3300005842 Bacteria 1902
104 Ga0068858_100538305 3300005842 Bacteria 1130
105 Ga0068860_100000324 3300005843 Bacteria 64920
106 Ga0068860_100200945 3300005843 Bacteria 1931
107 Ga0068862_100058558 3300005844 Bacteria 3304
108 Ga0068862_100194724 3300005844 Bacteria 1825
109 Ga0081455_10005118 3300005937 Bacteria 14456
110 Ga0081455_10016029 3300005937 Bacteria 7250
111 Ga0081455_10039178 3300005937 Bacteria 4191
112 Ga0081455_10048862 3300005937 Bacteria 3651
113 Ga0081538_10003312 3300005981 Bacteria 15270
114 Ga0081540_1000748 3300005983 Bacteria 29933
115 Ga0081540_1001710 3300005983 Bacteria 18575
116 Ga0081540_1002253 3300005983 Bacteria 15881
117 Ga0081540_1023504 3300005983 Bacteria 3602
118 Ga0081540_1024996 3300005983 Bacteria 3452
119 Ga0081540_1067849 3300005983 Bacteria 1664
120 Ga0081539_10000003 3300005985 Bacteria 594833
121 Ga0081539_10027637 3300005985 Bacteria 3588
122 Ga0070717_10001928 3300006028 Bacteria 14491
123 Ga0070717_10030675 3300006028 Bacteria 4319
124 Ga0070717_10094395 3300006028 Bacteria 2530
125 Ga0070717_10241345 3300006028 Bacteria 1594
126 Ga0075365_10005154 3300006038 Bacteria 7023
127 Ga0075365_10097139 3300006038 Bacteria 2013
128 Ga0075364_10033931 3300006051 Bacteria 3289
129 Ga0070715_10008533 3300006163 Bacteria 3575
130 Ga0070715_10051696 3300006163 Bacteria 1769
131 Ga0070712_100003154 3300006175 Bacteria 10153
132 Ga0070712_100003875 3300006175 Bacteria 9213
133 Ga0070712_100136921 3300006175 Bacteria 1863
134 Ga0070712_100230076 3300006175 Bacteria 1472
135 Ga0075362_10005069 3300006177 Bacteria 4788
136 Ga0075366_10091594 3300006195 Bacteria 1821
137 Ga0097621_100060432 3300006237 Bacteria 3106
138 Ga0097621_100114423 3300006237 Bacteria 2282
139 Ga0068871_100233044 3300006358 Bacteria 1599
140 Ga0075428_100007151 3300006844 Bacteria 12367
141 Ga0075430_100047419 3300006846 Bacteria 3628
142 Ga0075430_100222267 3300006846 Bacteria 1567
143 Ga0075431_100000305 3300006847 Bacteria 38524
144 Ga0075433_10369553 3300006852 Bacteria 1266
145 Ga0075434_100008672 3300006871 Bacteria 9467
146 Ga0075434_100606327 3300006871 Bacteria 1114
147 Ga0075429_100243486 3300006880 Bacteria 1575
148 Ga0068865_100177720 3300006881 Bacteria 1637
149 Ga0097620_100045154 3300006931 Bacteria 4427
150 Ga0097620_100336154 3300006931 Bacteria 1605
151 Ga0099823_1000128 3300006944 Bacteria 38804
152 Ga0075435_100042108 3300007076 Bacteria 3652
153 Ga0075435_100123231 3300007076 Bacteria 2164
154 Ga0075435_100206145 3300007076 Bacteria 1667
155 Ga0099794_10019293 3300007265 Bacteria 3069
156 Ga0099794_10089612 3300007265 Bacteria 1525
157 Ga0105240_10010988 3300009093 Bacteria 12677
158 Ga0105240_10035447 3300009093 Bacteria 6429
159 Ga0105240_10099278 3300009093 Bacteria 3543
160 Ga0105240_10152986 3300009093 Bacteria 2746
161 Ga0111539_10000072 3300009094 Bacteria 100461
162 Ga0111539_10054009 3300009094 Bacteria 4781
163 Ga0105245_10019134 3300009098 Bacteria 5995
164 Ga0105245_10019910 3300009098 Bacteria 5883
165 Ga0105245_10563132 3300009098 Bacteria 1163
166 Ga0105247_10206154 3300009101 Bacteria 1324
167 Ga0114129_10000134 3300009147 Bacteria 76265
168 Ga0114129_10095695 3300009147 Bacteria 4113
169 Ga0105243_10206547 3300009148 Bacteria 1726
170 Ga0105243_10217838 3300009148 Bacteria 1685
171 Ga0105241_10065587 3300009174 Bacteria 2806
172 Ga0105241_10075782 3300009174 Bacteria 2622
173 Ga0105242_10085549 3300009176 Bacteria 2644
174 Ga0105248_10008873 3300009177 Bacteria 11051
175 Ga0105248_10044705 3300009177 Bacteria 4967
176 Ga0105237_10004604 3300009545 Bacteria 15907
177 Ga0105237_10471698 3300009545 Bacteria 1261
178 Ga0105238_10034893 3300009551 Bacteria 5117
179 Ga0105238_10142468 3300009551 Bacteria 2374
180 Ga0105249_10062927 3300009553 Bacteria 3407
181 Ga0099796_10012684 3300010159 Bacteria 2387
182 Ga0105239_10014287 3300010375 Bacteria 8810
183 Ga0105239_10091507 3300010375 Bacteria 3356
184 Ga0105246_10003842 3300011119 Bacteria 9107
185 Ga0157370_10024143 3300013104 Bacteria 6026
186 Ga0157370_10026803 3300013104 Bacteria 5685
187 Ga0157370_10069990 3300013104 Bacteria 3313
188 Ga0157369_10007909 3300013105 Bacteria 12225
189 Ga0157369_10018308 3300013105 Bacteria 7855
190 Ga0157369_10311807 3300013105 Bacteria 1636
191 Ga0157374_10007429 3300013296 Bacteria 9345
192 Ga0157374_10359437 3300013296 Bacteria 1448
193 Ga0157374_10449410 3300013296 Bacteria 1290
194 Ga0157378_10003222 3300013297 Bacteria 14517
195 Ga0163162_10291139 3300013306 Bacteria 1765
196 Ga0157375_10021339 3300013308 Bacteria 5936
197 Ga0157375_10035861 3300013308 Bacteria 4739
198 Ga0163163_10017955 3300014325 Bacteria 6609
199 Ga0157380_10130804 3300014326 Bacteria 2141
200 Ga0157380_10219010 3300014326 Bacteria 1702
201 Ga0157380_10252930 3300014326 Bacteria 1596
202 Ga0157379_10261008 3300014968 Bacteria 1574
203 Ga0157376_10002689 3300014969 Bacteria 12093
204 Ga0157376_10307188 3300014969 Bacteria 1503
205 Ga0213872_10012894 3300021361 Bacteria 3921
206 Ga0213872_10105215 3300021361 Bacteria 1256
207 Ga0213876_10018968 3300021384 Bacteria 3634
208 Ga0224712_10092287 3300022467 Bacteria 1270
209 Ga0207697_10023842 3300025315 Bacteria 2506
210 Ga0207692_10038298 3300025898 Bacteria 2351
211 Ga0207692_10223998 3300025898 Bacteria 1116
212 Ga0207688_10061495 3300025901 Bacteria 2117
213 Ga0207688_10074331 3300025901 Bacteria 1932
214 Ga0207688_10095743 3300025901 Bacteria 1709
215 Ga0207680_10052955 3300025903 Bacteria 2434
216 Ga0207647_10120118 3300025904 Bacteria 1550
217 Ga0207699_10039197 3300025906 Bacteria 2721
218 Ga0207699_10053188 3300025906 Bacteria 2400
219 Ga0207699_10119070 3300025906 Bacteria 1705
220 Ga0207699_10147643 3300025906 Unclassified 1552
221 Ga0207699_10295067 3300025906 Bacteria 1130
222 Ga0207645_10055855 3300025907 Bacteria 2521
223 Ga0207643_10004262 3300025908 Bacteria 7704
224 Ga0207643_10048493 3300025908 Bacteria 2406
225 Ga0207705_10057862 3300025909 Bacteria 2797
226 Ga0207705_10279931 3300025909 Bacteria 1277
227 Ga0207684_10039139 3300025910 Bacteria 4023
228 Ga0207684_10080717 3300025910 Bacteria 2767
229 Ga0207684_10321299 3300025910 Bacteria 1334
230 Ga0207707_10005482 3300025912 Bacteria 11094
231 Ga0207707_10027698 3300025912 Bacteria 4955
232 Ga0207695_10019837 3300025913 Bacteria 7727
233 Ga0207695_10162016 3300025913 Bacteria 2168
234 Ga0207695_10220759 3300025913 Bacteria 1803
235 Ga0207671_10009837 3300025914 Bacteria 7954
236 Ga0207671_10019927 3300025914 Bacteria 5117
237 Ga0207693_10011077 3300025915 Bacteria 7307
238 Ga0207693_10027038 3300025915 Bacteria 4537
239 Ga0207693_10055785 3300025915 Bacteria 3099
240 Ga0207693_10150380 3300025915 Bacteria 1831
241 Ga0207693_10302031 3300025915 Bacteria 1254
242 Ga0207663_10055337 3300025916 Bacteria 2489
243 Ga0207663_10132439 3300025916 Bacteria 1725
244 Ga0207663_10243050 3300025916 Bacteria 1321
245 Ga0207660_10005549 3300025917 Bacteria 8194
246 Ga0207660_10095242 3300025917 Bacteria 2214
247 Ga0207662_10185708 3300025918 Bacteria 1340
248 Ga0207662_10219227 3300025918 Bacteria 1238
249 Ga0207657_10010231 3300025919 Bacteria 9369
250 Ga0207649_10061441 3300025920 Bacteria 2365
251 Ga0207652_10005283 3300025921 Bacteria 10482
252 Ga0207652_10058053 3300025921 Bacteria 3334
253 Ga0207652_10371202 3300025921 Bacteria 1291
254 Ga0207646_10030351 3300025922 Bacteria 4901
255 Ga0207646_10291739 3300025922 Bacteria 1474
256 Ga0207646_10357258 3300025922 Bacteria 1320
257 Ga0207681_10034474 3300025923 Bacteria 3329
258 Ga0207681_10172499 3300025923 Bacteria 1640
259 Ga0207694_10014040 3300025924 Bacteria 6040
260 Ga0207694_10033332 3300025924 Bacteria 3945
261 Ga0207694_10130117 3300025924 Bacteria 2017
262 Ga0207650_10009237 3300025925 Bacteria 6737
263 Ga0207650_10088506 3300025925 Bacteria 2361
264 Ga0207650_10348861 3300025925 Bacteria 1217
265 Ga0207659_10218403 3300025926 Bacteria 1531
266 Ga0207687_10009931 3300025927 Bacteria 6233
267 Ga0207687_10313914 3300025927 Bacteria 1267
268 Ga0207700_10007061 3300025928 Bacteria 6832
269 Ga0207700_10035641 3300025928 Bacteria 3585
270 Ga0207700_10061025 3300025928 Bacteria 2858
271 Ga0207700_10072539 3300025928 Bacteria 2655
272 Ga0207700_10077515 3300025928 Bacteria 2582
273 Ga0207700_10086393 3300025928 Bacteria 2465
274 Ga0207700_10305220 3300025928 Unclassified 1375
275 Ga0207700_10467803 3300025928 Bacteria 1113
276 Ga0207664_10099543 3300025929 Bacteria 2399
277 Ga0207644_10007111 3300025931 Bacteria 7299
278 Ga0207644_10034247 3300025931 Bacteria 3553
279 Ga0207644_10158564 3300025931 Bacteria 1757
280 Ga0207690_10201922 3300025932 Bacteria 1510
281 Ga0207706_10090399 3300025933 Bacteria 2692
282 Ga0207670_10248082 3300025936 Bacteria 1375
283 Ga0207704_10138184 3300025938 Bacteria 1700
284 Ga0207704_10271469 3300025938 Bacteria 1284
285 Ga0207665_10085760 3300025939 Bacteria 2174
286 Ga0207665_10179357 3300025939 Bacteria 1533
287 Ga0207665_10194637 3300025939 Bacteria 1475
288 Ga0207691_10108357 3300025940 Bacteria 2472
289 Ga0207691_10182948 3300025940 Bacteria 1831
290 Ga0207711_10024593 3300025941 Bacteria 5049
291 Ga0207711_10359063 3300025941 Bacteria 1349
292 Ga0207689_10023661 3300025942 Bacteria 5151
293 Ga0207689_10152775 3300025942 Bacteria 1903
294 Ga0207661_10002771 3300025944 Bacteria 12077
295 Ga0207661_10020728 3300025944 Bacteria 4918
296 Ga0207667_10010841 3300025949 Bacteria 10631
297 Ga0207667_10117725 3300025949 Bacteria 2738
298 Ga0207667_10369198 3300025949 Bacteria 1462
299 Ga0207651_10014535 3300025960 Bacteria 4549
300 Ga0207651_10074034 3300025960 Bacteria 2424
301 Ga0207712_10430861 3300025961 Bacteria 1115
302 Ga0207668_10056602 3300025972 Bacteria 2731
303 Ga0207668_10089653 3300025972 Bacteria 2255
304 Ga0207640_10035591 3300025981 Bacteria 3117
305 Ga0207640_10075730 3300025981 Bacteria 2282
306 Ga0207640_10141590 3300025981 Bacteria 1754
307 Ga0207658_10309892 3300025986 Bacteria 1363
308 Ga0207703_10071017 3300026035 Bacteria 2875
309 Ga0207703_10194616 3300026035 Bacteria 1798
310 Ga0207639_10037832 3300026041 Bacteria 3586
311 Ga0207639_10415704 3300026041 Bacteria 1215
312 Ga0207678_10019066 3300026067 Bacteria 6023
313 Ga0207678_10019744 3300026067 Bacteria 5928
314 Ga0207678_10040063 3300026067 Bacteria 4063
315 Ga0207678_10155186 3300026067 Bacteria 1954
316 Ga0207708_10046850 3300026075 Bacteria 3292
317 Ga0207702_10000090 3300026078 Bacteria 104566
318 Ga0207702_10151032 3300026078 Bacteria 2113
319 Ga0207702_10170441 3300026078 Bacteria 1995
320 Ga0207641_10142746 3300026088 Bacteria 2162
321 Ga0207641_10154415 3300026088 Bacteria 2082
322 Ga0207648_10071490 3300026089 Bacteria 3024
323 Ga0207676_10072921 3300026095 Bacteria 2761
324 Ga0207676_10087743 3300026095 Bacteria 2545
325 Ga0207674_10016369 3300026116 Bacteria 8120
326 Ga0207674_10163644 3300026116 Bacteria 2179
327 Ga0207674_10326635 3300026116 Bacteria 1484
328 Ga0207675_100205100 3300026118 Bacteria 1894
329 Ga0207675_100467758 3300026118 Bacteria 1251
330 Ga0207683_10049757 3300026121 Bacteria 3670
331 Ga0207683_10144298 3300026121 Bacteria 2146
332 Ga0207683_10147370 3300026121 Bacteria 2123
333 Ga0207698_10239914 3300026142 Bacteria 1651
334 Ga0209389_1000223 3300027296 Bacteria 38812
335 Ga0209489_102324 3300027361 Bacteria 38812
336 Ga0209700_102324 3300027363 Bacteria 38812
337 Ga0209588_1040258 3300027671 Bacteria 1508
338 Ga0207428_10001757 3300027907 Bacteria 22207
339 Ga0268266_10231700 3300028379 Bacteria 1701
340 Ga0268266_10238501 3300028379 Bacteria 1677
341 Ga0268265_10006977 3300028380 Bacteria 7642
342 Ga0268264_10000038 3300028381 Bacteria 383623
343 Ga0265325_10009012 3300031241 Bacteria 5857
344 Ga0265340_10001297 3300031247 Bacteria 14335
345 Ga0265316_10061566 3300031344 Bacteria 2914
346 Ga0307513_10289099 3300031456 Bacteria 1412
347 Ga0307509_10132483 3300031507 Bacteria 2445
348 Ga0307509_10182767 3300031507 Bacteria 1959
349 Ga0307508_10000063 3300031616 Bacteria 122536
350 Ga0265314_10002042 3300031711 Bacteria 21355
351 Ga0265342_10042030 3300031712 Bacteria 2764
352 Ga0307516_10001267 3300031730 Bacteria 35137
353 Ga0307516_10025196 3300031730 Bacteria 6059
354 Ga0307516_10129015 3300031730 Bacteria 2310
355 Ga0307516_10133892 3300031730 Bacteria 2255
356 Ga0307406_10177197 3300031901 Bacteria 1549
357 Ga0307406_10241982 3300031901 Bacteria 1354
358 Ga0307409_100045495 3300031995 Bacteria 3314
359 Ga0307411_10031449 3300032005 Bacteria 3266
360 Ga0307510_10110978 3300033180 Bacteria 2485
361 Ga0307510_10239116 3300033180 Bacteria 1312
362 Ga0373926_0013954 3300035083 Bacteria 2728
363 Ga0373926_0077332 3300035083 Bacteria 1228
364 Ga0373944_0001795 3300035089 Bacteria 5425
365 Ga0373936_0034392 3300035113 Bacteria 2013
366 Ga0373945_0009728 3300035116 Bacteria 3155
367 Ga0373954_0011226 3300035118 Bacteria 3966
368 Ga0373956_0119775 3300035119 Bacteria 1229
369 Ga0373943_0006158 3300035170 Bacteria 5384
370 Ga0373943_0016208 3300035170 Bacteria 3396
371 Ga0373943_0164739 3300035170 Bacteria 1209
372 Ga0373931_0108871 3300035691 Bacteria 1569
373 Ga0373935_0069054 3300035692 Bacteria 2275
374 Ga0373927_0001137 3300035695 Bacteria 20140
375 Ga0373927_0015387 3300035695 Bacteria 5055
376 Ga0373933_0024448 3300035724 Bacteria 3458
377 Ga0373933_0156681 3300035724 Bacteria 1445
378 Ga0373947_0000866 3300035725 Bacteria 18297
379 Ga0373947_0061434 3300035725 Unclassified 2284
380 Ga0373947_0122957 3300035725 Bacteria 1650
381 Ga0373937_0051482 3300036401 Bacteria 3774
382 Ga0373937_0171283 3300036401 Bacteria 2037
383 Ga0372808_002025 3300036459 Bacteria 2256
384 Ga0373925_0062901 3300037068 Bacteria 2791
385 Ga0373925_0186130 3300037068 Bacteria 1646
386 Ga0395900_0395043 3300037418 Bacteria 1348
387 Ga0395898_0038287 3300037466 Bacteria 4754
388 Ga0395898_0370043 3300037466 Bacteria 1367
389 Ga0395905_0247090 3300037471 Bacteria 1667
390 Ga0395901_0046141 3300038443 Bacteria 4525
391 Ga0395901_0243005 3300038443 Bacteria 1877
392 Ga0436365_0233583 3300039437 Bacteria 2877
393 Ga0436365_0500204 3300039437 Bacteria 5328
394 Ga0436360_0881351 3300039438 Bacteria 1185
395 Ga0436361_0060565 3300039447 Bacteria 4440
396 Ga0436361_0517667 3300039447 Bacteria 1273
397 Ga0436361_0674485 3300039447 Bacteria 6503
398 Ga0436361_1151628 3300039447 Bacteria 1829
399 Ga0436363_0802403 3300039450 Bacteria 1149
400 Ga0436363_1463080 3300039450 Bacteria 1255
401 Ga0436362_0475045 3300039453 Bacteria 4962
402 Ga0439465_0009720 3300041413 Bacteria 3030
403 Ga0466958_0294447 3300045836 Bacteria 1041
404 Ga0495592_0033927 3300046454 Bacteria 3849
405 Ga0495629_0089531 3300046459 Bacteria 2147
406 Ga0495629_0181653 3300046459 Bacteria 1458
407 Ga0495629_0193098 3300046459 Bacteria 1409
408 Ga0495638_0154043 3300046460 Bacteria 1331
409 Ga0495651_0166683 3300046462 Bacteria 1573
410 Ga0495651_0222536 3300046462 Bacteria 1305
411 Ga0495653_0011816 3300046463 Bacteria 7130
412 Ga0495580_0195326 3300046472 Bacteria 1395
413 Ga0495662_0000679 3300046476 Bacteria 16084
414 Ga0495662_0047649 3300046476 Bacteria 2069
415 Ga0495664_0003224 3300046477 Bacteria 8857
416 Ga0495618_0006865 3300046514 Bacteria 6898
417 Ga0495628_0018588 3300046516 Bacteria 5755
418 Ga0495628_0220315 3300046516 Bacteria 1425
419 Ga0495628_0290191 3300046516 Bacteria 1213
420 Ga0495630_0016967 3300046517 Bacteria 5328
421 Ga0495666_0028289 3300046526 Unclassified 2758
422 Ga0495652_0208328 3300046529 Bacteria 1478
423 Ga0495640_0077456 3300046533 Bacteria 2216
424 Ga0495645_0010524 3300046543 Bacteria 6487
425 Ga0495645_0090110 3300046543 Bacteria 2192
426 Ga0495635_0005654 3300046663 Bacteria 8705
427 Ga0495659_0073007 3300046664 Bacteria 1289
428 Ga0495588_0016420 3300046674 Bacteria 3577
429 Ga0495657_0131552 3300046675 Bacteria 1567
430 Ga0495647_0057046 3300046681 Bacteria 1532
431 Ga0495658_0029682 3300046683 Bacteria 2963
432 Ga0495658_0084813 3300046683 Bacteria 1866
433 Ga0495658_0220670 3300046683 Bacteria 1187
434 Ga0495669_0013947 3300046684 Bacteria 3431
435 Ga0495649_0178393 3300046694 Bacteria 1109
436 Ga0495589_0067806 3300046794 Bacteria 1746
437 Ga0495581_0075330 3300047315 Unclassified 1952
438 Ga0495581_0123397 3300047315 Bacteria 1508
439 Ga0495604_0094714 3300047317 Bacteria 2207
440 Ga0495604_0285577 3300047317 Bacteria 1113
441 Ga0495672_0079876 3300047320 Bacteria 1826
442 Ga0495673_0019752 3300047469 Bacteria 3371
443 Ga0495684_0017584 3300047471 Bacteria 5505
444 Ga0495593_0050734 3300047673 Unclassified 2197
445 Ga0495593_0090194 3300047673 Bacteria 1579
446 Ga0495593_0130518 3300047673 Bacteria 1275
447 Ga0495602_0120887 3300048088 Bacteria 2107
448 Ga0496100_0081027 3300048903 Bacteria 2192
449 Ga0496101_0000882 3300048904 Bacteria 17656
450 Ga0496101_0039070 3300048904 Bacteria 3373
451 Ga0496101_0190487 3300048904 Bacteria 1583
452 Ga0496102_0039900 3300048905 Bacteria 4244
453 Ga0496102_0430861 3300048905 Bacteria 1238
454 Ga0496104_0004009 3300048907 Bacteria 12765
455 Ga0496104_0018455 3300048907 Bacteria 6364
456 Ga0496105_0006844 3300048908 Bacteria 8770
457 Ga0496105_0039645 3300048908 Unclassified 3883
458 Ga0496106_0000714 3300048909 Bacteria 23911
459 Ga0496106_0001345 3300048909 Bacteria 18426
460 Ga0496106_0040317 3300048909 Bacteria 3497
461 Ga0496106_0407115 3300048909 Bacteria 1093
462 Ga0496107_0005648 3300048910 Bacteria 8566
463 Ga0496107_0048419 3300048910 Unclassified 3062
464 Ga0496108_0002665 3300048911 Bacteria 14307
465 Ga0496108_0043963 3300048911 Bacteria 3730
466 Ga0496108_0099308 3300048911 Bacteria 2481
467 Ga0496109_0008345 3300048912 Bacteria 8799
468 Ga0496109_0016385 3300048912 Bacteria 6478
469 Ga0496109_0026663 3300048912 Bacteria 5155
470 Ga0496109_0038642 3300048912 Bacteria 4316
471 Ga0496109_0052383 3300048912 Bacteria 3719
472 Ga0496110_0007723 3300048913 Bacteria 8606
473 Ga0496110_0018095 3300048913 Bacteria 5903
474 Ga0496110_0041846 3300048913 Bacteria 3999
475 Ga0496111_0001353 3300048914 Bacteria 13865
476 Ga0496111_0006089 3300048914 Bacteria 7802
477 Ga0496111_0032361 3300048914 Bacteria 3728
478 Ga0496112_0000960 3300048915 Bacteria 20955
479 Ga0496112_0022183 3300048915 Bacteria 6050
480 Ga0496112_0039791 3300048915 Bacteria 4595
481 Ga0496112_0048765 3300048915 Bacteria 4151
482 Ga0496112_0114514 3300048915 Bacteria 2667
483 Ga0496112_0170878 3300048915 Bacteria 2139
484 Ga0496112_0295604 3300048915 Bacteria 1565
485 Ga0496113_0004820 3300048916 Bacteria 8342
486 Ga0496113_0016236 3300048916 Bacteria 5139
487 Ga0496113_0020983 3300048916 Bacteria 4603
488 Ga0496113_0164333 3300048916 Bacteria 1756
489 Ga0496114_0017982 3300048917 Bacteria 5712
490 Ga0496114_0032200 3300048917 Bacteria 4314
491 Ga0496114_0317854 3300048917 Bacteria 1375
492 Ga0496115_0000999 3300048918 Bacteria 20514
493 Ga0496115_0076994 3300048918 Bacteria 2712
494 Ga0496115_0251795 3300048918 Bacteria 1454
495 Ga0496115_0423204 3300048918 Bacteria 1079
496 Ga0496118_0002645 3300048921 Bacteria 23738
497 Ga0496118_0037911 3300048921 Bacteria 3871
498 Ga0496118_0083239 3300048921 Bacteria 2238
499 Ga0496118_0192802 3300048921 Bacteria 1217
500 Ga0496121_0000418 3300048924 Bacteria 84182
501 Ga0496121_0001662 3300048924 Bacteria 36711
502 Ga0496121_0008362 3300048924 Bacteria 12211
503 Ga0496121_0127743 3300048924 Bacteria 1908
504 Ga0496121_0174569 3300048924 Bacteria 1557
505 Ga0496124_0082913 3300048927 Bacteria 2631
506 Ga0496125_0041010 3300048928 Bacteria 3963
507 Ga0496126_0004626 3300048929 Bacteria 16302
508 Ga0496126_0011720 3300048929 Bacteria 9035
509 Ga0496126_0014492 3300048929 Bacteria 7967
510 Ga0496126_0016798 3300048929 Bacteria 7306
511 Ga0496126_0022472 3300048929 Bacteria 6137
512 Ga0496126_0045704 3300048929 Bacteria 4022
513 Ga0496126_0053934 3300048929 Bacteria 3645
514 Ga0496126_0105378 3300048929 Bacteria 2462
515 Ga0496126_0184437 3300048929 Bacteria 1770
516 Ga0496126_0244345 3300048929 Bacteria 1498
517 Ga0501041_0249455 3300049577 Bacteria 1116
518 Ga0501070_0051561 3300049586 Bacteria 3415
519 nmdc:mga0yw44_28857_c1 3300050492 Bacteria 3197
520 nmdc:mga0yw44_336157_c1 3300050492 Bacteria 1015
521 nmdc:mga0yw44_640_c1 3300050492 Bacteria 12734
522 nmdc:mga05p37_168772_c1 3300050507 Bacteria 2670
523 nmdc:mga05p37_51_c1 3300050507 Bacteria 103396
524 nmdc:mga05p37_785716_c1 3300050507 Bacteria 1044
525 nmdc:mga0qj67_76816_c1 3300050509 Bacteria 2672
526 nmdc:mga0qj67_93328_c1 3300050509 Bacteria 2420
527 nmdc:mga06r32_16_c1 3300050510 Bacteria 101899
528 nmdc:mga06r32_93535_c1 3300050510 Bacteria 2940
529 nmdc:mga08y16_79_c2 3300050511 Bacteria 54400
530 nmdc:mga0n895_288964_c1 3300050512 Bacteria 1662
531 nmdc:mga0n895_394482_c1 3300050512 Bacteria 1400
532 nmdc:mga0rr50_90336_c1 3300050513 Bacteria 2383
533 nmdc:mga0a205_383936_c1 3300050515 Bacteria 1269
534 Ga0495601_0099997 3300053077 Bacteria 1872
535 Ga0495612_0001325 3300053078 Bacteria 10200
536 Ga0495612_0019417 3300053078 Bacteria 2721
537 Ga0500635_0001863 3300053080 Bacteria 5142
538 Ga0500635_0009407 3300053080 Bacteria 2712
539 Ga0495595_0007151 3300053084 Bacteria 4561
540 Ga0495595_0018796 3300053084 Bacteria 2991
541 Ga0495595_0169719 3300053084 Bacteria 1079
542 Ga0495619_0004937 3300053085 Bacteria 8471
543 Ga0495619_0028832 3300053085 Bacteria 3582
544 Ga0495619_0039393 3300053085 Bacteria 3085
545 Ga0500647_0120054 3300053091 Bacteria 1245
546 Ga0500583_0128574 3300053092 Bacteria 1256
547 Ga0500566_0000009 3300053094 Bacteria 131668
548 Ga0500566_0001254 3300053094 Bacteria 14821
549 Ga0500640_014979 3300053095 Bacteria 3236
550 Ga0500641_0008673 3300053096 Bacteria 3635
551 Ga0500556_0004126 3300053104 Bacteria 4161
552 Ga0500594_0039519 3300053118 Bacteria 1284
553 Ga0500595_000398 3300053119 Bacteria 27905
554 Ga0500595_005042 3300053119 Bacteria 5809
555 Ga0500595_006280 3300053119 Bacteria 5063
556 Ga0500642_0059218 3300053130 Bacteria 1714
557 Ga0500559_0000488 3300053136 Bacteria 27939
558 Ga0500559_0034889 3300053136 Bacteria 2170
559 Ga0500568_0008345 3300053139 Bacteria 5004
560 Ga0500577_0058523 3300053142 Bacteria 1474
561 Ga0500590_024866 3300053148 Bacteria 3109
562 Ga0500603_000016 3300053150 Bacteria 56563
563 Ga0500603_000193 3300053150 Bacteria 15937
564 Ga0500630_000034 3300053159 Bacteria 38552
565 Ga0500634_0111691 3300053161 Bacteria 1347
566 Ga0500638_000184 3300053162 Bacteria 12736
567 Ga0500638_011970 3300053162 Bacteria 3873
568 Ga0500639_000017 3300053163 Bacteria 114464
569 Ga0500639_066432 3300053163 Bacteria 1848
570 Ga0500637_0000118 3300053178 Bacteria 28882
571 Ga0500637_0101461 3300053178 Bacteria 1668
572 Ga0500596_000521 3300053735 Bacteria 7265
573 Ga0500601_003847 3300053737 Bacteria 1629
574 Ga0500661_000044 3300055283 Bacteria 19202
575 Ga0501082_0417319 3300060353 Bacteria 1172
576 2513679284 2513237098 Bacteria 9902361
577 2513679852 2513237098 Bacteria 9902361
578 2513695717 2513237101 Bacteria 7952346
579 2513889529 2513237141 Bacteria 8496279
580 2524463545 2524023210 Bacteria 9029266
581 2723846963 2721755755 Bacteria 8322773
582 2793084266
583 2847938923 2847930680 Bacteria 9342022
584 2874611070 2874604998 Bacteria 7834745
585 2876811086 2876808645 Bacteria 8824342
586 2879114516 2879110137 Bacteria 8907982
587 2885390493 2885383462 Bacteria 9473874
588 2885390653 2885383462 Bacteria 9473874
589 2885412909 2885409591 Bacteria 9235467
590 2903772885 2903768456 Bacteria 9749579
591 2908759619 2908756301 Bacteria 8864324
592 2922362655 2922361189 Bacteria 7436256
593 2922387531 2922386360 Bacteria 7017218
594 8006931040 8006926726 Bacteria 6749210
595 8006968464 8006964411 Bacteria 8966052
596 8006987396 8006984368 Bacteria 9651211
597 8006994902 8006994254 Bacteria 8309700
598 8056679474 8056673599 Bacteria 7871253
599 8056684994 8056681323 Bacteria 8472857
600 Ga0070712_100143091
601 JGI25406J46586_10000019
602 Ga0070658_10047159
603 Ga0070683_100046950
604 Ga0070683_100048677
605 Ga0070683_100093124
606 Ga0070690_100109433
607 Ga0070670_100194994
608 Ga0068869_100184423
609 Ga0070666_10111786
610 Ga0070666_10222571
611 Ga0070680_100047517
612 Ga0070680_100108573
613 Ga0068868_100165730
614 Ga0070660_100015162
615 Ga0070687_100205671
616 Ga0070661_100243470
617 Ga0070661_100343320
618 Ga0070668_100093681
619 Ga0070668_100141941
620 Ga0070668_100185048
621 Ga0070669_100068438
622 Ga0070669_100240597
623 Ga0070675_100099027
624 Ga0070675_100117198
625 Ga0070671_100159964
626 Ga0070674_100052465
627 Ga0070674_100077602
628 Ga0070673_100009738
629 Ga0070673_100059994
630 Ga0070673_100179842
631 Ga0070709_10008701
632 Ga0070709_10100944
633 Ga0070709_10201845
634 Ga0070714_100142738
635 Ga0070714_100162672
636 Ga0070714_100201729
637 Ga0070714_100229064
638 Ga0070713_100013849
639 Ga0070713_100019763
640 Ga0070713_100034927
641 Ga0070713_100104471
642 Ga0070713_100138264
643 Ga0070713_100242886
644 Ga0070710_10015768
645 Ga0070701_10017320
646 Ga0070701_10160568
647 Ga0070711_100004793
648 Ga0070711_100009631
649 Ga0070711_100020471
650 Ga0070711_100075918
651 Ga0070663_100093842
652 Ga0070663_100225391
653 Ga0070663_100324022
654 Ga0070678_100263445
655 Ga0070662_100030427
656 Ga0068867_100026289
657 Ga0070706_100062796
658 Ga0070707_100003587
659 Ga0070707_100208919
660 Ga0070707_100344342
661 Ga0070698_100031468
662 Ga0070698_100034815
663 Ga0070698_100220304
664 Ga0070698_100252643
665 Ga0070699_100004086
666 Ga0070699_100007056
667 Ga0070679_100034220
668 Ga0070679_100076594
669 Ga0070679_100079645
670 Ga0070679_100142941
671 Ga0070684_100008328
672 Ga0070684_100025182
673 Ga0070684_100033090
674 Ga0070697_100034363
675 Ga0070697_100206529
676 Ga0068853_100003011
677 Ga0070665_100306016
678 Ga0070665_100379170
679 Ga0070665_100396545
680 Ga0070665_100416011
681 Ga0068855_100024904
682 Ga0068855_100284328
683 Ga0068855_100405558
684 Ga0070664_100029815
685 Ga0068857_100003284
686 Ga0068857_100326952
687 Ga0068854_100075471
688 Ga0068856_100000013
689 Ga0068856_100385138
690 Ga0068852_100027450
691 Ga0068859_100045153
692 Ga0068859_100336156
693 Ga0068864_100016347
694 Ga0068864_100399005
695 Ga0068861_100070079
696 Ga0068861_100269457
697 Ga0068861_100349513
698 Ga0068861_100478469
699 Ga0068851_10013665
700 Ga0068870_10134884
701 Ga0068863_100022270
702 Ga0068858_100197484
703 Ga0068858_100538305
704 Ga0068860_100000324
705 Ga0068860_100200945
706 Ga0068862_100058558
707 Ga0068862_100194724
708 Ga0081455_10005118
709 Ga0081455_10016029
710 Ga0081455_10039178
711 Ga0081455_10048862
712 Ga0081538_10003312
713 Ga0081540_1000748
714 Ga0081540_1001710
715 Ga0081540_1002253
716 Ga0081540_1023504
717 Ga0081540_1024996
718 Ga0081540_1067849
719 Ga0081539_10000003
720 Ga0081539_10027637
721 Ga0070717_10001928
722 Ga0070717_10030675
723 Ga0070717_10094395
724 Ga0070717_10241345
725 Ga0075365_10005154
726 Ga0075365_10097139
727 Ga0075364_10033931
728 Ga0070715_10008533
729 Ga0070715_10051696
730 Ga0070712_100003154
731 Ga0070712_100003875
732 Ga0070712_100136921
733 Ga0070712_100230076
734 Ga0075362_10005069
735 Ga0075366_10091594
736 Ga0097621_100060432
737 Ga0097621_100114423
738 Ga0068871_100233044
739 Ga0075428_100007151
740 Ga0075430_100047419
741 Ga0075430_100222267
742 Ga0075431_100000305
743 Ga0075433_10369553
744 Ga0075434_100008672
745 Ga0075434_100606327
746 Ga0075429_100243486
747 Ga0068865_100177720
748 Ga0097620_100045154
749 Ga0097620_100336154
750 Ga0099823_1000128
751 Ga0075435_100042108
752 Ga0075435_100123231
753 Ga0075435_100206145
754 Ga0099794_10019293
755 Ga0099794_10089612
756 Ga0105240_10010988
757 Ga0105240_10035447
758 Ga0105240_10099278
759 Ga0105240_10152986
760 Ga0111539_10000072
761 Ga0111539_10054009
762 Ga0105245_10019134
763 Ga0105245_10019910
764 Ga0105245_10563132
765 Ga0105247_10206154
766 Ga0114129_10000134
767 Ga0114129_10095695
768 Ga0105243_10206547
769 Ga0105243_10217838
770 Ga0105241_10065587
771 Ga0105241_10075782
772 Ga0105242_10085549
773 Ga0105248_10008873
774 Ga0105248_10044705
775 Ga0105237_10004604
776 Ga0105237_10471698
777 Ga0105238_10034893
778 Ga0105238_10142468
779 Ga0105249_10062927
780 Ga0099796_10012684
781 Ga0105239_10014287
782 Ga0105239_10091507
783 Ga0105246_10003842
784 Ga0157370_10024143
785 Ga0157370_10026803
786 Ga0157370_10069990
787 Ga0157369_10007909
788 Ga0157369_10018308
789 Ga0157369_10311807
790 Ga0157374_10007429
791 Ga0157374_10359437
792 Ga0157374_10449410
793 Ga0157378_10003222
794 Ga0163162_10291139
795 Ga0157375_10021339
796 Ga0157375_10035861
797 Ga0163163_10017955
798 Ga0157380_10130804
799 Ga0157380_10219010
800 Ga0157380_10252930
801 Ga0157379_10261008
802 Ga0157376_10002689
803 Ga0157376_10307188
804 Ga0213872_10012894
805 Ga0213872_10105215
806 Ga0213876_10018968
807 Ga0224712_10092287
808 Ga0207697_10023842
809 Ga0207692_10038298
810 Ga0207692_10223998
811 Ga0207688_10061495
812 Ga0207688_10074331
813 Ga0207688_10095743
814 Ga0207680_10052955
815 Ga0207647_10120118
816 Ga0207699_10039197
817 Ga0207699_10053188
818 Ga0207699_10119070
819 Ga0207699_10147643
820 Ga0207699_10295067
821 Ga0207645_10055855
822 Ga0207643_10004262
823 Ga0207643_10048493
824 Ga0207705_10057862
825 Ga0207705_10279931
826 Ga0207684_10039139
827 Ga0207684_10080717
828 Ga0207684_10321299
829 Ga0207707_10005482
830 Ga0207707_10027698
831 Ga0207695_10019837
832 Ga0207695_10162016
833 Ga0207695_10220759
834 Ga0207671_10009837
835 Ga0207671_10019927
836 Ga0207693_10011077
837 Ga0207693_10027038
838 Ga0207693_10055785
839 Ga0207693_10150380
840 Ga0207693_10302031
841 Ga0207663_10055337
842 Ga0207663_10132439
843 Ga0207663_10243050
844 Ga0207660_10005549
845 Ga0207660_10095242
846 Ga0207662_10185708
847 Ga0207662_10219227
848 Ga0207657_10010231
849 Ga0207649_10061441
850 Ga0207652_10005283
851 Ga0207652_10058053
852 Ga0207652_10371202
853 Ga0207646_10030351
854 Ga0207646_10291739
855 Ga0207646_10357258
856 Ga0207681_10034474
857 Ga0207681_10172499
858 Ga0207694_10014040
859 Ga0207694_10033332
860 Ga0207694_10130117
861 Ga0207650_10009237
862 Ga0207650_10088506
863 Ga0207650_10348861
864 Ga0207659_10218403
865 Ga0207687_10009931
866 Ga0207687_10313914
867 Ga0207700_10007061
868 Ga0207700_10035641
869 Ga0207700_10061025
870 Ga0207700_10072539
871 Ga0207700_10077515
872 Ga0207700_10086393
873 Ga0207700_10305220
874 Ga0207700_10467803
875 Ga0207664_10099543
876 Ga0207644_10007111
877 Ga0207644_10034247
878 Ga0207644_10158564
879 Ga0207690_10201922
880 Ga0207706_10090399
881 Ga0207670_10248082
882 Ga0207704_10138184
883 Ga0207704_10271469
884 Ga0207665_10085760
885 Ga0207665_10179357
886 Ga0207665_10194637
887 Ga0207691_10108357
888 Ga0207691_10182948
889 Ga0207711_10024593
890 Ga0207711_10359063
891 Ga0207689_10023661
892 Ga0207689_10152775
893 Ga0207661_10002771
894 Ga0207661_10020728
895 Ga0207667_10010841
896 Ga0207667_10117725
897 Ga0207667_10369198
898 Ga0207651_10014535
899 Ga0207651_10074034
900 Ga0207712_10430861
901 Ga0207668_10056602
902 Ga0207668_10089653
903 Ga0207640_10035591
904 Ga0207640_10075730
905 Ga0207640_10141590
906 Ga0207658_10309892
907 Ga0207703_10071017
908 Ga0207703_10194616
909 Ga0207639_10037832
910 Ga0207639_10415704
911 Ga0207678_10019066
912 Ga0207678_10019744
913 Ga0207678_10040063
914 Ga0207678_10155186
915 Ga0207708_10046850
916 Ga0207702_10000090
917 Ga0207702_10151032
918 Ga0207702_10170441
919 Ga0207641_10142746
920 Ga0207641_10154415
921 Ga0207648_10071490
922 Ga0207676_10072921
923 Ga0207676_10087743
924 Ga0207674_10016369
925 Ga0207674_10163644
926 Ga0207674_10326635
927 Ga0207675_100205100
928 Ga0207675_100467758
929 Ga0207683_10049757
930 Ga0207683_10144298
931 Ga0207683_10147370
932 Ga0207698_10239914
933 Ga0209389_1000223
934 Ga0209489_102324
935 Ga0209700_102324
936 Ga0209588_1040258
937 Ga0207428_10001757
938 Ga0268266_10231700
939 Ga0268266_10238501
940 Ga0268265_10006977
941 Ga0268264_10000038
942 Ga0265325_10009012
943 Ga0265340_10001297
944 Ga0265316_10061566
945 Ga0307513_10289099
946 Ga0307509_10132483
947 Ga0307509_10182767
948 Ga0307508_10000063
949 Ga0265314_10002042
950 Ga0265342_10042030
951 Ga0307516_10001267
952 Ga0307516_10025196
953 Ga0307516_10129015
954 Ga0307516_10133892
955 Ga0307406_10177197
956 Ga0307406_10241982
957 Ga0307409_100045495
958 Ga0307411_10031449
959 Ga0307510_10110978
960 Ga0307510_10239116
961 Ga0373926_0013954
962 Ga0373926_0077332
963 Ga0373944_0001795
964 Ga0373936_0034392
965 Ga0373945_0009728
966 Ga0373954_0011226
967 Ga0373956_0119775
968 Ga0373943_0006158
969 Ga0373943_0016208
970 Ga0373943_0164739
971 Ga0373931_0108871
972 Ga0373935_0069054
973 Ga0373927_0001137
974 Ga0373927_0015387
975 Ga0373933_0024448
976 Ga0373933_0156681
977 Ga0373947_0000866
978 Ga0373947_0061434
979 Ga0373947_0122957
980 Ga0373937_0051482
981 Ga0373937_0171283
982 Ga0372808_002025
983 Ga0373925_0062901
984 Ga0373925_0186130
985 Ga0395900_0395043
986 Ga0395898_0038287
987 Ga0395898_0370043
988 Ga0395905_0247090
989 Ga0395901_0046141
990 Ga0395901_0243005
991 Ga0436365_0233583
992 Ga0436365_0500204
993 Ga0436360_0881351
994 Ga0436361_0060565
995 Ga0436361_0517667
996 Ga0436361_0674485
997 Ga0436361_1151628
998 Ga0436363_0802403
999 Ga0436363_1463080
1000 Ga0436362_0475045
1001 Ga0439465_0009720
1002 Ga0466958_0294447
1003 Ga0495592_0033927
1004 Ga0495629_0089531
1005 Ga0495629_0181653
1006 Ga0495629_0193098
1007 Ga0495638_0154043
1008 Ga0495651_0166683
1009 Ga0495651_0222536
1010 Ga0495653_0011816
1011 Ga0495580_0195326
1012 Ga0495662_0000679
1013 Ga0495662_0047649
1014 Ga0495664_0003224
1015 Ga0495618_0006865
1016 Ga0495628_0018588
1017 Ga0495628_0220315
1018 Ga0495628_0290191
1019 Ga0495630_0016967
1020 Ga0495666_0028289
1021 Ga0495652_0208328
1022 Ga0495640_0077456
1023 Ga0495645_0010524
1024 Ga0495645_0090110
1025 Ga0495635_0005654
1026 Ga0495659_0073007
1027 Ga0495588_0016420
1028 Ga0495657_0131552
1029 Ga0495647_0057046
1030 Ga0495658_0029682
1031 Ga0495658_0084813
1032 Ga0495658_0220670
1033 Ga0495669_0013947
1034 Ga0495649_0178393
1035 Ga0495589_0067806
1036 Ga0495581_0075330
1037 Ga0495581_0123397
1038 Ga0495604_0094714
1039 Ga0495604_0285577
1040 Ga0495672_0079876
1041 Ga0495673_0019752
1042 Ga0495684_0017584
1043 Ga0495593_0050734
1044 Ga0495593_0090194
1045 Ga0495593_0130518
1046 Ga0495602_0120887
1047 Ga0496100_0081027
1048 Ga0496101_0000882
1049 Ga0496101_0039070
1050 Ga0496101_0190487
1051 Ga0496102_0039900
1052 Ga0496102_0430861
1053 Ga0496104_0004009
1054 Ga0496104_0018455
1055 Ga0496105_0006844
1056 Ga0496105_0039645
1057 Ga0496106_0000714
1058 Ga0496106_0001345
1059 Ga0496106_0040317
1060 Ga0496106_0407115
1061 Ga0496107_0005648
1062 Ga0496107_0048419
1063 Ga0496108_0002665
1064 Ga0496108_0043963
1065 Ga0496108_0099308
1066 Ga0496109_0008345
1067 Ga0496109_0016385
1068 Ga0496109_0026663
1069 Ga0496109_0038642
1070 Ga0496109_0052383
1071 Ga0496110_0007723
1072 Ga0496110_0018095
1073 Ga0496110_0041846
1074 Ga0496111_0001353
1075 Ga0496111_0006089
1076 Ga0496111_0032361
1077 Ga0496112_0000960
1078 Ga0496112_0022183
1079 Ga0496112_0039791
1080 Ga0496112_0048765
1081 Ga0496112_0114514
1082 Ga0496112_0170878
1083 Ga0496112_0295604
1084 Ga0496113_0004820
1085 Ga0496113_0016236
1086 Ga0496113_0020983
1087 Ga0496113_0164333
1088 Ga0496114_0017982
1089 Ga0496114_0032200
1090 Ga0496114_0317854
1091 Ga0496115_0000999
1092 Ga0496115_0076994
1093 Ga0496115_0251795
1094 Ga0496115_0423204
1095 Ga0496118_0002645
1096 Ga0496118_0037911
1097 Ga0496118_0083239
1098 Ga0496118_0192802
1099 Ga0496121_0000418
1100 Ga0496121_0001662
1101 Ga0496121_0008362
1102 Ga0496121_0127743
1103 Ga0496121_0174569
1104 Ga0496124_0082913
1105 Ga0496125_0041010
1106 Ga0496126_0004626
1107 Ga0496126_0011720
1108 Ga0496126_0014492
1109 Ga0496126_0016798
1110 Ga0496126_0022472
1111 Ga0496126_0045704
1112 Ga0496126_0053934
1113 Ga0496126_0105378
1114 Ga0496126_0184437
1115 Ga0496126_0244345
1116 Ga0501041_0249455
1117 Ga0501070_0051561
1118 nmdc:mga0yw44_28857_c1
1119 nmdc:mga0yw44_336157_c1
1120 nmdc:mga0yw44_640_c1
1121 nmdc:mga05p37_168772_c1
1122 nmdc:mga05p37_51_c1
1123 nmdc:mga05p37_785716_c1
1124 nmdc:mga0qj67_76816_c1
1125 nmdc:mga0qj67_93328_c1
1126 nmdc:mga06r32_16_c1
1127 nmdc:mga06r32_93535_c1
1128 nmdc:mga08y16_79_c2
1129 nmdc:mga0n895_288964_c1
1130 nmdc:mga0n895_394482_c1
1131 nmdc:mga0rr50_90336_c1
1132 nmdc:mga0a205_383936_c1
1133 Ga0495601_0099997
1134 Ga0495612_0001325
1135 Ga0495612_0019417
1136 Ga0500635_0001863
1137 Ga0500635_0009407
1138 Ga0495595_0007151
1139 Ga0495595_0018796
1140 Ga0495595_0169719
1141 Ga0495619_0004937
1142 Ga0495619_0028832
1143 Ga0495619_0039393
1144 Ga0500647_0120054
1145 Ga0500583_0128574
1146 Ga0500566_0000009
1147 Ga0500566_0001254
1148 Ga0500640_014979
1149 Ga0500641_0008673
1150 Ga0500556_0004126
1151 Ga0500594_0039519
1152 Ga0500595_000398
1153 Ga0500595_005042
1154 Ga0500595_006280
1155 Ga0500642_0059218
1156 Ga0500559_0000488
1157 Ga0500559_0034889
1158 Ga0500568_0008345
1159 Ga0500577_0058523
1160 Ga0500590_024866
1161 Ga0500603_000016
1162 Ga0500603_000193
1163 Ga0500630_000034
1164 Ga0500634_0111691
1165 Ga0500638_000184
1166 Ga0500638_011970
1167 Ga0500639_000017
1168 Ga0500639_066432
1169 Ga0500637_0000118
1170 Ga0500637_0101461
1171 Ga0500596_000521
1172 Ga0500601_003847
1173 Ga0500661_000044
1174 Ga0501082_0417319
1175 2513679284
1176 2513679852
1177 2513695717
1178 2513889529
1179 2524463545
1180 2723846963
1181 2793084266
1182 2847938923
1183 2874611070
1184 2876811086
1185 2879114516
1186 2885390493
1187 2885390653
1188 2885412909
1189 2903772885
1190 2908759619
1191 2922362655
1192 2922387531
1193 8006931040
1194 8006968464
1195 8006987396
1196 8006994902
1197 8056679474
1198 8056684994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

71

381

0.92

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

1

52

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8568 1 330
4ast-assembly1.cif.gz_G the apo structure of a bacterial aldo-keto reductase akr14a1 0.8496 1 324
7ezl-assembly1.cif.gz_A rice l-galactose dehydrogenase (holo form) 0.8473 1 326
4ast-assembly1.cif.gz_H the apo structure of a bacterial aldo-keto reductase akr14a1 0.8465 1 323
4ast-assembly1.cif.gz_A the apo structure of a bacterial aldo-keto reductase akr14a1 0.8423 1 325
ID Description Score Start End Superfamily
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8568 1 330 3.20.20.100
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8503 1 116 3.20.20.100
3n6qB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8332 4 325 3.20.20.100
af_Q2QQV2_1_312_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8304 1 326 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8299 1 321 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2H9V6T5-F1-model_v4 deleted 0.9843 1 330
AF-A0A2H9V6T5-F1-model_v4 deleted 0.9813 1 330
AF-A0A3A9JQ81-F1-model_v4 Aldo/keto reductase 0.9804 1 330
AF-A0A1V2H5L1-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9786 69 323 GO:0005829
GO:0016491
AF-A0A3A9JQ81-F1-model_v4 Aldo/keto reductase 0.9774 1 330

Map