F467866

General Info

Members Datasets Scaffolds Average Seq Length
599 236 598 364

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10012170|Ga0105249_100121707
Length 397
Sequence MADFLQRCVFAVKAKFDAADFLILFLCLQHCKMTIREIVSFLETIAPPSLQEGYDNAGLLTGNGDWPCTGVVCALDATAEVIEEAIQKGANCVVAHHPIIFGGIKQISAHQYVGRALIAAIKHDIAIYAIHTNLDNILSGVNGKMADLLALENRQVLLPKAGQLMKLFCFVPHPHLEKLRSALFAAGAGQLGQYSECCFVTEGTGSFKPGESAKPFVGEIGKRHEEKESRLEVIFPTHLKSAVLKAMYENHPYEEVAFDLVALANDHPALGSGLVGDLPAKMDAKDFLALVKTRFSLPVIRHTPLLADPISRVALCGGAGSFLISKALNAGAQAFITADLKYHEFFDCQGRMLIADIGHYESEQFTIDLLQQVLQQKFRNFAVLKTGVRTNPITYYF

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
226 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
232 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.01
Nodule 0
Rhizoplane 0.67
Rhizosphere 89.65
Stem 0
Stem Tuber 0
Unclassified 4.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001198 3300003203 Bacteria 12201
2 rootH1_10022049 3300003316 Bacteria 4472
3 rootH1_10025341 3300003316 Bacteria 18680
4 rootH2_10026040 3300003320 Bacteria 11532
5 rootH2_10028893 3300003320 Bacteria 7727
6 rootH2_10058174 3300003320 Bacteria 4615
7 rootH2_10162304 3300003320 Bacteria 3234
8 rootH2_10220972 3300003320 Bacteria 3336
9 rootL2_10052717 3300003322 Bacteria 2672
10 rootL2_10092713 3300003322 Bacteria 1296
11 rootH1_10000715 3300003323 Bacteria 71212
12 rootH1_10067989 3300003323 Bacteria 1918
13 rootH1_10074886 3300003323 Bacteria 2991
14 rootH1_10178763 3300003323 Bacteria 2888
15 JGI25160J50197_1001526 3300003354 Bacteria 11492
16 Ga0065712_10077506 3300005290 Bacteria 3485
17 Ga0065707_10151531 3300005295 Bacteria 1653
18 Ga0070658_10031606 3300005327 Bacteria 4251
19 Ga0070676_10023434 3300005328 Bacteria 3469
20 Ga0070676_10026169 3300005328 Bacteria 3302
21 Ga0070676_10034209 3300005328 Bacteria 2918
22 Ga0070676_10059285 3300005328 Bacteria 2270
23 Ga0070683_100010729 3300005329 Bacteria 7880
24 Ga0070683_100082309 3300005329 Bacteria 3014
25 Ga0070683_100089636 3300005329 Bacteria 2887
26 Ga0070670_100003751 3300005331 Bacteria 12649
27 Ga0070670_100052071 3300005331 Bacteria 3516
28 Ga0068869_100033791 3300005334 Bacteria 3613
29 Ga0068869_100055414 3300005334 Bacteria 2889
30 Ga0068869_100063018 3300005334 Bacteria 2722
31 Ga0068869_100162633 3300005334 Bacteria 1738
32 Ga0070666_10000179 3300005335 Bacteria 43394
33 Ga0070666_10001826 3300005335 Bacteria 12979
34 Ga0070666_10026741 3300005335 Bacteria 3773
35 Ga0070666_10044833 3300005335 Bacteria 2964
36 Ga0070666_10045323 3300005335 Bacteria 2948
37 Ga0070666_10090697 3300005335 Bacteria 2099
38 Ga0070682_100000037 3300005337 Bacteria 147526
39 Ga0070682_100058299 3300005337 Bacteria 2435
40 Ga0068868_100026013 3300005338 Bacteria 4456
41 Ga0068868_100126770 3300005338 Bacteria 2086
42 Ga0068868_100304564 3300005338 Unclassified 1354
43 Ga0070660_100038476 3300005339 Bacteria 3632
44 Ga0070689_100352431 3300005340 Unclassified 1235
45 Ga0070687_100028213 3300005343 Bacteria 2720
46 Ga0070661_100000716 3300005344 Bacteria 24318
47 Ga0070661_100008231 3300005344 Bacteria 7195
48 Ga0070668_100003384 3300005347 Bacteria 11761
49 Ga0070668_100047921 3300005347 Bacteria 3286
50 Ga0070669_100001167 3300005353 Bacteria 19189
51 Ga0070669_100013551 3300005353 Bacteria 5795
52 Ga0070669_100038495 3300005353 Bacteria 3472
53 Ga0070669_100041358 3300005353 Bacteria 3352
54 Ga0070669_100220748 3300005353 Unclassified 1498
55 Ga0070675_100025329 3300005354 Unclassified 4756
56 Ga0070675_100164966 3300005354 Bacteria 1907
57 Ga0070671_100003971 3300005355 Bacteria 11647
58 Ga0070671_100043469 3300005355 Bacteria 3733
59 Ga0070674_100010748 3300005356 Bacteria 5550
60 Ga0070674_100073158 3300005356 Bacteria 2429
61 Ga0070673_100120469 3300005364 Unclassified 2188
62 Ga0070688_100156348 3300005365 Unclassified 1562
63 Ga0070659_100025806 3300005366 Bacteria 4518
64 Ga0070667_100006582 3300005367 Bacteria 9661
65 Ga0070667_100026589 3300005367 Bacteria 4814
66 Ga0070663_100007168 3300005455 Bacteria 6771
67 Ga0070678_100046800 3300005456 Bacteria 3105
68 Ga0070678_100154696 3300005456 Bacteria 1851
69 Ga0070662_100175361 3300005457 Bacteria 1686
70 Ga0070681_10004917 3300005458 Bacteria 12834
71 Ga0070681_10044366 3300005458 Bacteria 4450
72 Ga0070681_10085297 3300005458 Bacteria 3111
73 Ga0068867_100015142 3300005459 Bacteria 5468
74 Ga0068867_100058022 3300005459 Bacteria 2868
75 Ga0068867_100093421 3300005459 Bacteria 2286
76 Ga0068867_100129819 3300005459 Bacteria 1957
77 Ga0068867_100132720 3300005459 Bacteria 1937
78 Ga0070685_10046594 3300005466 Unclassified 2489
79 Ga0070685_10191266 3300005466 Bacteria 1324
80 Ga0070698_100005543 3300005471 Bacteria 13795
81 Ga0070698_100061752 3300005471 Bacteria 3782
82 Ga0070679_100121271 3300005530 Bacteria 2599
83 Ga0070684_100000134 3300005535 Bacteria 49154
84 Ga0070684_100000916 3300005535 Bacteria 20926
85 Ga0070684_100038360 3300005535 Bacteria 4115
86 Ga0068853_100001259 3300005539 Bacteria 18115
87 Ga0068853_100009491 3300005539 Bacteria 7841
88 Ga0068853_100024422 3300005539 Bacteria 5068
89 Ga0068853_100028345 3300005539 Bacteria 4710
90 Ga0068853_100352210 3300005539 Bacteria 1370
91 Ga0070672_100010174 3300005543 Bacteria 6514
92 Ga0070672_100031315 3300005543 Bacteria 4002
93 Ga0070672_100105387 3300005543 Unclassified 2292
94 Ga0070672_100172539 3300005543 Unclassified 1799
95 Ga0070672_100205808 3300005543 Bacteria 1647
96 Ga0070672_100215229 3300005543 Bacteria 1610
97 Ga0070686_100081058 3300005544 Bacteria 2148
98 Ga0070693_100015081 3300005547 Bacteria 3974
99 Ga0070665_100000001 3300005548 Bacteria 1083363
100 Ga0070665_100106262 3300005548 Unclassified 2809
101 Ga0070704_100107858 3300005549 Unclassified 2113
102 Ga0068855_100000210 3300005563 Bacteria 74786
103 Ga0068855_100001078 3300005563 Bacteria 33907
104 Ga0068855_100038957 3300005563 Bacteria 5643
105 Ga0068855_100056621 3300005563 Bacteria 4599
106 Ga0070664_100001395 3300005564 Bacteria 19263
107 Ga0070664_100020800 3300005564 Bacteria 5405
108 Ga0070664_100159499 3300005564 Bacteria 1995
109 Ga0068857_100001709 3300005577 Bacteria 17667
110 Ga0068857_100042194 3300005577 Bacteria 4046
111 Ga0068854_100035707 3300005578 Bacteria 3481
112 Ga0068854_100047694 3300005578 Bacteria 3054
113 Ga0068856_100026621 3300005614 Bacteria 5639
114 Ga0068856_100027949 3300005614 Bacteria 5504
115 Ga0068856_100106625 3300005614 Bacteria 2797
116 Ga0068856_100172391 3300005614 Bacteria 2176
117 Ga0070702_100030791 3300005615 Bacteria 2929
118 Ga0068852_100001649 3300005616 Bacteria 15236
119 Ga0068852_100035306 3300005616 Bacteria 4169
120 Ga0068859_100000163 3300005617 Bacteria 64401
121 Ga0068859_100001345 3300005617 Bacteria 25063
122 Ga0068859_100012614 3300005617 Bacteria 8499
123 Ga0068859_100013898 3300005617 Bacteria 8076
124 Ga0068859_100053201 3300005617 Bacteria 4071
125 Ga0068859_100116755 3300005617 Bacteria 2733
126 Ga0068859_100407610 3300005617 Unclassified 1455
127 Ga0068859_100451672 3300005617 Bacteria 1381
128 Ga0068864_100000555 3300005618 Bacteria 31945
129 Ga0068864_100035639 3300005618 Bacteria 4237
130 Ga0068864_100056751 3300005618 Bacteria 3383
131 Ga0068864_100169300 3300005618 Bacteria 1991
132 Ga0068861_100002071 3300005719 Bacteria 13009
133 Ga0068861_100062950 3300005719 Bacteria 2851
134 Ga0068851_10020833 3300005834 Bacteria 3178
135 Ga0068851_10133228 3300005834 Bacteria 1346
136 Ga0068870_10002941 3300005840 Bacteria 7180
137 Ga0068870_10009548 3300005840 Bacteria 4419
138 Ga0068863_100001590 3300005841 Bacteria 22477
139 Ga0068863_100034551 3300005841 Unclassified 4815
140 Ga0068858_100005829 3300005842 Bacteria 12032
141 Ga0068858_100008767 3300005842 Bacteria 9702
142 Ga0068858_100118833 3300005842 Bacteria 2471
143 Ga0068858_100177725 3300005842 Bacteria 2009
144 Ga0068860_100000004 3300005843 Bacteria 506126
145 Ga0068860_100000431 3300005843 Bacteria 53318
146 Ga0068860_100019370 3300005843 Bacteria 6600
147 Ga0068860_100026397 3300005843 Bacteria 5599
148 Ga0068860_100048568 3300005843 Bacteria 4045
149 Ga0068860_100274903 3300005843 Bacteria 1645
150 Ga0068862_100003045 3300005844 Bacteria 14603
151 Ga0068862_100060004 3300005844 Bacteria 3267
152 Ga0068862_100067148 3300005844 Bacteria 3091
153 Ga0068862_100180932 3300005844 Bacteria 1892
154 Ga0081539_10001080 3300005985 Bacteria 49627
155 Ga0070716_100178156 3300006173 Bacteria 1393
156 Ga0075366_10047078 3300006195 Bacteria 2556
157 Ga0075366_10066684 3300006195 Bacteria 2141
158 Ga0075366_10069140 3300006195 Bacteria 2102
159 Ga0097621_100001101 3300006237 Bacteria 18887
160 Ga0097621_100007450 3300006237 Bacteria 7827
161 Ga0097621_100090147 3300006237 Bacteria 2565
162 Ga0068871_100000076 3300006358 Bacteria 55186
163 Ga0068871_100013914 3300006358 Bacteria 5983
164 Ga0068871_100014135 3300006358 Bacteria 5939
165 Ga0068871_100028750 3300006358 Bacteria 4362
166 Ga0068871_100150962 3300006358 Bacteria 1981
167 Ga0068865_100046443 3300006881 Bacteria 2980
168 Ga0068865_100052426 3300006881 Bacteria 2827
169 Ga0068865_100067626 3300006881 Unclassified 2524
170 Ga0068865_100219709 3300006881 Bacteria 1485
171 Ga0097620_100000163 3300006931 Bacteria 64401
172 Ga0097620_100001345 3300006931 Bacteria 25063
173 Ga0097620_100012613 3300006931 Bacteria 8499
174 Ga0097620_100013898 3300006931 Bacteria 8076
175 Ga0097620_100053200 3300006931 Bacteria 4071
176 Ga0097620_100116750 3300006931 Bacteria 2733
177 Ga0097620_100407612 3300006931 Unclassified 1455
178 Ga0097620_100451663 3300006931 Bacteria 1381
179 Ga0105240_10000061 3300009093 Bacteria 218897
180 Ga0105240_10000087 3300009093 Bacteria 187637
181 Ga0105240_10001401 3300009093 Bacteria 41397
182 Ga0105240_10027638 3300009093 Bacteria 7425
183 Ga0105240_10050030 3300009093 Bacteria 5271
184 Ga0105240_10217601 3300009093 Bacteria 2227
185 Ga0111539_10002150 3300009094 Bacteria 26359
186 Ga0111539_10013736 3300009094 Bacteria 10117
187 Ga0111539_10024406 3300009094 Bacteria 7420
188 Ga0105245_10148546 3300009098 Bacteria 2214
189 Ga0105247_10002644 3300009101 Bacteria 12067
190 Ga0105247_10003918 3300009101 Bacteria 9600
191 Ga0105241_10000491 3300009174 Bacteria 29828
192 Ga0105241_10008476 3300009174 Bacteria 7558
193 Ga0105241_10036393 3300009174 Bacteria 3704
194 Ga0105242_10018926 3300009176 Bacteria 5393
195 Ga0105242_10041071 3300009176 Unclassified 3729
196 Ga0105242_10041092 3300009176 Bacteria 3728
197 Ga0105242_10043253 3300009176 Bacteria 3644
198 Ga0105242_10048024 3300009176 Bacteria 3468
199 Ga0105242_10101819 3300009176 Bacteria 2435
200 Ga0105248_10005454 3300009177 Bacteria 13977
201 Ga0105248_10181012 3300009177 Bacteria 2375
202 Ga0105248_10181647 3300009177 Unclassified 2370
203 Ga0105237_10000377 3300009545 Bacteria 63580
204 Ga0105237_10001797 3300009545 Bacteria 27696
205 Ga0105237_10002561 3300009545 Bacteria 22436
206 Ga0105237_10003301 3300009545 Bacteria 19250
207 Ga0105237_10005147 3300009545 Bacteria 14800
208 Ga0105237_10007186 3300009545 Bacteria 12227
209 Ga0105237_10085267 3300009545 Bacteria 3148
210 Ga0105238_10000725 3300009551 Bacteria 34423
211 Ga0105238_10066267 3300009551 Bacteria 3613
212 Ga0105249_10002038 3300009553 Bacteria 17526
213 Ga0105249_10002607 3300009553 Bacteria 15620
214 Ga0105249_10003777 3300009553 Bacteria 13077
215 Ga0105249_10004927 3300009553 Bacteria 11521
216 Ga0105249_10012170 3300009553 Bacteria 7576
217 Ga0105249_10099625 3300009553 Bacteria 2731
218 Ga0105239_10000029 3300010375 Bacteria 234749
219 Ga0105239_10002405 3300010375 Bacteria 23853
220 Ga0105239_10004460 3300010375 Bacteria 16732
221 Ga0105239_10004600 3300010375 Bacteria 16426
222 Ga0105239_10016150 3300010375 Bacteria 8261
223 Ga0105239_10094681 3300010375 Unclassified 3299
224 Ga0105239_10168320 3300010375 Unclassified 2450
225 Ga0105239_10325294 3300010375 Bacteria 1734
226 Ga0105239_10673846 3300010375 Bacteria 1182
227 Ga0105246_10063665 3300011119 Bacteria 2573
228 Ga0105246_10163105 3300011119 Bacteria 1700
229 Ga0105246_10199240 3300011119 Bacteria 1555
230 Ga0157373_10000150 3300013100 Bacteria 56030
231 Ga0157373_10047171 3300013100 Bacteria 3074
232 Ga0157373_10125053 3300013100 Unclassified 1808
233 Ga0157373_10236219 3300013100 Bacteria 1292
234 Ga0157371_10001842 3300013102 Bacteria 21373
235 Ga0157371_10008939 3300013102 Bacteria 7928
236 Ga0157371_10026370 3300013102 Bacteria 4226
237 Ga0157371_10094111 3300013102 Bacteria 2123
238 Ga0157371_10156361 3300013102 Bacteria 1627
239 Ga0157370_10001188 3300013104 Bacteria 32485
240 Ga0157370_10052979 3300013104 Bacteria 3871
241 Ga0157370_10068891 3300013104 Bacteria 3343
242 Ga0157369_10017131 3300013105 Bacteria 8140
243 Ga0157369_10028467 3300013105 Bacteria 6184
244 Ga0157369_10136306 3300013105 Bacteria 2599
245 Ga0157369_10148357 3300013105 Bacteria 2479
246 Ga0157369_10498156 3300013105 Bacteria 1260
247 Ga0157374_10000001 3300013296 Bacteria 1077351
248 Ga0157374_10001176 3300013296 Bacteria 22324
249 Ga0157374_10002087 3300013296 Bacteria 16807
250 Ga0157374_10014056 3300013296 Bacteria 6999
251 Ga0157374_10021812 3300013296 Bacteria 5706
252 Ga0157374_10026774 3300013296 Bacteria 5191
253 Ga0157374_10130203 3300013296 Bacteria 2435
254 Ga0157374_10184584 3300013296 Bacteria 2039
255 Ga0157378_10005700 3300013297 Bacteria 10895
256 Ga0157378_10036442 3300013297 Bacteria 4353
257 Ga0157378_10047163 3300013297 Bacteria 3829
258 Ga0157378_10063036 3300013297 Bacteria 3311
259 Ga0157378_10084839 3300013297 Bacteria 2868
260 Ga0157378_10108111 3300013297 Bacteria 2546
261 Ga0157378_10177229 3300013297 Bacteria 2003
262 Ga0157378_10181167 3300013297 Bacteria 1982
263 Ga0157378_10210567 3300013297 Bacteria 1843
264 Ga0157378_10589957 3300013297 Bacteria 1121
265 Ga0163162_10000170 3300013306 Bacteria 60233
266 Ga0163162_10000461 3300013306 Bacteria 37669
267 Ga0163162_10000944 3300013306 Bacteria 27022
268 Ga0163162_10007991 3300013306 Bacteria 10315
269 Ga0163162_10056441 3300013306 Bacteria 3955
270 Ga0163162_10100627 3300013306 Bacteria 2982
271 Ga0163162_10134445 3300013306 Unclassified 2583
272 Ga0163162_10151731 3300013306 Bacteria 2435
273 Ga0157372_10006562 3300013307 Bacteria 12380
274 Ga0157372_10007169 3300013307 Bacteria 11864
275 Ga0157372_10008654 3300013307 Bacteria 10809
276 Ga0157372_10008725 3300013307 Bacteria 10767
277 Ga0157372_10011120 3300013307 Bacteria 9573
278 Ga0157372_10031941 3300013307 Bacteria 5769
279 Ga0157372_10083093 3300013307 Bacteria 3627
280 Ga0157372_10085131 3300013307 Bacteria 3585
281 Ga0157372_10295923 3300013307 Bacteria 1882
282 Ga0157372_10391260 3300013307 Bacteria 1620
283 Ga0157372_10420713 3300013307 Unclassified 1557
284 Ga0157375_10000125 3300013308 Bacteria 75607
285 Ga0157375_10010676 3300013308 Bacteria 8089
286 Ga0157375_10010714 3300013308 Bacteria 8077
287 Ga0157375_10032564 3300013308 Bacteria 4945
288 Ga0157375_10127599 3300013308 Bacteria 2660
289 Ga0157375_10182090 3300013308 Unclassified 2253
290 Ga0157375_10243755 3300013308 Bacteria 1957
291 Ga0163163_10000281 3300014325 Bacteria 50719
292 Ga0163163_10000448 3300014325 Bacteria 37700
293 Ga0163163_10055250 3300014325 Bacteria 3925
294 Ga0163163_10057689 3300014325 Bacteria 3839
295 Ga0163163_10108026 3300014325 Bacteria 2809
296 Ga0163163_10133527 3300014325 Bacteria 2522
297 Ga0157380_10000955 3300014326 Bacteria 18339
298 Ga0157380_10073193 3300014326 Bacteria 2777
299 Ga0157380_10152098 3300014326 Bacteria 2002
300 Ga0157377_10000426 3300014745 Bacteria 18260
301 Ga0157377_10051117 3300014745 Bacteria 2330
302 Ga0157377_10177431 3300014745 Unclassified 1337
303 Ga0157379_10016017 3300014968 Bacteria 6590
304 Ga0157379_10064333 3300014968 Bacteria 3278
305 Ga0157379_10071174 3300014968 Bacteria 3111
306 Ga0157379_10103092 3300014968 Unclassified 2560
307 Ga0157379_10263220 3300014968 Unclassified 1567
308 Ga0157376_10001405 3300014969 Bacteria 15829
309 Ga0157376_10013013 3300014969 Bacteria 6196
310 Ga0157376_10141415 3300014969 Bacteria 2159
311 Ga0157376_10238037 3300014969 Bacteria 1695
312 Ga0163161_10001802 3300017792 Bacteria 15639
313 Ga0163161_10029799 3300017792 Bacteria 3879
314 Ga0163161_10035217 3300017792 Bacteria 3583
315 Ga0213876_10006422 3300021384 Bacteria 6411
316 Ga0209026_1000282 3300025250 Bacteria 58460
317 Ga0207426_1000105 3300025302 Bacteria 247269
318 Ga0207656_10027470 3300025321 Bacteria 2328
319 Ga0207642_10003294 3300025899 Bacteria 5076
320 Ga0207680_10000068 3300025903 Bacteria 45911
321 Ga0207680_10088042 3300025903 Bacteria 1968
322 Ga0207647_10015024 3300025904 Bacteria 5322
323 Ga0207647_10057639 3300025904 Bacteria 2381
324 Ga0207645_10000245 3300025907 Bacteria 45135
325 Ga0207645_10092111 3300025907 Bacteria 1950
326 Ga0207643_10012710 3300025908 Bacteria 4551
327 Ga0207705_10024472 3300025909 Bacteria 4308
328 Ga0207654_10000699 3300025911 Bacteria 18733
329 Ga0207654_10007372 3300025911 Bacteria 5539
330 Ga0207707_10078189 3300025912 Bacteria 2888
331 Ga0207707_10118721 3300025912 Bacteria 2311
332 Ga0207695_10000057 3300025913 Bacteria 376090
333 Ga0207695_10000568 3300025913 Bacteria 75553
334 Ga0207695_10001216 3300025913 Bacteria 44107
335 Ga0207695_10003352 3300025913 Bacteria 22653
336 Ga0207695_10055112 3300025913 Bacteria 4146
337 Ga0207695_10086339 3300025913 Bacteria 3165
338 Ga0207695_10098493 3300025913 Bacteria 2923
339 Ga0207671_10001122 3300025914 Bacteria 32272
340 Ga0207671_10002095 3300025914 Bacteria 21819
341 Ga0207671_10005145 3300025914 Bacteria 12181
342 Ga0207671_10009050 3300025914 Bacteria 8375
343 Ga0207671_10030397 3300025914 Bacteria 4028
344 Ga0207671_10052086 3300025914 Bacteria 3033
345 Ga0207657_10025037 3300025919 Bacteria 5512
346 Ga0207657_10165802 3300025919 Bacteria 1792
347 Ga0207657_10249814 3300025919 Bacteria 1414
348 Ga0207649_10000604 3300025920 Bacteria 24340
349 Ga0207649_10010286 3300025920 Bacteria 5137
350 Ga0207652_10000029 3300025921 Bacteria 149054
351 Ga0207681_10064976 3300025923 Bacteria 2521
352 Ga0207681_10339500 3300025923 Bacteria 1199
353 Ga0207694_10009443 3300025924 Bacteria 7354
354 Ga0207694_10051025 3300025924 Bacteria 3206
355 Ga0207650_10037658 3300025925 Bacteria 3526
356 Ga0207650_10194944 3300025925 Bacteria 1620
357 Ga0207659_10362311 3300025926 Bacteria 1205
358 Ga0207644_10057213 3300025931 Bacteria 2815
359 Ga0207706_10000633 3300025933 Bacteria 37294
360 Ga0207706_10002220 3300025933 Bacteria 18951
361 Ga0207706_10003075 3300025933 Bacteria 16042
362 Ga0207706_10031919 3300025933 Unclassified 4692
363 Ga0207706_10118133 3300025933 Bacteria 2332
364 Ga0207686_10027101 3300025934 Bacteria 3352
365 Ga0207686_10035161 3300025934 Bacteria 3005
366 Ga0207686_10173580 3300025934 Bacteria 1522
367 Ga0207670_10024136 3300025936 Bacteria 3797
368 Ga0207670_10168485 3300025936 Bacteria 1640
369 Ga0207669_10093905 3300025937 Bacteria 1961
370 Ga0207704_10011586 3300025938 Bacteria 4347
371 Ga0207704_10025149 3300025938 Bacteria 3245
372 Ga0207704_10261122 3300025938 Bacteria 1306
373 Ga0207665_10130279 3300025939 Bacteria 1785
374 Ga0207691_10008548 3300025940 Bacteria 9831
375 Ga0207691_10014754 3300025940 Bacteria 7446
376 Ga0207691_10021745 3300025940 Bacteria 6056
377 Ga0207691_10036342 3300025940 Bacteria 4564
378 Ga0207691_10043790 3300025940 Bacteria 4123
379 Ga0207691_10214059 3300025940 Bacteria 1673
380 Ga0207691_10227033 3300025940 Bacteria 1618
381 Ga0207689_10002325 3300025942 Bacteria 17792
382 Ga0207689_10009287 3300025942 Bacteria 8501
383 Ga0207689_10015881 3300025942 Bacteria 6377
384 Ga0207689_10027865 3300025942 Bacteria 4727
385 Ga0207689_10030048 3300025942 Bacteria 4531
386 Ga0207661_10000092 3300025944 Bacteria 57540
387 Ga0207661_10037662 3300025944 Unclassified 3785
388 Ga0207661_10055068 3300025944 Bacteria 3189
389 Ga0207661_10096544 3300025944 Bacteria 2473
390 Ga0207679_10000146 3300025945 Bacteria 58219
391 Ga0207679_10031666 3300025945 Bacteria 3704
392 Ga0207679_10035820 3300025945 Unclassified 3514
393 Ga0207679_10124309 3300025945 Bacteria 2059
394 Ga0207679_10275420 3300025945 Bacteria 1441
395 Ga0207667_10000246 3300025949 Bacteria 76379
396 Ga0207667_10008205 3300025949 Bacteria 12430
397 Ga0207667_10008415 3300025949 Bacteria 12261
398 Ga0207667_10009109 3300025949 Bacteria 11733
399 Ga0207651_10234702 3300025960 Unclassified 1491
400 Ga0207712_10004698 3300025961 Bacteria 8631
401 Ga0207712_10005427 3300025961 Bacteria 8046
402 Ga0207712_10011405 3300025961 Bacteria 5662
403 Ga0207668_10020856 3300025972 Bacteria 4172
404 Ga0207668_10029997 3300025972 Bacteria 3570
405 Ga0207668_10062025 3300025972 Bacteria 2632
406 Ga0207640_10033858 3300025981 Bacteria 3183
407 Ga0207658_10023118 3300025986 Bacteria 4335
408 Ga0207703_10031912 3300026035 Bacteria 4168
409 Ga0207703_10064714 3300026035 Unclassified 3002
410 Ga0207639_10000667 3300026041 Bacteria 23704
411 Ga0207639_10013268 3300026041 Bacteria 5761
412 Ga0207639_10049656 3300026041 Bacteria 3182
413 Ga0207639_10111950 3300026041 Bacteria 2226
414 Ga0207678_10046039 3300026067 Bacteria 3773
415 Ga0207678_10119887 3300026067 Bacteria 2245
416 Ga0207708_10093283 3300026075 Bacteria 2324
417 Ga0207702_10030729 3300026078 Bacteria 4474
418 Ga0207702_10083738 3300026078 Bacteria 2776
419 Ga0207702_10136421 3300026078 Bacteria 2214
420 Ga0207702_10139330 3300026078 Bacteria 2193
421 Ga0207641_10000176 3300026088 Bacteria 88863
422 Ga0207641_10034863 3300026088 Unclassified 4189
423 Ga0207648_10000488 3300026089 Bacteria 44152
424 Ga0207648_10004428 3300026089 Bacteria 14412
425 Ga0207648_10012996 3300026089 Bacteria 7769
426 Ga0207648_10063827 3300026089 Bacteria 3210
427 Ga0207648_10120861 3300026089 Bacteria 2303
428 Ga0207648_10213523 3300026089 Bacteria 1713
429 Ga0207676_10003360 3300026095 Bacteria 11327
430 Ga0207676_10016431 3300026095 Bacteria 5360
431 Ga0207676_10021360 3300026095 Bacteria 4748
432 Ga0207676_10089154 3300026095 Bacteria 2527
433 Ga0207676_10171461 3300026095 Bacteria 1891
434 Ga0207674_10002078 3300026116 Bacteria 25384
435 Ga0207674_10042928 3300026116 Bacteria 4665
436 Ga0207674_10045695 3300026116 Bacteria 4502
437 Ga0207674_10060972 3300026116 Bacteria 3813
438 Ga0207674_10193656 3300026116 Bacteria 1983
439 Ga0207674_10295441 3300026116 Unclassified 1569
440 Ga0207675_100014043 3300026118 Bacteria 7468
441 Ga0207675_100023947 3300026118 Bacteria 5677
442 Ga0207675_100070084 3300026118 Bacteria 3277
443 Ga0207683_10001028 3300026121 Bacteria 25438
444 Ga0207683_10045758 3300026121 Bacteria 3827
445 Ga0207683_10069256 3300026121 Bacteria 3116
446 Ga0207683_10091704 3300026121 Unclassified 2707
447 Ga0207683_10110576 3300026121 Bacteria 2460
448 Ga0207698_10002593 3300026142 Bacteria 10748
449 Ga0207698_10040250 3300026142 Bacteria 3470
450 Ga0207698_10132401 3300026142 Bacteria 2133
451 Ga0207698_10220954 3300026142 Bacteria 1712
452 Ga0207698_10298982 3300026142 Bacteria 1497
453 Ga0207428_10028910 3300027907 Bacteria 4600
454 Ga0268266_10000065 3300028379 Bacteria 246498
455 Ga0268266_10037415 3300028379 Unclassified 4135
456 Ga0268266_10278993 3300028379 Unclassified 1553
457 Ga0268264_10000011 3300028381 Bacteria 580884
458 Ga0268264_10009483 3300028381 Bacteria 8061
459 Ga0268264_10044941 3300028381 Bacteria 3666
460 Ga0268264_10402134 3300028381 Bacteria 1316
461 Ga0307515_10000001 3300028794 Bacteria 4259510
462 Ga0307515_10000107 3300028794 Bacteria 197046
463 Ga0307511_10017926 3300030521 Bacteria 6777
464 Ga0265327_10000641 3300031251 Bacteria 56723
465 Ga0307513_10033628 3300031456 Bacteria 5761
466 Ga0307513_10200038 3300031456 Bacteria 1840
467 Ga0307509_10032693 3300031507 Bacteria 5732
468 Ga0307509_10067071 3300031507 Unclassified 3761
469 Ga0307508_10002368 3300031616 Bacteria 19945
470 Ga0307516_10026528 3300031730 Bacteria 5882
471 Ga0307410_10088468 3300031852 Bacteria 2193
472 Ga0307407_10070578 3300031903 Bacteria 2077
473 Ga0307510_10004442 3300033180 Bacteria 16492
474 Ga0395899_0015301 3300037312 Bacteria 5846
475 Ga0395900_0048528 3300037418 Bacteria 4373
476 Ga0395900_0193349 3300037418 Unclassified 2062
477 Ga0395898_0026480 3300037466 Bacteria 5834
478 Ga0395898_0041693 3300037466 Bacteria 4532
479 Ga0395898_0346550 3300037466 Unclassified 1416
480 Ga0395901_0001058 3300038443 Bacteria 29597
481 Ga0395901_0052727 3300038443 Bacteria 4227
482 Ga0436365_0507128 3300039437 Bacteria 6623
483 Ga0436365_1931949 3300039437 Bacteria 26658
484 Ga0439436_0000669 3300041404 Bacteria 9174
485 Ga0439449_0057228 3300042007 Bacteria 1439
486 Ga0439457_006032 3300042014 Bacteria 2993
487 Ga0451577_0185725 3300042876 Bacteria 1875
488 Ga0466969_0000004 3300044656 Bacteria 168068
489 Ga0466972_0000017 3300044658 Bacteria 199884
490 Ga0466972_0002540 3300044658 Bacteria 9028
491 Ga0466965_0058031 3300044683 Unclassified 1930
492 Ga0466966_0007010 3300044684 Bacteria 7462
493 Ga0466961_0160765 3300044693 Bacteria 1400
494 Ga0466964_0021370 3300044706 Bacteria 2503
495 Ga0453684_0098370 3300044712 Bacteria 3587
496 Ga0453684_0132257 3300044712 Bacteria 2992
497 Ga0453684_0147114 3300044712 Unclassified 2805
498 Ga0453684_0184156 3300044712 Bacteria 2449
499 Ga0453684_0195148 3300044712 Unclassified 2365
500 Ga0453684_0221717 3300044712 Bacteria 2190
501 Ga0466971_0003009 3300044719 Bacteria 7161
502 Ga0466968_0022973 3300044735 Bacteria 2538
503 Ga0466970_0001899 3300044765 Bacteria 10091
504 Ga0466957_0000717 3300044842 Bacteria 17020
505 Ga0466957_0002508 3300044842 Bacteria 9874
506 Ga0466959_0000015 3300045049 Bacteria 149242
507 Ga0466959_0000681 3300045049 Bacteria 19853
508 Ga0466958_0187503 3300045836 Bacteria 1314
509 Ga0495638_0048794 3300046460 Bacteria 2649
510 Ga0495580_0029249 3300046472 Bacteria 4000
511 Ga0495606_0006158 3300046507 Bacteria 11169
512 Ga0495628_0006778 3300046516 Bacteria 9964
513 Ga0495648_0025765 3300046524 Bacteria 3974
514 Ga0495586_0076148 3300046535 Bacteria 1838
515 Ga0495668_0001736 3300046616 Bacteria 20049
516 Ga0495611_0000021 3300046648 Bacteria 123657
517 Ga0495657_0198996 3300046675 Bacteria 1222
518 Ga0495649_0074461 3300046694 Bacteria 1819
519 Ga0495672_0030018 3300047320 Bacteria 3416
520 Ga0495672_0041445 3300047320 Unclassified 2784
521 Ga0495672_0044646 3300047320 Bacteria 2657
522 Ga0495687_000001 3300047443 Bacteria 1215582
523 Ga0495686_0000094 3300047472 Bacteria 187720
524 Ga0495686_0008553 3300047472 Bacteria 7499
525 Ga0496100_0037704 3300048903 Bacteria 3058
526 Ga0496101_0053170 3300048904 Bacteria 2921
527 Ga0496110_0157882 3300048913 Bacteria 2055
528 Ga0496114_0081380 3300048917 Bacteria 2736
529 Ga0501031_0072371 3300049568 Unclassified 2244
530 Ga0501032_0023895 3300049569 Bacteria 4222
531 Ga0501033_0039630 3300049570 Bacteria 3519
532 Ga0501033_0198453 3300049570 Unclassified 1434
533 Ga0501034_0000002 3300049571 Bacteria 565510
534 Ga0501034_0037131 3300049571 Bacteria 4933
535 Ga0501034_0102833 3300049571 Bacteria 2850
536 Ga0501034_0113341 3300049571 Bacteria 2701
537 Ga0501036_0001951 3300049572 Bacteria 16011
538 Ga0501037_0040398 3300049573 Bacteria 3433
539 Ga0501037_0080947 3300049573 Unclassified 2355
540 Ga0501037_0091842 3300049573 Bacteria 2196
541 Ga0501038_0077153 3300049574 Unclassified 2813
542 Ga0501038_0225645 3300049574 Bacteria 1493
543 Ga0501038_0241562 3300049574 Unclassified 1434
544 Ga0501043_0033238 3300049579 Bacteria 4057
545 Ga0501043_0041956 3300049579 Bacteria 3594
546 Ga0501043_0056239 3300049579 Bacteria 3090
547 Ga0501046_0127940 3300049580 Bacteria 1928
548 Ga0501047_0083095 3300049581 Bacteria 3078
549 Ga0501047_0096905 3300049581 Bacteria 2828
550 Ga0501047_0244048 3300049581 Bacteria 1646
551 Ga0501048_0093241 3300049582 Bacteria 2124
552 Ga0501068_0024698 3300049584 Bacteria 3530
553 Ga0501070_0218312 3300049586 Bacteria 1564
554 Ga0501070_0314719 3300049586 Bacteria 1274
555 Ga0501073_0034606 3300049589 Bacteria 3594
556 Ga0501073_0205361 3300049589 Bacteria 1362
557 Ga0501074_0087849 3300049590 Bacteria 2226
558 Ga0501202_037023 3300049652 Bacteria 1040
559 Ga0501225_0002257 3300049705 Bacteria 5959
560 Ga0501083_0032831 3300049744 Bacteria 3557
561 Ga0501035_0018773 3300049822 Bacteria 6369
562 Ga0501035_0035569 3300049822 Bacteria 4519
563 Ga0501035_0110240 3300049822 Bacteria 2412
564 Ga0501044_0001493 3300049823 Bacteria 27394
565 Ga0501044_0009334 3300049823 Bacteria 10702
566 Ga0501044_0014346 3300049823 Bacteria 8555
567 Ga0501044_0034928 3300049823 Bacteria 5267
568 Ga0501044_0112835 3300049823 Bacteria 2725
569 Ga0501044_0154566 3300049823 Bacteria 2274
570 Ga0501044_0259609 3300049823 Bacteria 1676
571 Ga0501284_00114 3300050005 Bacteria 15475
572 nmdc:mga0k408_22163_c1 3300050493 Bacteria 2748
573 nmdc:mga0k408_24585_c1 3300050493 Bacteria 3406
574 nmdc:mga0k408_36955_c1 3300050493 Bacteria 2803
575 nmdc:mga0k408_37218_c1 3300050493 Bacteria 2793
576 nmdc:mga08y16_10649_c1 3300050511 Bacteria 9651
577 nmdc:mga08y16_5792_c1 3300050511 Bacteria 12945
578 Ga0500578_0000362 3300053086 Bacteria 55748
579 Ga0500644_0055076 3300053088 Bacteria 1379
580 Ga0500646_0011758 3300053090 Bacteria 2254
581 Ga0500583_0001120 3300053092 Bacteria 7640
582 Ga0500583_0007440 3300053092 Bacteria 3857
583 Ga0500555_036146 3300053103 Bacteria 1386
584 Ga0500594_0053385 3300053118 Bacteria 1145
585 Ga0500642_0008551 3300053130 Bacteria 3512
586 Ga0500652_005234 3300053131 Bacteria 4070
587 Ga0500652_055667 3300053131 Unclassified 1621
588 Ga0500559_0014592 3300053136 Bacteria 3321
589 Ga0500568_0001989 3300053139 Bacteria 12457
590 Ga0500568_0014731 3300053139 Bacteria 3521
591 Ga0500588_0002898 3300053146 Bacteria 3560
592 Ga0500589_028692 3300053147 Bacteria 2587
593 Ga0500616_0006214 3300053153 Bacteria 7881
594 Ga0500616_0017083 3300053153 Bacteria 4120
595 Ga0500622_0001555 3300053156 Bacteria 18137
596 Ga0500622_0003213 3300053156 Bacteria 11112
597 Ga0500611_000005 3300053727 Bacteria 228837
598 Ga0500645_007244 3300053730 Bacteria 3881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053118 Ga0500594_0053385 Ga0500594_0053385_155_1090 298
2 3300049652 Ga0501202_037023 Ga0501202_037023_56_1003 302
3 3300013297 Ga0157378_10589957 Ga0157378_105899571 310
4 3300025904 Ga0207647_10057639 Ga0207647_100576392 314
5 3300039437 Ga0436365_1931949 Ga0436365_1931949_10856_11959 320
6 3300053088 Ga0500644_0055076 Ga0500644_0055076_47_1063 325
7 3300025913 Ga0207695_10055112 Ga0207695_100551124 336
8 3300025924 Ga0207694_10051025 Ga0207694_100510253 336
9 3300009094 Ga0111539_10002150 Ga0111539_1000215017 340
10 3300050511 nmdc:mga08y16_5792_c1 nmdc:mga08y16_5792_c1_1727_2833 340
11 3300013297 Ga0157378_10063036 Ga0157378_100630363 342
12 3300042876 Ga0451577_0185725 Ga0451577_0185725_26_1096 343
13 3300005328 Ga0070676_10026169 Ga0070676_100261692 345
14 3300005335 Ga0070666_10045323 Ga0070666_100453232 345
15 3300005353 Ga0070669_100038495 Ga0070669_1000384952 345
16 3300005354 Ga0070675_100164966 Ga0070675_1001649662 345
17 3300005367 Ga0070667_100006582 Ga0070667_1000065828 345
18 3300005459 Ga0068867_100132720 Ga0068867_1001327202 345
19 3300005543 Ga0070672_100010174 Ga0070672_1000101741 345
20 3300005578 Ga0068854_100047694 Ga0068854_1000476942 345
21 3300005617 Ga0068859_100053201 Ga0068859_1000532013 345
22 3300005834 Ga0068851_10133228 Ga0068851_101332282 345
23 3300005840 Ga0068870_10002941 Ga0068870_100029419 345
24 3300005843 Ga0068860_100048568 Ga0068860_1000485682 345
25 3300006931 Ga0097620_100053200 Ga0097620_1000532003 345
26 3300009176 Ga0105242_10043253 Ga0105242_100432532 345
27 3300009553 Ga0105249_10099625 Ga0105249_100996252 345
28 3300011119 Ga0105246_10163105 Ga0105246_101631051 345
29 3300013296 Ga0157374_10021812 Ga0157374_100218124 345
30 3300013297 Ga0157378_10210567 Ga0157378_102105672 345
31 3300025907 Ga0207645_10000245 Ga0207645_1000024541 345
32 3300025908 Ga0207643_10012710 Ga0207643_100127103 345
33 3300025925 Ga0207650_10194944 Ga0207650_101949441 345
34 3300025940 Ga0207691_10008548 Ga0207691_100085483 345
35 3300025942 Ga0207689_10015881 Ga0207689_100158816 345
36 3300026041 Ga0207639_10049656 Ga0207639_100496563 345
37 3300026089 Ga0207648_10004428 Ga0207648_100044288 345
38 3300026118 Ga0207675_100070084 Ga0207675_1000700842 345
39 3300026121 Ga0207683_10001028 Ga0207683_1000102821 345
40 3300005290 Ga0065712_10077506 Ga0065712_100775061 347
41 3300005334 Ga0068869_100162633 Ga0068869_1001626331 347
42 3300005343 Ga0070687_100028213 Ga0070687_1000282132 347
43 3300005353 Ga0070669_100013551 Ga0070669_1000135514 347
44 3300005617 Ga0068859_100116755 Ga0068859_1001167552 347
45 3300005844 Ga0068862_100067148 Ga0068862_1000671482 347
46 3300006931 Ga0097620_100116750 Ga0097620_1001167502 347
47 3300011119 Ga0105246_10199240 Ga0105246_101992402 347
48 3300013105 Ga0157369_10148357 Ga0157369_101483571 347
49 3300014745 Ga0157377_10051117 Ga0157377_100511173 347
50 3300025923 Ga0207681_10339500 Ga0207681_103395001 347
51 3300025926 Ga0207659_10362311 Ga0207659_103623111 347
52 3300025940 Ga0207691_10036342 Ga0207691_100363423 347
53 3300026095 Ga0207676_10089154 Ga0207676_100891542 347
54 iso_pu_bacteria 2738541278 2738724456 348
55 3300005334 Ga0068869_100055414 Ga0068869_1000554142 350
56 3300005347 Ga0070668_100047921 Ga0070668_1000479212 350
57 3300005719 Ga0068861_100062950 Ga0068861_1000629502 350
58 3300005843 Ga0068860_100274903 Ga0068860_1002749033 350
59 3300005844 Ga0068862_100060004 Ga0068862_1000600043 350
60 3300006237 Ga0097621_100090147 Ga0097621_1000901472 350
61 3300006881 Ga0068865_100046443 Ga0068865_1000464432 350
62 3300009176 Ga0105242_10048024 Ga0105242_100480243 350
63 3300009545 Ga0105237_10003301 Ga0105237_100033012 350
64 3300010375 Ga0105239_10016150 Ga0105239_100161503 350
65 3300013296 Ga0157374_10184584 Ga0157374_101845842 350
66 3300025942 Ga0207689_10030048 Ga0207689_100300483 350
67 3300025972 Ga0207668_10029997 Ga0207668_100299972 350
68 3300026118 Ga0207675_100014043 Ga0207675_1000140438 350
69 3300031456 Ga0307513_10200038 Ga0307513_102000382 350
70 3300046460 Ga0495638_0048794 Ga0495638_0048794_586_1683 350
71 3300053730 Ga0500645_007244 Ga0500645_007244_1651_2757 350
72 3300003316 rootH1_10022049 rootH1_100220492 351
73 3300003316 rootH1_10025341 rootH1_1002534117 351
74 3300003320 rootH2_10026040 rootH2_100260403 351
75 3300003320 rootH2_10162304 rootH2_101623043 351
76 3300003322 rootL2_10052717 rootL2_100527171 351
77 3300003322 rootL2_10092713 rootL2_100927131 351
78 3300003323 rootH1_10000715 rootH1_1000071554 351
79 3300003323 rootH1_10067989 rootH1_100679892 351
80 3300003323 rootH1_10074886 rootH1_100748863 351
81 3300003323 rootH1_10178763 rootH1_101787632 351
82 3300003354 JGI25160J50197_1001526 JGI25160J50197_10015266 351
83 3300005328 Ga0070676_10023434 Ga0070676_100234343 351
84 3300005331 Ga0070670_100052071 Ga0070670_1000520714 351
85 3300005335 Ga0070666_10090697 Ga0070666_100906972 351
86 3300005337 Ga0070682_100000037 Ga0070682_100000037114 351
87 3300005338 Ga0068868_100304564 Ga0068868_1003045641 351
88 3300005459 Ga0068867_100015142 Ga0068867_1000151425 351
89 3300005459 Ga0068867_100093421 Ga0068867_1000934212 351
90 3300005471 Ga0070698_100061752 Ga0070698_1000617521 351
91 3300005539 Ga0068853_100028345 Ga0068853_1000283452 351
92 3300005543 Ga0070672_100205808 Ga0070672_1002058082 351
93 3300005548 Ga0070665_100000001 Ga0070665_10000000135 351
94 3300005577 Ga0068857_100042194 Ga0068857_1000421941 351
95 3300005614 Ga0068856_100027949 Ga0068856_1000279493 351
96 3300005614 Ga0068856_100106625 Ga0068856_1001066252 351
97 3300005618 Ga0068864_100056751 Ga0068864_1000567513 351
98 3300005844 Ga0068862_100180932 Ga0068862_1001809321 351
99 3300006195 Ga0075366_10047078 Ga0075366_100470783 351
100 3300006195 Ga0075366_10069140 Ga0075366_100691402 351
101 3300009093 Ga0105240_10000061 Ga0105240_1000006122 351
102 3300009093 Ga0105240_10000087 Ga0105240_1000008713 351
103 3300009093 Ga0105240_10001401 Ga0105240_1000140127 351
104 3300009093 Ga0105240_10027638 Ga0105240_100276384 351
105 3300009174 Ga0105241_10000491 Ga0105241_1000049115 351
106 3300009176 Ga0105242_10018926 Ga0105242_100189264 351
107 3300009176 Ga0105242_10041071 Ga0105242_100410711 351
108 3300009545 Ga0105237_10000377 Ga0105237_1000037720 351
109 3300009545 Ga0105237_10002561 Ga0105237_100025618 351
110 3300009551 Ga0105238_10000725 Ga0105238_100007253 351
111 3300009551 Ga0105238_10066267 Ga0105238_100662672 351
112 3300009553 Ga0105249_10003777 Ga0105249_100037776 351
113 3300010375 Ga0105239_10004600 Ga0105239_100046002 351
114 3300010375 Ga0105239_10168320 Ga0105239_101683202 351
115 3300013100 Ga0157373_10000150 Ga0157373_1000015016 351
116 3300013297 Ga0157378_10084839 Ga0157378_100848393 351
117 3300013307 Ga0157372_10006562 Ga0157372_100065624 351
118 3300013307 Ga0157372_10007169 Ga0157372_100071696 351
119 3300013307 Ga0157372_10008725 Ga0157372_100087255 351
120 3300013307 Ga0157372_10011120 Ga0157372_1001112010 351
121 3300013308 Ga0157375_10010676 Ga0157375_100106766 351
122 3300013308 Ga0157375_10243755 Ga0157375_102437551 351
123 3300014326 Ga0157380_10152098 Ga0157380_101520981 351
124 3300025250 Ga0209026_1000282 Ga0209026_100028219 351
125 3300025302 Ga0207426_1000105 Ga0207426_1000105155 351
126 3300025911 Ga0207654_10007372 Ga0207654_100073724 351
127 3300025913 Ga0207695_10000057 Ga0207695_10000057126 351
128 3300025913 Ga0207695_10001216 Ga0207695_100012166 351
129 3300025913 Ga0207695_10003352 Ga0207695_100033522 351
130 3300025914 Ga0207671_10002095 Ga0207671_100020952 351
131 3300025914 Ga0207671_10009050 Ga0207671_100090508 351
132 3300025924 Ga0207694_10009443 Ga0207694_100094432 351
133 3300025925 Ga0207650_10037658 Ga0207650_100376582 351
134 3300025934 Ga0207686_10027101 Ga0207686_100271012 351
135 3300025940 Ga0207691_10214059 Ga0207691_102140592 351
136 3300025942 Ga0207689_10027865 Ga0207689_100278653 351
137 3300025961 Ga0207712_10005427 Ga0207712_100054275 351
138 3300025972 Ga0207668_10062025 Ga0207668_100620252 351
139 3300026041 Ga0207639_10111950 Ga0207639_101119502 351
140 3300026078 Ga0207702_10139330 Ga0207702_101393302 351
141 3300026089 Ga0207648_10000488 Ga0207648_1000048830 351
142 3300026089 Ga0207648_10213523 Ga0207648_102135232 351
143 3300026095 Ga0207676_10021360 Ga0207676_100213603 351
144 3300026116 Ga0207674_10042928 Ga0207674_100429284 351
145 3300026142 Ga0207698_10298982 Ga0207698_102989822 351
146 3300028379 Ga0268266_10000065 Ga0268266_1000006553 351
147 3300028381 Ga0268264_10402134 Ga0268264_104021341 351
148 3300030521 Ga0307511_10017926 Ga0307511_100179264 351
149 3300031251 Ga0265327_10000641 Ga0265327_1000064124 351
150 3300031507 Ga0307509_10032693 Ga0307509_100326933 351
151 3300031616 Ga0307508_10002368 Ga0307508_1000236811 351
152 3300033180 Ga0307510_10004442 Ga0307510_100044426 351
153 3300042007 Ga0439449_0057228 Ga0439449_0057228_95_1195 351
154 3300044658 Ga0466972_0002540 Ga0466972_0002540_2052_3161 351
155 3300044683 Ga0466965_0058031 Ga0466965_0058031_234_1331 351
156 3300044712 Ga0453684_0147114 Ga0453684_0147114_809_1903 351
157 3300044712 Ga0453684_0184156 Ga0453684_0184156_806_1900 351
158 3300044735 Ga0466968_0022973 Ga0466968_0022973_823_1932 351
159 3300044842 Ga0466957_0002508 Ga0466957_0002508_6706_7803 351
160 3300046507 Ga0495606_0006158 Ga0495606_0006158_7470_8591 351
161 3300046648 Ga0495611_0000021 Ga0495611_0000021_69589_70689 351
162 3300047472 Ga0495686_0008553 Ga0495686_0008553_2264_3358 351
163 3300049568 Ga0501031_0072371 Ga0501031_0072371_45_1139 351
164 3300049571 Ga0501034_0102833 Ga0501034_0102833_1264_2358 351
165 3300049572 Ga0501036_0001951 Ga0501036_0001951_7633_8727 351
166 3300049573 Ga0501037_0080947 Ga0501037_0080947_891_1985 351
167 3300049574 Ga0501038_0077153 Ga0501038_0077153_1062_2156 351
168 3300049579 Ga0501043_0033238 Ga0501043_0033238_1143_2237 351
169 3300049579 Ga0501043_0056239 Ga0501043_0056239_126_1223 351
170 3300049580 Ga0501046_0127940 Ga0501046_0127940_17_1111 351
171 3300049581 Ga0501047_0096905 Ga0501047_0096905_1452_2546 351
172 3300049822 Ga0501035_0018773 Ga0501035_0018773_5259_6353 351
173 3300049823 Ga0501044_0001493 Ga0501044_0001493_4737_5834 351
174 3300049823 Ga0501044_0034928 Ga0501044_0034928_1990_3084 351
175 3300050493 nmdc:mga0k408_22163_c1 nmdc:mga0k408_22163_c1_92_1192 351
176 3300050493 nmdc:mga0k408_36955_c1 nmdc:mga0k408_36955_c1_90_1184 351
177 3300050493 nmdc:mga0k408_37218_c1 nmdc:mga0k408_37218_c1_582_1676 351
178 3300053131 Ga0500652_055667 Ga0500652_055667_378_1472 351
179 3300053153 Ga0500616_0017083 Ga0500616_0017083_1583_2677 351
180 3300053156 Ga0500622_0003213 Ga0500622_0003213_4945_6039 351
181 3300053727 Ga0500611_000005 Ga0500611_000005_130298_131392 351
182 3300003203 JGI25406J46586_10001198 JGI25406J46586_1000119811 352
183 3300003320 rootH2_10028893 rootH2_100288932 352
184 3300003320 rootH2_10058174 rootH2_100581742 352
185 3300003320 rootH2_10220972 rootH2_102209721 352
186 3300005295 Ga0065707_10151531 Ga0065707_101515312 352
187 3300005327 Ga0070658_10031606 Ga0070658_100316063 352
188 3300005328 Ga0070676_10034209 Ga0070676_100342093 352
189 3300005328 Ga0070676_10059285 Ga0070676_100592852 352
190 3300005329 Ga0070683_100010729 Ga0070683_1000107293 352
191 3300005329 Ga0070683_100082309 Ga0070683_1000823092 352
192 3300005329 Ga0070683_100089636 Ga0070683_1000896362 352
193 3300005331 Ga0070670_100003751 Ga0070670_1000037514 352
194 3300005334 Ga0068869_100033791 Ga0068869_1000337914 352
195 3300005334 Ga0068869_100063018 Ga0068869_1000630182 352
196 3300005335 Ga0070666_10000179 Ga0070666_1000017931 352
197 3300005335 Ga0070666_10001826 Ga0070666_100018263 352
198 3300005335 Ga0070666_10026741 Ga0070666_100267413 352
199 3300005335 Ga0070666_10044833 Ga0070666_100448332 352
200 3300005337 Ga0070682_100058299 Ga0070682_1000582992 352
201 3300005338 Ga0068868_100026013 Ga0068868_1000260136 352
202 3300005338 Ga0068868_100126770 Ga0068868_1001267701 352
203 3300005339 Ga0070660_100038476 Ga0070660_1000384763 352
204 3300005340 Ga0070689_100352431 Ga0070689_1003524311 352
205 3300005344 Ga0070661_100000716 Ga0070661_1000007166 352
206 3300005344 Ga0070661_100008231 Ga0070661_1000082315 352
207 3300005347 Ga0070668_100003384 Ga0070668_10000338414 352
208 3300005353 Ga0070669_100001167 Ga0070669_1000011678 352
209 3300005353 Ga0070669_100041358 Ga0070669_1000413581 352
210 3300005353 Ga0070669_100220748 Ga0070669_1002207482 352
211 3300005354 Ga0070675_100025329 Ga0070675_1000253294 352
212 3300005355 Ga0070671_100003971 Ga0070671_1000039718 352
213 3300005355 Ga0070671_100043469 Ga0070671_1000434692 352
214 3300005356 Ga0070674_100010748 Ga0070674_1000107485 352
215 3300005356 Ga0070674_100073158 Ga0070674_1000731583 352
216 3300005364 Ga0070673_100120469 Ga0070673_1001204692 352
217 3300005365 Ga0070688_100156348 Ga0070688_1001563482 352
218 3300005366 Ga0070659_100025806 Ga0070659_1000258061 352
219 3300005367 Ga0070667_100026589 Ga0070667_1000265892 352
220 3300005455 Ga0070663_100007168 Ga0070663_1000071689 352
221 3300005456 Ga0070678_100046800 Ga0070678_1000468002 352
222 3300005456 Ga0070678_100154696 Ga0070678_1001546962 352
223 3300005457 Ga0070662_100175361 Ga0070662_1001753611 352
224 3300005458 Ga0070681_10004917 Ga0070681_1000491714 352
225 3300005458 Ga0070681_10044366 Ga0070681_100443662 352
226 3300005458 Ga0070681_10085297 Ga0070681_100852971 352
227 3300005459 Ga0068867_100058022 Ga0068867_1000580223 352
228 3300005459 Ga0068867_100129819 Ga0068867_1001298192 352
229 3300005466 Ga0070685_10046594 Ga0070685_100465942 352
230 3300005466 Ga0070685_10191266 Ga0070685_101912662 352
231 3300005471 Ga0070698_100005543 Ga0070698_1000055437 352
232 3300005530 Ga0070679_100121271 Ga0070679_1001212712 352
233 3300005535 Ga0070684_100000134 Ga0070684_10000013421 352
234 3300005535 Ga0070684_100000916 Ga0070684_10000091615 352
235 3300005535 Ga0070684_100038360 Ga0070684_1000383602 352
236 3300005539 Ga0068853_100001259 Ga0068853_10000125913 352
237 3300005539 Ga0068853_100009491 Ga0068853_10000949110 352
238 3300005539 Ga0068853_100024422 Ga0068853_1000244225 352
239 3300005539 Ga0068853_100352210 Ga0068853_1003522102 352
240 3300005543 Ga0070672_100031315 Ga0070672_1000313153 352
241 3300005543 Ga0070672_100105387 Ga0070672_1001053872 352
242 3300005543 Ga0070672_100172539 Ga0070672_1001725392 352
243 3300005543 Ga0070672_100215229 Ga0070672_1002152291 352
244 3300005544 Ga0070686_100081058 Ga0070686_1000810582 352
245 3300005547 Ga0070693_100015081 Ga0070693_1000150813 352
246 3300005548 Ga0070665_100106262 Ga0070665_1001062623 352
247 3300005549 Ga0070704_100107858 Ga0070704_1001078582 352
248 3300005563 Ga0068855_100000210 Ga0068855_10000021022 352
249 3300005563 Ga0068855_100001078 Ga0068855_10000107822 352
250 3300005563 Ga0068855_100038957 Ga0068855_1000389573 352
251 3300005563 Ga0068855_100056621 Ga0068855_1000566212 352
252 3300005564 Ga0070664_100001395 Ga0070664_1000013952 352
253 3300005564 Ga0070664_100020800 Ga0070664_1000208002 352
254 3300005564 Ga0070664_100159499 Ga0070664_1001594992 352
255 3300005577 Ga0068857_100001709 Ga0068857_10000170915 352
256 3300005578 Ga0068854_100035707 Ga0068854_1000357074 352
257 3300005614 Ga0068856_100026621 Ga0068856_1000266215 352
258 3300005614 Ga0068856_100172391 Ga0068856_1001723912 352
259 3300005615 Ga0070702_100030791 Ga0070702_1000307912 352
260 3300005616 Ga0068852_100001649 Ga0068852_1000016495 352
261 3300005616 Ga0068852_100035306 Ga0068852_1000353062 352
262 3300005617 Ga0068859_100000163 Ga0068859_1000001636 352
263 3300005617 Ga0068859_100001345 Ga0068859_10000134514 352
264 3300005617 Ga0068859_100012614 Ga0068859_1000126144 352
265 3300005617 Ga0068859_100013898 Ga0068859_1000138985 352
266 3300005617 Ga0068859_100407610 Ga0068859_1004076101 352
267 3300005617 Ga0068859_100451672 Ga0068859_1004516721 352
268 3300005618 Ga0068864_100000555 Ga0068864_1000005559 352
269 3300005618 Ga0068864_100035639 Ga0068864_1000356393 352
270 3300005618 Ga0068864_100169300 Ga0068864_1001693002 352
271 3300005719 Ga0068861_100002071 Ga0068861_1000020715 352
272 3300005834 Ga0068851_10020833 Ga0068851_100208332 352
273 3300005840 Ga0068870_10009548 Ga0068870_100095485 352
274 3300005841 Ga0068863_100001590 Ga0068863_10000159017 352
275 3300005841 Ga0068863_100034551 Ga0068863_1000345513 352
276 3300005842 Ga0068858_100005829 Ga0068858_1000058294 352
277 3300005842 Ga0068858_100008767 Ga0068858_1000087678 352
278 3300005842 Ga0068858_100118833 Ga0068858_1001188333 352
279 3300005842 Ga0068858_100177725 Ga0068858_1001777252 352
280 3300005843 Ga0068860_100000004 Ga0068860_100000004175 352
281 3300005843 Ga0068860_100000431 Ga0068860_1000004314 352
282 3300005843 Ga0068860_100019370 Ga0068860_1000193702 352
283 3300005843 Ga0068860_100026397 Ga0068860_1000263975 352
284 3300005844 Ga0068862_100003045 Ga0068862_1000030455 352
285 3300005985 Ga0081539_10001080 Ga0081539_1000108038 352
286 3300006173 Ga0070716_100178156 Ga0070716_1001781561 352
287 3300006195 Ga0075366_10066684 Ga0075366_100666842 352
288 3300006237 Ga0097621_100001101 Ga0097621_1000011014 352
289 3300006237 Ga0097621_100007450 Ga0097621_1000074503 352
290 3300006358 Ga0068871_100000076 Ga0068871_10000007633 352
291 3300006358 Ga0068871_100013914 Ga0068871_1000139145 352
292 3300006358 Ga0068871_100014135 Ga0068871_1000141353 352
293 3300006358 Ga0068871_100028750 Ga0068871_1000287503 352
294 3300006358 Ga0068871_100150962 Ga0068871_1001509622 352
295 3300006881 Ga0068865_100052426 Ga0068865_1000524263 352
296 3300006881 Ga0068865_100067626 Ga0068865_1000676262 352
297 3300006881 Ga0068865_100219709 Ga0068865_1002197092 352
298 3300006931 Ga0097620_100000163 Ga0097620_1000001636 352
299 3300006931 Ga0097620_100001345 Ga0097620_10000134514 352
300 3300006931 Ga0097620_100012613 Ga0097620_1000126136 352
301 3300006931 Ga0097620_100013898 Ga0097620_1000138985 352
302 3300006931 Ga0097620_100407612 Ga0097620_1004076122 352
303 3300006931 Ga0097620_100451663 Ga0097620_1004516632 352
304 3300009093 Ga0105240_10050030 Ga0105240_100500302 352
305 3300009093 Ga0105240_10217601 Ga0105240_102176012 352
306 3300009094 Ga0111539_10013736 Ga0111539_100137363 352
307 3300009094 Ga0111539_10024406 Ga0111539_100244065 352
308 3300009098 Ga0105245_10148546 Ga0105245_101485462 352
309 3300009101 Ga0105247_10002644 Ga0105247_100026447 352
310 3300009101 Ga0105247_10003918 Ga0105247_100039184 352
311 3300009174 Ga0105241_10008476 Ga0105241_100084766 352
312 3300009174 Ga0105241_10036393 Ga0105241_100363933 352
313 3300009176 Ga0105242_10041092 Ga0105242_100410924 352
314 3300009176 Ga0105242_10101819 Ga0105242_101018193 352
315 3300009177 Ga0105248_10005454 Ga0105248_1000545411 352
316 3300009177 Ga0105248_10181012 Ga0105248_101810122 352
317 3300009177 Ga0105248_10181647 Ga0105248_101816472 352
318 3300009545 Ga0105237_10001797 Ga0105237_1000179716 352
319 3300009545 Ga0105237_10005147 Ga0105237_100051479 352
320 3300009545 Ga0105237_10007186 Ga0105237_1000718610 352
321 3300009545 Ga0105237_10085267 Ga0105237_100852672 352
322 3300009553 Ga0105249_10002038 Ga0105249_1000203813 352
323 3300009553 Ga0105249_10002607 Ga0105249_100026074 352
324 3300009553 Ga0105249_10004927 Ga0105249_100049272 352
325 3300009553 Ga0105249_10012170 Ga0105249_100121707 352
326 3300010375 Ga0105239_10000029 Ga0105239_1000002949 352
327 3300010375 Ga0105239_10002405 Ga0105239_1000240514 352
328 3300010375 Ga0105239_10004460 Ga0105239_1000446010 352
329 3300010375 Ga0105239_10094681 Ga0105239_100946812 352
330 3300010375 Ga0105239_10325294 Ga0105239_103252942 352
331 3300010375 Ga0105239_10673846 Ga0105239_106738461 352
332 3300011119 Ga0105246_10063665 Ga0105246_100636653 352
333 3300013100 Ga0157373_10047171 Ga0157373_100471712 352
334 3300013100 Ga0157373_10125053 Ga0157373_101250532 352
335 3300013100 Ga0157373_10236219 Ga0157373_102362191 352
336 3300013102 Ga0157371_10001842 Ga0157371_1000184213 352
337 3300013102 Ga0157371_10008939 Ga0157371_1000893911 352
338 3300013102 Ga0157371_10026370 Ga0157371_100263702 352
339 3300013102 Ga0157371_10094111 Ga0157371_100941112 352
340 3300013102 Ga0157371_10156361 Ga0157371_101563611 352
341 3300013104 Ga0157370_10001188 Ga0157370_1000118818 352
342 3300013104 Ga0157370_10052979 Ga0157370_100529792 352
343 3300013104 Ga0157370_10068891 Ga0157370_100688913 352
344 3300013105 Ga0157369_10017131 Ga0157369_100171313 352
345 3300013105 Ga0157369_10028467 Ga0157369_100284674 352
346 3300013105 Ga0157369_10136306 Ga0157369_101363063 352
347 3300013105 Ga0157369_10498156 Ga0157369_104981561 352
348 3300013296 Ga0157374_10000001 Ga0157374_10000001654 352
349 3300013296 Ga0157374_10001176 Ga0157374_1000117613 352
350 3300013296 Ga0157374_10002087 Ga0157374_100020875 352
351 3300013296 Ga0157374_10014056 Ga0157374_100140563 352
352 3300013296 Ga0157374_10026774 Ga0157374_100267744 352
353 3300013296 Ga0157374_10130203 Ga0157374_101302032 352
354 3300013297 Ga0157378_10005700 Ga0157378_100057005 352
355 3300013297 Ga0157378_10036442 Ga0157378_100364424 352
356 3300013297 Ga0157378_10047163 Ga0157378_100471631 352
357 3300013297 Ga0157378_10108111 Ga0157378_101081112 352
358 3300013297 Ga0157378_10177229 Ga0157378_101772292 352
359 3300013297 Ga0157378_10181167 Ga0157378_101811672 352
360 3300013306 Ga0163162_10000170 Ga0163162_100001704 352
361 3300013306 Ga0163162_10000461 Ga0163162_1000046124 352
362 3300013306 Ga0163162_10000944 Ga0163162_1000094421 352
363 3300013306 Ga0163162_10007991 Ga0163162_100079915 352
364 3300013306 Ga0163162_10056441 Ga0163162_100564413 352
365 3300013306 Ga0163162_10100627 Ga0163162_101006272 352
366 3300013306 Ga0163162_10134445 Ga0163162_101344451 352
367 3300013306 Ga0163162_10151731 Ga0163162_101517312 352
368 3300013307 Ga0157372_10008654 Ga0157372_100086544 352
369 3300013307 Ga0157372_10031941 Ga0157372_100319413 352
370 3300013307 Ga0157372_10083093 Ga0157372_100830933 352
371 3300013307 Ga0157372_10085131 Ga0157372_100851314 352
372 3300013307 Ga0157372_10295923 Ga0157372_102959232 352
373 3300013307 Ga0157372_10391260 Ga0157372_103912601 352
374 3300013307 Ga0157372_10420713 Ga0157372_104207131 352
375 3300013308 Ga0157375_10000125 Ga0157375_100001252 352
376 3300013308 Ga0157375_10010714 Ga0157375_100107147 352
377 3300013308 Ga0157375_10032564 Ga0157375_100325644 352
378 3300013308 Ga0157375_10127599 Ga0157375_101275993 352
379 3300013308 Ga0157375_10182090 Ga0157375_101820902 352
380 3300014325 Ga0163163_10000281 Ga0163163_1000028134 352
381 3300014325 Ga0163163_10000448 Ga0163163_1000044823 352
382 3300014325 Ga0163163_10055250 Ga0163163_100552503 352
383 3300014325 Ga0163163_10057689 Ga0163163_100576892 352
384 3300014325 Ga0163163_10108026 Ga0163163_101080263 352
385 3300014325 Ga0163163_10133527 Ga0163163_101335274 352
386 3300014326 Ga0157380_10000955 Ga0157380_100009555 352
387 3300014326 Ga0157380_10073193 Ga0157380_100731933 352
388 3300014745 Ga0157377_10000426 Ga0157377_100004264 352
389 3300014745 Ga0157377_10177431 Ga0157377_101774311 352
390 3300014968 Ga0157379_10016017 Ga0157379_100160173 352
391 3300014968 Ga0157379_10064333 Ga0157379_100643333 352
392 3300014968 Ga0157379_10071174 Ga0157379_100711742 352
393 3300014968 Ga0157379_10103092 Ga0157379_101030921 352
394 3300014968 Ga0157379_10263220 Ga0157379_102632202 352
395 3300014969 Ga0157376_10001405 Ga0157376_100014056 352
396 3300014969 Ga0157376_10013013 Ga0157376_100130133 352
397 3300014969 Ga0157376_10141415 Ga0157376_101414152 352
398 3300014969 Ga0157376_10238037 Ga0157376_102380372 352
399 3300017792 Ga0163161_10001802 Ga0163161_100018023 352
400 3300017792 Ga0163161_10029799 Ga0163161_100297994 352
401 3300017792 Ga0163161_10035217 Ga0163161_100352172 352
402 3300021384 Ga0213876_10006422 Ga0213876_100064224 352
403 3300025321 Ga0207656_10027470 Ga0207656_100274701 352
404 3300025899 Ga0207642_10003294 Ga0207642_100032943 352
405 3300025903 Ga0207680_10000068 Ga0207680_1000006826 352
406 3300025903 Ga0207680_10088042 Ga0207680_100880422 352
407 3300025904 Ga0207647_10015024 Ga0207647_100150245 352
408 3300025907 Ga0207645_10092111 Ga0207645_100921112 352
409 3300025909 Ga0207705_10024472 Ga0207705_100244725 352
410 3300025911 Ga0207654_10000699 Ga0207654_100006996 352
411 3300025912 Ga0207707_10078189 Ga0207707_100781892 352
412 3300025912 Ga0207707_10118721 Ga0207707_101187211 352
413 3300025913 Ga0207695_10000568 Ga0207695_1000056823 352
414 3300025913 Ga0207695_10086339 Ga0207695_100863392 352
415 3300025913 Ga0207695_10098493 Ga0207695_100984932 352
416 3300025914 Ga0207671_10001122 Ga0207671_1000112217 352
417 3300025914 Ga0207671_10005145 Ga0207671_100051458 352
418 3300025914 Ga0207671_10030397 Ga0207671_100303972 352
419 3300025914 Ga0207671_10052086 Ga0207671_100520862 352
420 3300025919 Ga0207657_10025037 Ga0207657_100250373 352
421 3300025919 Ga0207657_10165802 Ga0207657_101658022 352
422 3300025919 Ga0207657_10249814 Ga0207657_102498142 352
423 3300025920 Ga0207649_10000604 Ga0207649_1000060422 352
424 3300025920 Ga0207649_10010286 Ga0207649_100102865 352
425 3300025921 Ga0207652_10000029 Ga0207652_1000002949 352
426 3300025923 Ga0207681_10064976 Ga0207681_100649761 352
427 3300025931 Ga0207644_10057213 Ga0207644_100572131 352
428 3300025933 Ga0207706_10000633 Ga0207706_100006333 352
429 3300025933 Ga0207706_10002220 Ga0207706_100022208 352
430 3300025933 Ga0207706_10003075 Ga0207706_1000307517 352
431 3300025933 Ga0207706_10031919 Ga0207706_100319194 352
432 3300025933 Ga0207706_10118133 Ga0207706_101181331 352
433 3300025934 Ga0207686_10035161 Ga0207686_100351613 352
434 3300025934 Ga0207686_10173580 Ga0207686_101735802 352
435 3300025936 Ga0207670_10024136 Ga0207670_100241362 352
436 3300025936 Ga0207670_10168485 Ga0207670_101684852 352
437 3300025937 Ga0207669_10093905 Ga0207669_100939052 352
438 3300025938 Ga0207704_10011586 Ga0207704_100115863 352
439 3300025938 Ga0207704_10025149 Ga0207704_100251492 352
440 3300025938 Ga0207704_10261122 Ga0207704_102611221 352
441 3300025939 Ga0207665_10130279 Ga0207665_101302792 352
442 3300025940 Ga0207691_10014754 Ga0207691_100147546 352
443 3300025940 Ga0207691_10021745 Ga0207691_100217453 352
444 3300025940 Ga0207691_10043790 Ga0207691_100437903 352
445 3300025940 Ga0207691_10227033 Ga0207691_102270331 352
446 3300025942 Ga0207689_10002325 Ga0207689_100023255 352
447 3300025942 Ga0207689_10009287 Ga0207689_100092873 352
448 3300025944 Ga0207661_10000092 Ga0207661_1000009223 352
449 3300025944 Ga0207661_10037662 Ga0207661_100376622 352
450 3300025944 Ga0207661_10055068 Ga0207661_100550682 352
451 3300025944 Ga0207661_10096544 Ga0207661_100965441 352
452 3300025945 Ga0207679_10000146 Ga0207679_1000014623 352
453 3300025945 Ga0207679_10031666 Ga0207679_100316663 352
454 3300025945 Ga0207679_10035820 Ga0207679_100358203 352
455 3300025945 Ga0207679_10124309 Ga0207679_101243092 352
456 3300025945 Ga0207679_10275420 Ga0207679_102754202 352
457 3300025949 Ga0207667_10000246 Ga0207667_1000024648 352
458 3300025949 Ga0207667_10008205 Ga0207667_100082052 352
459 3300025949 Ga0207667_10008415 Ga0207667_100084157 352
460 3300025949 Ga0207667_10009109 Ga0207667_1000910913 352
461 3300025960 Ga0207651_10234702 Ga0207651_102347022 352
462 3300025961 Ga0207712_10004698 Ga0207712_100046986 352
463 3300025961 Ga0207712_10011405 Ga0207712_100114052 352
464 3300025972 Ga0207668_10020856 Ga0207668_100208562 352
465 3300025981 Ga0207640_10033858 Ga0207640_100338582 352
466 3300025986 Ga0207658_10023118 Ga0207658_100231183 352
467 3300026035 Ga0207703_10031912 Ga0207703_100319122 352
468 3300026035 Ga0207703_10064714 Ga0207703_100647142 352
469 3300026041 Ga0207639_10000667 Ga0207639_1000066722 352
470 3300026041 Ga0207639_10013268 Ga0207639_100132685 352
471 3300026067 Ga0207678_10046039 Ga0207678_100460391 352
472 3300026067 Ga0207678_10119887 Ga0207678_101198872 352
473 3300026075 Ga0207708_10093283 Ga0207708_100932832 352
474 3300026078 Ga0207702_10030729 Ga0207702_100307294 352
475 3300026078 Ga0207702_10083738 Ga0207702_100837381 352
476 3300026078 Ga0207702_10136421 Ga0207702_101364211 352
477 3300026088 Ga0207641_10000176 Ga0207641_1000017630 352
478 3300026088 Ga0207641_10034863 Ga0207641_100348633 352
479 3300026089 Ga0207648_10012996 Ga0207648_100129968 352
480 3300026089 Ga0207648_10063827 Ga0207648_100638272 352
481 3300026089 Ga0207648_10120861 Ga0207648_101208612 352
482 3300026095 Ga0207676_10003360 Ga0207676_100033605 352
483 3300026095 Ga0207676_10016431 Ga0207676_100164315 352
484 3300026095 Ga0207676_10171461 Ga0207676_101714611 352
485 3300026116 Ga0207674_10002078 Ga0207674_100020787 352
486 3300026116 Ga0207674_10045695 Ga0207674_100456953 352
487 3300026116 Ga0207674_10060972 Ga0207674_100609722 352
488 3300026116 Ga0207674_10193656 Ga0207674_101936562 352
489 3300026116 Ga0207674_10295441 Ga0207674_102954411 352
490 3300026118 Ga0207675_100023947 Ga0207675_1000239476 352
491 3300026121 Ga0207683_10045758 Ga0207683_100457583 352
492 3300026121 Ga0207683_10069256 Ga0207683_100692563 352
493 3300026121 Ga0207683_10091704 Ga0207683_100917042 352
494 3300026121 Ga0207683_10110576 Ga0207683_101105762 352
495 3300026142 Ga0207698_10002593 Ga0207698_100025934 352
496 3300026142 Ga0207698_10040250 Ga0207698_100402503 352
497 3300026142 Ga0207698_10132401 Ga0207698_101324012 352
498 3300026142 Ga0207698_10220954 Ga0207698_102209541 352
499 3300027907 Ga0207428_10028910 Ga0207428_100289102 352
500 3300028379 Ga0268266_10037415 Ga0268266_100374152 352
501 3300028379 Ga0268266_10278993 Ga0268266_102789932 352
502 3300028381 Ga0268264_10000011 Ga0268264_10000011191 352
503 3300028381 Ga0268264_10009483 Ga0268264_100094833 352
504 3300028381 Ga0268264_10044941 Ga0268264_100449413 352
505 3300028794 Ga0307515_10000001 Ga0307515_100000011684 352
506 3300028794 Ga0307515_10000107 Ga0307515_1000010753 352
507 3300031456 Ga0307513_10033628 Ga0307513_100336283 352
508 3300031507 Ga0307509_10067071 Ga0307509_100670712 352
509 3300031730 Ga0307516_10026528 Ga0307516_100265283 352
510 3300031852 Ga0307410_10088468 Ga0307410_100884682 352
511 3300031903 Ga0307407_10070578 Ga0307407_100705782 352
512 3300037312 Ga0395899_0015301 Ga0395899_0015301_4156_5253 352
513 3300037418 Ga0395900_0048528 Ga0395900_0048528_3055_4152 352
514 3300037418 Ga0395900_0193349 Ga0395900_0193349_637_1734 352
515 3300037466 Ga0395898_0026480 Ga0395898_0026480_2284_3381 352
516 3300037466 Ga0395898_0041693 Ga0395898_0041693_2793_3890 352
517 3300037466 Ga0395898_0346550 Ga0395898_0346550_114_1211 352
518 3300038443 Ga0395901_0001058 Ga0395901_0001058_5069_6166 352
519 3300038443 Ga0395901_0052727 Ga0395901_0052727_2804_3901 352
520 3300039437 Ga0436365_0507128 Ga0436365_0507128_706_1803 352
521 3300041404 Ga0439436_0000669 Ga0439436_0000669_1060_2160 352
522 3300042014 Ga0439457_006032 Ga0439457_006032_874_1974 352
523 3300044656 Ga0466969_0000004 Ga0466969_0000004_4837_5934 352
524 3300044658 Ga0466972_0000017 Ga0466972_0000017_134465_135562 352
525 3300044684 Ga0466966_0007010 Ga0466966_0007010_1529_2626 352
526 3300044693 Ga0466961_0160765 Ga0466961_0160765_151_1248 352
527 3300044706 Ga0466964_0021370 Ga0466964_0021370_797_1894 352
528 3300044712 Ga0453684_0098370 Ga0453684_0098370_281_1390 352
529 3300044712 Ga0453684_0132257 Ga0453684_0132257_288_1385 352
530 3300044712 Ga0453684_0195148 Ga0453684_0195148_1138_2238 352
531 3300044712 Ga0453684_0221717 Ga0453684_0221717_423_1520 352
532 3300044719 Ga0466971_0003009 Ga0466971_0003009_2411_3517 352
533 3300044765 Ga0466970_0001899 Ga0466970_0001899_5960_7057 352
534 3300044842 Ga0466957_0000717 Ga0466957_0000717_15087_16184 352
535 3300045049 Ga0466959_0000015 Ga0466959_0000015_126112_127209 352
536 3300045049 Ga0466959_0000681 Ga0466959_0000681_9495_10601 352
537 3300045836 Ga0466958_0187503 Ga0466958_0187503_39_1145 352
538 3300046472 Ga0495580_0029249 Ga0495580_0029249_1299_2396 352
539 3300046516 Ga0495628_0006778 Ga0495628_0006778_440_1543 352
540 3300046524 Ga0495648_0025765 Ga0495648_0025765_195_1307 352
541 3300046535 Ga0495586_0076148 Ga0495586_0076148_198_1301 352
542 3300046616 Ga0495668_0001736 Ga0495668_0001736_14397_15494 352
543 3300046675 Ga0495657_0198996 Ga0495657_0198996_59_1162 352
544 3300046694 Ga0495649_0074461 Ga0495649_0074461_681_1787 352
545 3300047320 Ga0495672_0030018 Ga0495672_0030018_2071_3171 352
546 3300047320 Ga0495672_0041445 Ga0495672_0041445_818_1918 352
547 3300047320 Ga0495672_0044646 Ga0495672_0044646_1396_2493 352
548 3300047443 Ga0495687_000001 Ga0495687_000001_1203093_1204238 352
549 3300047472 Ga0495686_0000094 Ga0495686_0000094_136169_137269 352
550 3300048903 Ga0496100_0037704 Ga0496100_0037704_791_1888 352
551 3300048904 Ga0496101_0053170 Ga0496101_0053170_1149_2246 352
552 3300048913 Ga0496110_0157882 Ga0496110_0157882_865_1977 352
553 3300048917 Ga0496114_0081380 Ga0496114_0081380_588_1685 352
554 3300049569 Ga0501032_0023895 Ga0501032_0023895_2056_3153 352
555 3300049570 Ga0501033_0039630 Ga0501033_0039630_780_1877 352
556 3300049570 Ga0501033_0198453 Ga0501033_0198453_307_1410 352
557 3300049571 Ga0501034_0000002 Ga0501034_0000002_412445_413554 352
558 3300049571 Ga0501034_0037131 Ga0501034_0037131_2753_3850 352
559 3300049571 Ga0501034_0113341 Ga0501034_0113341_521_1618 352
560 3300049573 Ga0501037_0040398 Ga0501037_0040398_1248_2345 352
561 3300049573 Ga0501037_0091842 Ga0501037_0091842_992_2089 352
562 3300049574 Ga0501038_0225645 Ga0501038_0225645_164_1261 352
563 3300049574 Ga0501038_0241562 Ga0501038_0241562_117_1220 352
564 3300049579 Ga0501043_0041956 Ga0501043_0041956_2420_3517 352
565 3300049581 Ga0501047_0083095 Ga0501047_0083095_1130_2227 352
566 3300049581 Ga0501047_0244048 Ga0501047_0244048_115_1239 352
567 3300049582 Ga0501048_0093241 Ga0501048_0093241_548_1645 352
568 3300049584 Ga0501068_0024698 Ga0501068_0024698_772_1869 352
569 3300049586 Ga0501070_0218312 Ga0501070_0218312_186_1283 352
570 3300049586 Ga0501070_0314719 Ga0501070_0314719_38_1135 352
571 3300049589 Ga0501073_0034606 Ga0501073_0034606_78_1175 352
572 3300049589 Ga0501073_0205361 Ga0501073_0205361_62_1159 352
573 3300049590 Ga0501074_0087849 Ga0501074_0087849_61_1158 352
574 3300049705 Ga0501225_0002257 Ga0501225_0002257_1842_2942 352
575 3300049744 Ga0501083_0032831 Ga0501083_0032831_2014_3111 352
576 3300049822 Ga0501035_0035569 Ga0501035_0035569_1402_2499 352
577 3300049822 Ga0501035_0110240 Ga0501035_0110240_894_1991 352
578 3300049823 Ga0501044_0009334 Ga0501044_0009334_6559_7656 352
579 3300049823 Ga0501044_0014346 Ga0501044_0014346_6843_7940 352
580 3300049823 Ga0501044_0112835 Ga0501044_0112835_572_1669 352
581 3300049823 Ga0501044_0154566 Ga0501044_0154566_44_1141 352
582 3300049823 Ga0501044_0259609 Ga0501044_0259609_546_1643 352
583 3300050005 Ga0501284_00114 Ga0501284_00114_5217_6314 352
584 3300050493 nmdc:mga0k408_24585_c1 nmdc:mga0k408_24585_c1_1731_2828 352
585 3300050511 nmdc:mga08y16_10649_c1 nmdc:mga08y16_10649_c1_1931_3034 352
586 3300053086 Ga0500578_0000362 Ga0500578_0000362_53723_54820 352
587 3300053090 Ga0500646_0011758 Ga0500646_0011758_1123_2223 352
588 3300053092 Ga0500583_0001120 Ga0500583_0001120_25_1122 352
589 3300053092 Ga0500583_0007440 Ga0500583_0007440_1806_2918 352
590 3300053103 Ga0500555_036146 Ga0500555_036146_33_1133 352
591 3300053130 Ga0500642_0008551 Ga0500642_0008551_734_1846 352
592 3300053131 Ga0500652_005234 Ga0500652_005234_2926_4023 352
593 3300053136 Ga0500559_0014592 Ga0500559_0014592_2037_3134 352
594 3300053139 Ga0500568_0001989 Ga0500568_0001989_1027_2124 352
595 3300053139 Ga0500568_0014731 Ga0500568_0014731_1015_2127 352
596 3300053146 Ga0500588_0002898 Ga0500588_0002898_993_2096 352
597 3300053147 Ga0500589_028692 Ga0500589_028692_1428_2525 352
598 3300053153 Ga0500616_0006214 Ga0500616_0006214_1975_3072 352
599 3300053156 Ga0500622_0001555 Ga0500622_0001555_11363_12475 352

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01784

DUF34_NIF3

Duf34/NIF3 (NGG1p interacting factor 3)

37

383

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fyw-assembly1.cif.gz_A crystal structure of a conserved protein of unknown function from streptococcus pneumoniae 0.8957 1 350
2fyw-assembly1.cif.gz_A crystal structure of a conserved protein of unknown function from streptococcus pneumoniae 0.8861 1 350
1nmo-assembly1.cif.gz_A structural genomics, protein ybgi, unknown function 0.8403 1 347
2nyd-assembly1.cif.gz_A-3 crystal structure of staphylococcus aureus hypothetical protein sa1388 0.8384 1 350
1nmo-assembly1.cif.gz_A structural genomics, protein ybgi, unknown function 0.8371 1 347
ID Description Score Start End Superfamily
af_Q2FY14_1_121_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.9451 1 121 3.40.1390.30
af_P9WFM1_1_122_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.9432 1 118 3.40.1390.30
af_Q2FY14_1_121_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.9303 1 121 3.40.1390.30
af_P9WFM1_132_234_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9287 132 218 3.30.70.120
af_Q4V7D6_21_147_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.928 1 118 3.40.1390.30
ID Description Score Start End GO Terms
AF-A0A351Q1B2-F1-model_v4 deleted 0.9884 1 103
AF-A0A357Z767-F1-model_v4 Nif3-like dinuclear metal center hexameric protein 0.9868 1 117 GO:0005737
AF-A0A3D3CXN4-F1-model_v4 Nif3-like dinuclear metal center hexameric protein 0.9861 1 270 GO:0005737
AF-A0A519RRW9-F1-model_v4 Nif3-like dinuclear metal center hexameric protein 0.9847 1 97 GO:0005737
AF-A0A5D0H6A8-F1-model_v4 Nif3-like dinuclear metal center hexameric protein 0.9837 1 128 GO:0005737

Feature Viewer

pLDDT pTM Quality
93.44 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map