F467897

General Info

Members Datasets Scaffolds Average Seq Length
599 300 1198 320

Family's Representative Sequence

Representative Sequence 3300042438|Ga0439459_0000607|Ga0439459_0000607_3335_4492
Length 385
Sequence MMSYVRAMEGLLSLKGREPDGDDNPGETLAARLALRTCLDKRGSLLSDAVHRDELDPPGGRPIMLMRRLGRTGLKVSALCLGGNTFGWTTDQKASEAVLDAYVDAGGNFIDTADIYSRWAPGNKGGESEAALGQWMSARKNRAGVLIATKVCGPMGPGPNDKGLSRAHIVEGVEASLRRLGTDYIDLYQAHWDDQETPLAETLRAFDDLVRQGKVRYIGASNYAAWRLTRALWESDRQRTVRYECLQPKYNLVVRDEYERELEPLCLEQEVGVIPYSSLASGFLSGKYRSGEPLPKTARAGGVEKTYMNERGFRVLAAVEKVAAATSATAAQVSLSWLAHRPGITAPIASATSVPQLKELVGAIDLKLDAEQTAALDQAGAWRDA

Samples

Sample ID Description Type Environment
1 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
292 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 2904504865 Serratia marcescens 1822 Isolate Unclassified
300 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.17
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 0
Rhizoplane 2.84
Rhizosphere 91.32
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439459_0000607 3300042438 Bacteria 4800
2 JGI24741J21665_1001654 3300001915 Bacteria 6207
3 JGI24747J21853_1004000 3300001978 Bacteria 1300
4 JGI24740J21852_10005153 3300001979 Bacteria 5545
5 JGI24737J22298_10008660 3300001990 Bacteria 3401
6 JGI24742J22300_10015415 3300002244 Bacteria 1286
7 JGI25153J46596_10000005 3300003215 Bacteria 492839
8 Ga0055525_1000037 3300003759 Bacteria 297990
9 Ga0055542_1000088 3300003762 Bacteria 123491
10 Ga0055529_1000034 3300003763 Bacteria 244657
11 Ga0065715_10017578 3300005293 Bacteria 2839
12 Ga0070658_10000481 3300005327 Bacteria 34645
13 Ga0070658_10009197 3300005327 Bacteria 7943
14 Ga0070658_10172497 3300005327 Bacteria 1817
15 Ga0070658_10331032 3300005327 Bacteria 1301
16 Ga0070683_100073871 3300005329 Bacteria 3184
17 Ga0070670_100005995 3300005331 Bacteria 10283
18 Ga0070670_100017594 3300005331 Bacteria 6134
19 Ga0068869_100001228 3300005334 Bacteria 15094
20 Ga0068869_100005973 3300005334 Bacteria 7698
21 Ga0070666_10305700 3300005335 Bacteria 1133
22 Ga0070680_100064851 3300005336 Bacteria 2993
23 Ga0070680_100071335 3300005336 Bacteria 2854
24 Ga0070682_100000321 3300005337 Bacteria 32876
25 Ga0068868_100036736 3300005338 Bacteria 3794
26 Ga0070660_100017972 3300005339 Bacteria 5160
27 Ga0070660_100018543 3300005339 Bacteria 5086
28 Ga0070691_10022579 3300005341 Bacteria 2920
29 Ga0070691_10065370 3300005341 Bacteria 1756
30 Ga0070687_100003766 3300005343 Bacteria 5943
31 Ga0070661_100038716 3300005344 Bacteria 3472
32 Ga0070692_10011420 3300005345 Bacteria 4076
33 Ga0070692_10029390 3300005345 Bacteria 2739
34 Ga0070692_10149615 3300005345 Bacteria 1329
35 Ga0070669_100042029 3300005353 Bacteria 3326
36 Ga0070675_100041642 3300005354 Bacteria 3752
37 Ga0070674_100006004 3300005356 Bacteria 7059
38 Ga0070674_100011682 3300005356 Bacteria 5353
39 Ga0070673_100011559 3300005364 Bacteria 6031
40 Ga0070673_100055143 3300005364 Bacteria 3131
41 Ga0070659_100000588 3300005366 Bacteria 26590
42 Ga0070705_100000167 3300005440 Bacteria 38185
43 Ga0070705_100044835 3300005440 Bacteria 2541
44 Ga0070700_100043113 3300005441 Bacteria 2774
45 Ga0070694_100000046 3300005444 Bacteria 56167
46 Ga0070694_100012790 3300005444 Bacteria 5228
47 Ga0070694_100018264 3300005444 Bacteria 4450
48 Ga0070694_100033125 3300005444 Bacteria 3397
49 Ga0070694_100063939 3300005444 Bacteria 2518
50 Ga0070708_100065662 3300005445 Bacteria 3254
51 Ga0070708_100131343 3300005445 Bacteria 2318
52 Ga0070708_100273910 3300005445 Bacteria 1588
53 Ga0070708_100496355 3300005445 Bacteria 1151
54 Ga0070663_100005028 3300005455 Bacteria 7810
55 Ga0070663_100186154 3300005455 Bacteria 1613
56 Ga0070678_100000261 3300005456 Bacteria 24340
57 Ga0070662_100002378 3300005457 Bacteria 11561
58 Ga0070662_100130444 3300005457 Bacteria 1937
59 Ga0068867_100016472 3300005459 Bacteria 5248
60 Ga0068867_100048081 3300005459 Bacteria 3138
61 Ga0070685_10124090 3300005466 Bacteria 1607
62 Ga0070706_100027733 3300005467 Bacteria 5208
63 Ga0070707_100062434 3300005468 Bacteria 3574
64 Ga0070707_100102764 3300005468 Bacteria 2769
65 Ga0070698_100009856 3300005471 Bacteria 10212
66 Ga0070698_100025525 3300005471 Bacteria 6159
67 Ga0070698_100160348 3300005471 Bacteria 2193
68 Ga0070698_100428567 3300005471 Bacteria 1257
69 Ga0070699_100010797 3300005518 Bacteria 7905
70 Ga0070699_100023401 3300005518 Bacteria 5321
71 Ga0070699_100052388 3300005518 Bacteria 3532
72 Ga0070699_100204434 3300005518 Bacteria 1757
73 Ga0070699_100221424 3300005518 Bacteria 1686
74 Ga0070679_100001093 3300005530 Bacteria 23732
75 Ga0070679_100308493 3300005530 Bacteria 1532
76 Ga0070684_100005395 3300005535 Bacteria 9796
77 Ga0070697_100028920 3300005536 Bacteria 4441
78 Ga0070697_100041326 3300005536 Bacteria 3731
79 Ga0070697_100063652 3300005536 Bacteria 3012
80 Ga0070697_100160632 3300005536 Bacteria 1898
81 Ga0070697_100210083 3300005536 Bacteria 1657
82 Ga0068853_100000495 3300005539 Bacteria 26943
83 Ga0070686_100081424 3300005544 Bacteria 2144
84 Ga0070695_100000293 3300005545 Bacteria 25187
85 Ga0070695_100000853 3300005545 Bacteria 16416
86 Ga0070695_100004479 3300005545 Bacteria 8207
87 Ga0070695_100014364 3300005545 Bacteria 4773
88 Ga0070695_100018841 3300005545 Bacteria 4195
89 Ga0070695_100090905 3300005545 Bacteria 2038
90 Ga0070695_100227238 3300005545 Bacteria 1347
91 Ga0070696_100015145 3300005546 Bacteria 5178
92 Ga0070693_100000128 3300005547 Bacteria 33796
93 Ga0070693_100013788 3300005547 Bacteria 4125
94 Ga0070665_100000021 3300005548 Bacteria 389668
95 Ga0070665_100488943 3300005548 Bacteria 1242
96 Ga0070704_100003447 3300005549 Bacteria 9073
97 Ga0070704_100089770 3300005549 Bacteria 2287
98 Ga0070704_100109291 3300005549 Bacteria 2101
99 Ga0070704_100118336 3300005549 Bacteria 2030
100 Ga0068855_100000113 3300005563 Bacteria 100669
101 Ga0070664_100051696 3300005564 Bacteria 3479
102 Ga0068859_100004214 3300005617 Bacteria 14669
103 Ga0068859_100460469 3300005617 Bacteria 1368
104 Ga0068864_100072347 3300005618 Bacteria 3004
105 Ga0068861_100001165 3300005719 Bacteria 16378
106 Ga0068861_100121596 3300005719 Bacteria 2107
107 Ga0068861_100134180 3300005719 Bacteria 2013
108 Ga0068870_10003391 3300005840 Bacteria 6751
109 Ga0068863_100002755 3300005841 Bacteria 17400
110 Ga0068863_100115614 3300005841 Bacteria 2556
111 Ga0068858_100015250 3300005842 Bacteria 7230
112 Ga0068858_100032585 3300005842 Bacteria 4839
113 Ga0068860_100005010 3300005843 Bacteria 13488
114 Ga0068860_100017894 3300005843 Bacteria 6901
115 Ga0068862_100019376 3300005844 Bacteria 5678
116 Ga0068862_100103994 3300005844 Bacteria 2487
117 Ga0068862_100207112 3300005844 Bacteria 1771
118 Ga0068862_100215478 3300005844 Bacteria 1736
119 Ga0081455_10000758 3300005937 Bacteria 41975
120 Ga0081539_10000021 3300005985 Bacteria 360643
121 Ga0070716_100002300 3300006173 Bacteria 8797
122 Ga0097621_100200300 3300006237 Bacteria 1733
123 Ga0068871_100272720 3300006358 Bacteria 1478
124 Ga0075430_100020276 3300006846 Bacteria 5656
125 Ga0075430_100190477 3300006846 Bacteria 1705
126 Ga0075430_100340098 3300006846 Bacteria 1240
127 Ga0075431_100004967 3300006847 Bacteria 13088
128 Ga0075431_100032827 3300006847 Bacteria 5350
129 Ga0075431_100135155 3300006847 Bacteria 2542
130 Ga0075431_100138454 3300006847 Bacteria 2509
131 Ga0075433_10021333 3300006852 Bacteria 5431
132 Ga0075433_10091846 3300006852 Bacteria 2684
133 Ga0075434_100006381 3300006871 Bacteria 10810
134 Ga0075434_100091577 3300006871 Bacteria 3042
135 Ga0075429_100001416 3300006880 Bacteria 19655
136 Ga0075429_100055651 3300006880 Bacteria 3442
137 Ga0075429_100337715 3300006880 Bacteria 1318
138 Ga0075436_100002401 3300006914 Bacteria 12913
139 Ga0075436_100069017 3300006914 Bacteria 2442
140 Ga0097620_100004214 3300006931 Bacteria 14669
141 Ga0097620_100460502 3300006931 Bacteria 1368
142 Ga0075435_100020631 3300007076 Bacteria 5054
143 Ga0075435_100022841 3300007076 Bacteria 4829
144 Ga0075435_100120239 3300007076 Bacteria 2191
145 Ga0075435_100417141 3300007076 Bacteria 1156
146 Ga0099794_10114088 3300007265 Bacteria 1356
147 Ga0105250_10000329 3300009092 Bacteria 36640
148 Ga0105240_10436956 3300009093 Bacteria 1467
149 Ga0111539_10020969 3300009094 Bacteria 8046
150 Ga0111539_10419718 3300009094 Bacteria 1558
151 Ga0105245_10388009 3300009098 Bacteria 1392
152 Ga0114129_10003541 3300009147 Bacteria 21982
153 Ga0114129_10014779 3300009147 Bacteria 11121
154 Ga0114129_10045716 3300009147 Bacteria 6154
155 Ga0114129_10140311 3300009147 Bacteria 3313
156 Ga0114129_10156199 3300009147 Bacteria 3119
157 Ga0114129_10321373 3300009147 Bacteria 2057
158 Ga0114129_10596025 3300009147 Bacteria 1432
159 Ga0105243_10000030 3300009148 Bacteria 190342
160 Ga0105243_10046698 3300009148 Bacteria 3407
161 Ga0105243_10468807 3300009148 Bacteria 1186
162 Ga0105241_10002463 3300009174 Bacteria 13913
163 Ga0105241_10053319 3300009174 Bacteria 3092
164 Ga0105242_10251548 3300009176 Bacteria 1593
165 Ga0105248_10083594 3300009177 Bacteria 3591
166 Ga0105248_10202817 3300009177 Bacteria 2234
167 Ga0105237_10228013 3300009545 Bacteria 1864
168 Ga0105249_10081790 3300009553 Bacteria 3003
169 Ga0105249_10172081 3300009553 Bacteria 2101
170 Ga0105246_10085282 3300011119 Bacteria 2261
171 Ga0105246_10086773 3300011119 Bacteria 2244
172 Ga0157373_10070462 3300013100 Bacteria 2470
173 Ga0157371_10000043 3300013102 Bacteria 197887
174 Ga0157371_10170636 3300013102 Bacteria 1555
175 Ga0157370_10044822 3300013104 Bacteria 4247
176 Ga0157378_10149506 3300013297 Bacteria 2175
177 Ga0157378_10434581 3300013297 Bacteria 1300
178 Ga0163162_10145306 3300013306 Bacteria 2487
179 Ga0163162_10433433 3300013306 Bacteria 1447
180 Ga0157372_10000113 3300013307 Bacteria 85757
181 Ga0157372_10147944 3300013307 Bacteria 2709
182 Ga0157375_10086105 3300013308 Bacteria 3193
183 Ga0157375_10164713 3300013308 Bacteria 2361
184 Ga0157375_10593407 3300013308 Bacteria 1267
185 Ga0157375_10736307 3300013308 Bacteria 1138
186 Ga0157380_10313873 3300014326 Bacteria 1450
187 Ga0157379_10003379 3300014968 Bacteria 13509
188 Ga0157379_10142436 3300014968 Bacteria 2161
189 Ga0163161_10329841 3300017792 Bacteria 1208
190 Ga0206353_11704518 3300020082 Bacteria 1800
191 Ga0209563_100053 3300025230 Bacteria 332370
192 Ga0209148_1000093 3300025254 Bacteria 245339
193 Ga0209455_1000045 3300025272 Bacteria 383329
194 Ga0209455_1020768 3300025272 Bacteria 1292
195 Ga0209758_1000001 3300025297 Bacteria 1981790
196 Ga0207696_1000029 3300025711 Bacteria 398074
197 Ga0207647_10009233 3300025904 Bacteria 7014
198 Ga0207647_10104917 3300025904 Bacteria 1674
199 Ga0207647_10106901 3300025904 Bacteria 1656
200 Ga0207645_10000075 3300025907 Bacteria 71333
201 Ga0207645_10234534 3300025907 Bacteria 1212
202 Ga0207643_10000059 3300025908 Bacteria 73469
203 Ga0207705_10000308 3300025909 Bacteria 45168
204 Ga0207705_10009426 3300025909 Bacteria 7100
205 Ga0207705_10019183 3300025909 Bacteria 4891
206 Ga0207684_10004286 3300025910 Bacteria 13518
207 Ga0207684_10006021 3300025910 Bacteria 11097
208 Ga0207684_10015657 3300025910 Bacteria 6527
209 Ga0207654_10036675 3300025911 Bacteria 2741
210 Ga0207707_10000207 3300025912 Bacteria 62455
211 Ga0207695_10019788 3300025913 Bacteria 7738
212 Ga0207671_10002691 3300025914 Bacteria 18638
213 Ga0207693_10091544 3300025915 Bacteria 2384
214 Ga0207660_10000373 3300025917 Bacteria 29237
215 Ga0207660_10117246 3300025917 Bacteria 2012
216 Ga0207662_10171288 3300025918 Bacteria 1392
217 Ga0207657_10000209 3300025919 Bacteria 60459
218 Ga0207657_10003038 3300025919 Bacteria 17970
219 Ga0207657_10047821 3300025919 Bacteria 3737
220 Ga0207649_10000572 3300025920 Bacteria 25183
221 Ga0207652_10000105 3300025921 Bacteria 91044
222 Ga0207646_10034282 3300025922 Bacteria 4588
223 Ga0207646_10060151 3300025922 Bacteria 3392
224 Ga0207646_10082488 3300025922 Bacteria 2875
225 Ga0207694_10009171 3300025924 Bacteria 7465
226 Ga0207650_10009415 3300025925 Bacteria 6678
227 Ga0207650_10023144 3300025925 Bacteria 4405
228 Ga0207659_10109049 3300025926 Bacteria 2101
229 Ga0207690_10004637 3300025932 Bacteria 8128
230 Ga0207706_10031594 3300025933 Bacteria 4716
231 Ga0207706_10212796 3300025933 Bacteria 1694
232 Ga0207706_10219505 3300025933 Bacteria 1665
233 Ga0207686_10040277 3300025934 Bacteria 2840
234 Ga0207686_10107363 3300025934 Bacteria 1876
235 Ga0207709_10000137 3300025935 Bacteria 106203
236 Ga0207709_10021115 3300025935 Bacteria 3682
237 Ga0207669_10000031 3300025937 Bacteria 85825
238 Ga0207669_10000870 3300025937 Bacteria 12815
239 Ga0207704_10318495 3300025938 Bacteria 1199
240 Ga0207665_10003423 3300025939 Bacteria 10612
241 Ga0207711_10382980 3300025941 Bacteria 1305
242 Ga0207689_10000888 3300025942 Bacteria 28747
243 Ga0207689_10001012 3300025942 Bacteria 26995
244 Ga0207689_10062706 3300025942 Bacteria 3057
245 Ga0207689_10109141 3300025942 Bacteria 2274
246 Ga0207661_10088728 3300025944 Bacteria 2571
247 Ga0207679_10045399 3300025945 Bacteria 3177
248 Ga0207679_10199507 3300025945 Bacteria 1670
249 Ga0207667_10000069 3300025949 Bacteria 180683
250 Ga0207667_10000372 3300025949 Bacteria 60711
251 Ga0207667_10013067 3300025949 Bacteria 9531
252 Ga0207651_10032394 3300025960 Bacteria 3357
253 Ga0207712_10194352 3300025961 Bacteria 1604
254 Ga0207712_10375439 3300025961 Bacteria 1188
255 Ga0207668_10021830 3300025972 Bacteria 4088
256 Ga0207640_10002864 3300025981 Bacteria 9252
257 Ga0207703_10004565 3300026035 Bacteria 11351
258 Ga0207703_10012775 3300026035 Bacteria 6547
259 Ga0207639_10007499 3300026041 Bacteria 7442
260 Ga0207639_10026468 3300026041 Bacteria 4215
261 Ga0207678_10003942 3300026067 Bacteria 13352
262 Ga0207678_10013834 3300026067 Bacteria 7090
263 Ga0207678_10303872 3300026067 Bacteria 1371
264 Ga0207708_10008349 3300026075 Bacteria 7669
265 Ga0207708_10031849 3300026075 Bacteria 4004
266 Ga0207708_10101274 3300026075 Bacteria 2229
267 Ga0207702_10001935 3300026078 Bacteria 20217
268 Ga0207702_10031392 3300026078 Bacteria 4427
269 Ga0207641_10062529 3300026088 Bacteria 3177
270 Ga0207641_10095574 3300026088 Bacteria 2609
271 Ga0207648_10040575 3300026089 Bacteria 4090
272 Ga0207648_10556629 3300026089 Bacteria 1054
273 Ga0207676_10095511 3300026095 Bacteria 2451
274 Ga0207674_10000585 3300026116 Bacteria 47921
275 Ga0207674_10002536 3300026116 Bacteria 23004
276 Ga0207674_10030900 3300026116 Bacteria 5630
277 Ga0207675_100000699 3300026118 Bacteria 33170
278 Ga0207675_100021613 3300026118 Bacteria 5992
279 Ga0207675_100122412 3300026118 Bacteria 2462
280 Ga0207675_100397553 3300026118 Bacteria 1357
281 Ga0207683_10000199 3300026121 Bacteria 51632
282 Ga0207698_10053434 3300026142 Bacteria 3101
283 Ga0209969_1015329 3300027360 Bacteria 1119
284 Ga0209996_1000727 3300027395 Bacteria 3942
285 Ga0209984_1008650 3300027424 Bacteria 1283
286 Ga0209999_1001809 3300027543 Bacteria 3712
287 Ga0209970_1000700 3300027614 Bacteria 5825
288 Ga0210002_1007673 3300027617 Bacteria 1639
289 Ga0209983_1002041 3300027665 Bacteria 4459
290 Ga0209588_1010638 3300027671 Bacteria 2770
291 Ga0209971_1000044 3300027682 Bacteria 40743
292 Ga0209966_1000199 3300027695 Bacteria 24912
293 Ga0209998_10000093 3300027717 Bacteria 35480
294 Ga0209974_10014952 3300027876 Bacteria 2577
295 Ga0207428_10000069 3300027907 Bacteria 149507
296 Ga0268266_10000015 3300028379 Bacteria 630629
297 Ga0268265_10011825 3300028380 Bacteria 5901
298 Ga0268265_10034833 3300028380 Bacteria 3673
299 Ga0268265_10183181 3300028380 Bacteria 1801
300 Ga0268265_10196815 3300028380 Bacteria 1745
301 Ga0268264_10004094 3300028381 Bacteria 12483
302 Ga0268264_10021930 3300028381 Bacteria 5213
303 Ga0268264_10218286 3300028381 Bacteria 1754
304 Ga0268264_10560753 3300028381 Bacteria 1121
305 Ga0307517_10031140 3300028786 Bacteria 6222
306 Ga0307517_10045712 3300028786 Bacteria 4591
307 Ga0307513_10010010 3300031456 Bacteria 11956
308 Ga0307408_100005660 3300031548 Bacteria 8332
309 Ga0307408_100030543 3300031548 Bacteria 3742
310 Ga0307408_100064829 3300031548 Bacteria 2677
311 Ga0307408_100102181 3300031548 Bacteria 2186
312 Ga0316575_10006910 3300031665 Bacteria 4106
313 Ga0307405_10005307 3300031731 Bacteria 6199
314 Ga0316577_10098462 3300031733 Bacteria 1638
315 Ga0307413_10006730 3300031824 Bacteria 5278
316 Ga0307406_10041770 3300031901 Bacteria 2859
317 Ga0307407_10003194 3300031903 Bacteria 6648
318 Ga0307412_10013757 3300031911 Bacteria 4754
319 Ga0307409_100003130 3300031995 Bacteria 8886
320 Ga0307409_100244241 3300031995 Bacteria 1636
321 Ga0307416_100006893 3300032002 Bacteria 7155
322 Ga0307416_100226127 3300032002 Bacteria 1800
323 Ga0307416_100413568 3300032002 Bacteria 1390
324 Ga0307414_10188766 3300032004 Bacteria 1665
325 Ga0307411_10011733 3300032005 Bacteria 4746
326 Ga0307415_100071887 3300032126 Bacteria 2434
327 Ga0307415_100389481 3300032126 Bacteria 1186
328 Ga0316583_10016238 3300032133 Bacteria 2679
329 Ga0307510_10086192 3300033180 Bacteria 3014
330 Ga0373948_0018156 3300034817 Bacteria 1319
331 Ga0373960_0005142 3300035121 Bacteria 3019
332 Ga0373961_0021607 3300035241 Bacteria 1713
333 Ga0373931_0017202 3300035691 Bacteria 3572
334 Ga0373931_0017787 3300035691 Bacteria 3522
335 Ga0373931_0063317 3300035691 Bacteria 1999
336 Ga0316582_0000385 3300036647 Bacteria 15972
337 Ga0316584_0085690 3300036712 Bacteria 2359
338 Ga0316584_0091324 3300036712 Bacteria 2280
339 Ga0395899_0084302 3300037312 Bacteria 2310
340 Ga0395900_0310647 3300037418 Bacteria 1560
341 Ga0395905_0114790 3300037471 Bacteria 2530
342 Ga0395901_0342771 3300038443 Bacteria 1543
343 Ga0439448_0000964 3300042005 Bacteria 7117
344 Ga0439448_0021098 3300042005 Bacteria 2019
345 Ga0439464_0001318 3300042439 Bacteria 5787
346 Ga0453683_0000634 3300044673 Bacteria 38191
347 Ga0453683_0004120 3300044673 Bacteria 10446
348 Ga0453683_0018822 3300044673 Unclassified 4429
349 Ga0453683_0124423 3300044673 Bacteria 1623
350 Ga0453683_0188059 3300044673 Bacteria 1310
351 Ga0453684_0001260 3300044712 Bacteria 76122
352 Ga0453684_0004159 3300044712 Bacteria 31307
353 Ga0453684_0009138 3300044712 Bacteria 17446
354 Ga0453684_0405033 3300044712 Bacteria 1527
355 Ga0466970_0072773 3300044765 Bacteria 1849
356 Ga0451576_0013950 3300045051 Bacteria 8968
357 Ga0451576_0025057 3300045051 Bacteria 6433
358 Ga0451576_0142528 3300045051 Bacteria 2499
359 Ga0451576_0168364 3300045051 Bacteria 2287
360 Ga0451576_0285203 3300045051 Bacteria 1726
361 Ga0451576_0287183 3300045051 Bacteria 1720
362 Ga0451576_0563295 3300045051 Bacteria 1197
363 Ga0466958_0051700 3300045836 Bacteria 2488
364 Ga0495617_010765 3300046452 Bacteria 3131
365 Ga0495603_0037551 3300046455 Bacteria 2907
366 Ga0495650_0002700 3300046471 Bacteria 13757
367 Ga0495580_0008477 3300046472 Bacteria 8177
368 Ga0495580_0012996 3300046472 Bacteria 6375
369 Ga0495584_0011454 3300046491 Bacteria 4542
370 Ga0495585_0009855 3300046492 Bacteria 5713
371 Ga0495585_0051372 3300046492 Bacteria 2285
372 Ga0495596_0009243 3300046500 Bacteria 4346
373 Ga0495583_0004141 3300046506 Bacteria 10609
374 Ga0495583_0005152 3300046506 Bacteria 9006
375 Ga0495583_0020669 3300046506 Bacteria 3402
376 Ga0495606_0049132 3300046507 Bacteria 2769
377 Ga0495616_0052612 3300046513 Bacteria 2027
378 Ga0495637_0013598 3300046520 Bacteria 3859
379 Ga0495643_0001691 3300046522 Bacteria 19215
380 Ga0495643_0006852 3300046522 Bacteria 7426
381 Ga0495643_0128549 3300046522 Bacteria 1274
382 Ga0495648_0001164 3300046524 Bacteria 26555
383 Ga0495648_0039673 3300046524 Bacteria 2994
384 Ga0495663_0001245 3300046525 Bacteria 8107
385 Ga0495663_0006854 3300046525 Bacteria 3143
386 Ga0495642_0037220 3300046528 Bacteria 1968
387 Ga0495587_0064297 3300046536 Bacteria 2144
388 Ga0495609_0041291 3300046538 Bacteria 2074
389 Ga0495621_0001044 3300046539 Bacteria 7099
390 Ga0495597_0047887 3300046542 Bacteria 1892
391 Ga0495622_0051840 3300046557 Bacteria 1903
392 Ga0495633_0001474 3300046558 Bacteria 18258
393 Ga0495633_0028719 3300046558 Bacteria 2708
394 Ga0495668_0000084 3300046616 Bacteria 153179
395 Ga0495668_0054296 3300046616 Bacteria 2215
396 Ga0495611_0007168 3300046648 Bacteria 4737
397 Ga0495611_0055486 3300046648 Bacteria 1792
398 Ga0495625_0000774 3300046660 Bacteria 44511
399 Ga0495625_0002005 3300046660 Bacteria 22973
400 Ga0495625_0075999 3300046660 Bacteria 2349
401 Ga0495625_0211940 3300046660 Bacteria 1273
402 Ga0495659_0004869 3300046664 Bacteria 4227
403 Ga0495659_0103615 3300046664 Bacteria 1105
404 Ga0495661_0052952 3300046665 Bacteria 2443
405 Ga0495669_0000128 3300046684 Bacteria 48595
406 Ga0495669_0000296 3300046684 Bacteria 27684
407 Ga0495669_0012049 3300046684 Bacteria 3676
408 Ga0495669_0057143 3300046684 Bacteria 1760
409 Ga0495670_0067756 3300046691 Bacteria 1802
410 Ga0495670_0166831 3300046691 Bacteria 1158
411 Ga0495649_0089823 3300046694 Bacteria 1638
412 Ga0495600_0005154 3300046809 Bacteria 7857
413 Ga0495636_0051324 3300047318 Bacteria 1729
414 Ga0495687_000188 3300047443 Bacteria 90084
415 Ga0495687_000300 3300047443 Bacteria 65580
416 Ga0495677_0014303 3300047445 Bacteria 2890
417 Ga0495681_0004087 3300047470 Bacteria 10041
418 Ga0495686_0000425 3300047472 Bacteria 66316
419 Ga0496101_0034063 3300048904 Bacteria 3596
420 Ga0496102_0000320 3300048905 Bacteria 60114
421 Ga0496102_0008626 3300048905 Bacteria 8746
422 Ga0496102_0008779 3300048905 Bacteria 8666
423 Ga0496102_0089257 3300048905 Bacteria 2851
424 Ga0496102_0224825 3300048905 Bacteria 1770
425 Ga0496103_0000605 3300048906 Bacteria 28172
426 Ga0496103_0111116 3300048906 Bacteria 1741
427 Ga0496105_0007007 3300048908 Bacteria 8682
428 Ga0496106_0059784 3300048909 Bacteria 2888
429 Ga0496106_0242667 3300048909 Bacteria 1440
430 Ga0496106_0365171 3300048909 Bacteria 1160
431 Ga0496107_0061512 3300048910 Bacteria 2719
432 Ga0496108_0032201 3300048911 Bacteria 4354
433 Ga0496111_0018188 3300048914 Bacteria 4866
434 Ga0496114_0008875 3300048917 Bacteria 7970
435 Ga0496115_0000061 3300048918 Bacteria 101438
436 Ga0496116_0018914 3300048919 Bacteria 5290
437 Ga0496117_0000281 3300048920 Bacteria 94664
438 Ga0496117_0002869 3300048920 Bacteria 20949
439 Ga0496118_0000555 3300048921 Bacteria 61594
440 Ga0496118_0001180 3300048921 Bacteria 40327
441 Ga0496119_0014547 3300048922 Bacteria 6143
442 Ga0496119_0088653 3300048922 Bacteria 1763
443 Ga0496121_0002679 3300048924 Bacteria 26637
444 Ga0496121_0017666 3300048924 Bacteria 7261
445 Ga0496121_0165184 3300048924 Bacteria 1614
446 Ga0496123_0070355 3300048926 Bacteria 2190
447 Ga0496124_0000266 3300048927 Bacteria 101288
448 Ga0496125_0002307 3300048928 Bacteria 25174
449 Ga0496125_0037905 3300048928 Bacteria 4184
450 Ga0496126_0001074 3300048929 Bacteria 45978
451 Ga0495682_0029017 3300049460 Bacteria 2049
452 Ga0501031_0150848 3300049568 Bacteria 1519
453 Ga0501033_0167358 3300049570 Bacteria 1580
454 Ga0501036_0063999 3300049572 Bacteria 3114
455 Ga0501036_0091533 3300049572 Bacteria 2569
456 Ga0501036_0163930 3300049572 Bacteria 1874
457 Ga0501039_0014613 3300049575 Bacteria 6010
458 Ga0501039_0018956 3300049575 Bacteria 5281
459 Ga0501039_0068062 3300049575 Bacteria 2765
460 Ga0501039_0071531 3300049575 Bacteria 2695
461 Ga0501039_0156216 3300049575 Bacteria 1792
462 Ga0501039_0163717 3300049575 Bacteria 1749
463 Ga0501039_0267013 3300049575 Bacteria 1345
464 Ga0501040_0006756 3300049576 Bacteria 7445
465 Ga0501040_0077069 3300049576 Bacteria 2306
466 Ga0501040_0110246 3300049576 Bacteria 1924
467 Ga0501040_0181241 3300049576 Bacteria 1493
468 Ga0501042_0005155 3300049578 Bacteria 8390
469 Ga0501042_0012046 3300049578 Bacteria 5850
470 Ga0501042_0056315 3300049578 Bacteria 2806
471 Ga0501042_0178687 3300049578 Bacteria 1531
472 Ga0501042_0219496 3300049578 Bacteria 1371
473 Ga0501042_0228134 3300049578 Bacteria 1343
474 Ga0501046_0000318 3300049580 Bacteria 48443
475 Ga0501046_0039212 3300049580 Bacteria 3795
476 Ga0501046_0054045 3300049580 Bacteria 3161
477 Ga0501046_0163054 3300049580 Bacteria 1676
478 Ga0501046_0187290 3300049580 Bacteria 1545
479 Ga0501046_0209911 3300049580 Bacteria 1446
480 Ga0501047_0096508 3300049581 Bacteria 2835
481 Ga0501048_0002450 3300049582 Bacteria 14165
482 Ga0501048_0013817 3300049582 Bacteria 5989
483 Ga0501048_0030595 3300049582 Bacteria 3895
484 Ga0501048_0060790 3300049582 Bacteria 2677
485 Ga0501048_0176924 3300049582 Bacteria 1512
486 Ga0501067_0157517 3300049583 Bacteria 1265
487 Ga0501068_0087759 3300049584 Bacteria 1916
488 Ga0501070_0335278 3300049586 Bacteria 1229
489 Ga0501071_0139442 3300049587 Bacteria 1805
490 Ga0501072_0005549 3300049588 Bacteria 9595
491 Ga0501072_0011092 3300049588 Bacteria 6877
492 Ga0501072_0011266 3300049588 Bacteria 6827
493 Ga0501072_0080036 3300049588 Bacteria 2588
494 Ga0501072_0121417 3300049588 Bacteria 2082
495 Ga0501072_0145812 3300049588 Bacteria 1887
496 Ga0501074_0163365 3300049590 Bacteria 1590
497 Ga0501074_0214578 3300049590 Bacteria 1371
498 Ga0501075_0003798 3300049591 Bacteria 10162
499 Ga0501075_0004318 3300049591 Bacteria 9617
500 Ga0501075_0031760 3300049591 Bacteria 3922
501 Ga0501075_0087427 3300049591 Bacteria 2362
502 Ga0501075_0098369 3300049591 Bacteria 2221
503 Ga0501075_0173170 3300049591 Bacteria 1647
504 Ga0501076_0000232 3300049592 Bacteria 33942
505 Ga0501076_0002991 3300049592 Bacteria 11740
506 Ga0501076_0006570 3300049592 Bacteria 8435
507 Ga0501076_0026953 3300049592 Bacteria 4455
508 Ga0501076_0041464 3300049592 Bacteria 3622
509 Ga0501076_0119578 3300049592 Bacteria 2133
510 Ga0501076_0183262 3300049592 Bacteria 1707
511 Ga0501076_0357307 3300049592 Bacteria 1200
512 Ga0501077_0004658 3300049593 Bacteria 8333
513 Ga0501077_0020213 3300049593 Bacteria 4215
514 Ga0501077_0028534 3300049593 Bacteria 3547
515 Ga0501079_0001218 3300049741 Bacteria 18020
516 Ga0501079_0010346 3300049741 Bacteria 7088
517 Ga0501079_0097723 3300049741 Bacteria 2276
518 Ga0501079_0098559 3300049741 Bacteria 2265
519 Ga0501079_0359205 3300049741 Bacteria 1141
520 Ga0501080_0012976 3300049742 Bacteria 7650
521 Ga0501080_0065668 3300049742 Bacteria 3375
522 Ga0501081_0001454 3300049743 Bacteria 14514
523 Ga0501081_0045326 3300049743 Bacteria 3020
524 Ga0501081_0078956 3300049743 Bacteria 2301
525 Ga0501081_0113676 3300049743 Bacteria 1923
526 Ga0501081_0129898 3300049743 Bacteria 1799
527 Ga0501083_0006003 3300049744 Bacteria 8605
528 Ga0501083_0023463 3300049744 Bacteria 4277
529 Ga0501083_0164867 3300049744 Bacteria 1449
530 Ga0501035_0166993 3300049822 Bacteria 1903
531 Ga0501044_0041252 3300049823 Bacteria 4805
532 Ga0501045_0001729 3300049824 Bacteria 14702
533 Ga0501045_0001994 3300049824 Bacteria 13780
534 Ga0501045_0028116 3300049824 Bacteria 4055
535 Ga0501045_0147316 3300049824 Bacteria 1751
536 Ga0501045_0247929 3300049824 Bacteria 1326
537 nmdc:mga05p37_109272_c1 3300050507 Bacteria 3402
538 nmdc:mga05p37_156227_c1 3300050507 Bacteria 2787
539 nmdc:mga05p37_159373_c1 3300050507 Bacteria 2757
540 nmdc:mga05p37_178357_c1 3300050507 Bacteria 2587
541 nmdc:mga05p37_27381_c1 3300050507 Bacteria 6940
542 nmdc:mga05p37_287_c1 3300050507 Bacteria 52760
543 nmdc:mga05p37_35133_c2 3300050507 Bacteria 1175
544 nmdc:mga05p37_531334_c1 3300050507 Bacteria 1343
545 nmdc:mga05p37_72092_c1 3300050507 Bacteria 4250
546 nmdc:mga09592_101212_c1 3300050508 Bacteria 2468
547 nmdc:mga09592_21475_c1 3300050508 Bacteria 5319
548 nmdc:mga09592_224555_c1 3300050508 Bacteria 1627
549 nmdc:mga0qj67_138855_c1 3300050509 Bacteria 1970
550 nmdc:mga0qj67_3168_c1 3300050509 Bacteria 11850
551 nmdc:mga06r32_4805_c1 3300050510 Bacteria 12157
552 nmdc:mga06r32_6363_c1 3300050510 Bacteria 10613
553 nmdc:mga06r32_82222_c1 3300050510 Bacteria 3137
554 nmdc:mga06r32_8573_c1 3300050510 Bacteria 9216
555 nmdc:mga06r32_96694_c1 3300050510 Bacteria 2893
556 nmdc:mga08y16_199186_c1 3300050511 Bacteria 2075
557 nmdc:mga08y16_24299_c1 3300050511 Bacteria 6397
558 nmdc:mga08y16_3030_c1 3300050511 Bacteria 17353
559 nmdc:mga0n895_24928_c1 3300050512 Bacteria 5644
560 nmdc:mga0n895_557_c1 3300050512 Bacteria 25550
561 nmdc:mga0n895_89084_c1 3300050512 Bacteria 3087
562 nmdc:mga0rr50_144323_c1 3300050513 Bacteria 1918
563 nmdc:mga0rr50_296127_c1 3300050513 Bacteria 1353
564 nmdc:mga0rr50_489_c1 3300050513 Bacteria 21063
565 nmdc:mga0rr50_94045_c1 3300050513 Bacteria 2340
566 nmdc:mga08x19_174553_c1 3300050514 Bacteria 1465
567 nmdc:mga08x19_74051_c1 3300050514 Bacteria 2225
568 nmdc:mga08x19_7744_c1 3300050514 Bacteria 6379
569 nmdc:mga0a205_111229_c1 3300050515 Bacteria 2638
570 nmdc:mga0a205_13506_c1 3300050515 Bacteria 7606
571 nmdc:mga0a205_27986_c1 3300050515 Bacteria 5385
572 nmdc:mga0a205_3208_c1 3300050515 Bacteria 14532
573 nmdc:mga0a205_386489_c1 3300050515 Bacteria 1264
574 nmdc:mga0a205_449658_c1 3300050515 Bacteria 1148
575 Ga0500610_0000569 3300053079 Bacteria 11351
576 Ga0500595_001983 3300053119 Bacteria 10505
577 Ga0500642_0008093 3300053130 Bacteria 3575
578 Ga0500645_000005 3300053730 Bacteria 284466
579 Ga0500596_001504 3300053735 Bacteria 4718
580 Ga0501084_0012559 3300054114 Bacteria 7017
581 Ga0501084_0023480 3300054114 Bacteria 5145
582 Ga0501084_0024538 3300054114 Bacteria 5031
583 Ga0501084_0027530 3300054114 Bacteria 4749
584 Ga0501084_0048217 3300054114 Bacteria 3566
585 Ga0501084_0170289 3300054114 Bacteria 1838
586 Ga0501084_0183698 3300054114 Bacteria 1765
587 Ga0501082_0000423 3300060353 Bacteria 37467
588 Ga0501082_0014386 3300060353 Bacteria 6808
589 Ga0501082_0018328 3300060353 Bacteria 6028
590 Ga0501082_0023539 3300060353 Bacteria 5313
591 Ga0501082_0033958 3300060353 Bacteria 4400
592 Ga0501082_0087489 3300060353 Bacteria 2688
593 Ga0530510_0000618 3300061734 Bacteria 22898
594 Ga0530510_0007404 3300061734 Bacteria 7639
595 Ga0530510_0012658 3300061734 Bacteria 5930
596 Ga0530510_0113245 3300061734 Bacteria 1988
597 Ga0530510_0146092 3300061734 Bacteria 1744
598 2904509077 2904504865 Bacteria 5152820
599 8054564291 8054563764 Bacteria 5592885
600 Ga0439459_0000607
601 JGI24741J21665_1001654
602 JGI24747J21853_1004000
603 JGI24740J21852_10005153
604 JGI24737J22298_10008660
605 JGI24742J22300_10015415
606 JGI25153J46596_10000005
607 Ga0055525_1000037
608 Ga0055542_1000088
609 Ga0055529_1000034
610 Ga0065715_10017578
611 Ga0070658_10000481
612 Ga0070658_10009197
613 Ga0070658_10172497
614 Ga0070658_10331032
615 Ga0070683_100073871
616 Ga0070670_100005995
617 Ga0070670_100017594
618 Ga0068869_100001228
619 Ga0068869_100005973
620 Ga0070666_10305700
621 Ga0070680_100064851
622 Ga0070680_100071335
623 Ga0070682_100000321
624 Ga0068868_100036736
625 Ga0070660_100017972
626 Ga0070660_100018543
627 Ga0070691_10022579
628 Ga0070691_10065370
629 Ga0070687_100003766
630 Ga0070661_100038716
631 Ga0070692_10011420
632 Ga0070692_10029390
633 Ga0070692_10149615
634 Ga0070669_100042029
635 Ga0070675_100041642
636 Ga0070674_100006004
637 Ga0070674_100011682
638 Ga0070673_100011559
639 Ga0070673_100055143
640 Ga0070659_100000588
641 Ga0070705_100000167
642 Ga0070705_100044835
643 Ga0070700_100043113
644 Ga0070694_100000046
645 Ga0070694_100012790
646 Ga0070694_100018264
647 Ga0070694_100033125
648 Ga0070694_100063939
649 Ga0070708_100065662
650 Ga0070708_100131343
651 Ga0070708_100273910
652 Ga0070708_100496355
653 Ga0070663_100005028
654 Ga0070663_100186154
655 Ga0070678_100000261
656 Ga0070662_100002378
657 Ga0070662_100130444
658 Ga0068867_100016472
659 Ga0068867_100048081
660 Ga0070685_10124090
661 Ga0070706_100027733
662 Ga0070707_100062434
663 Ga0070707_100102764
664 Ga0070698_100009856
665 Ga0070698_100025525
666 Ga0070698_100160348
667 Ga0070698_100428567
668 Ga0070699_100010797
669 Ga0070699_100023401
670 Ga0070699_100052388
671 Ga0070699_100204434
672 Ga0070699_100221424
673 Ga0070679_100001093
674 Ga0070679_100308493
675 Ga0070684_100005395
676 Ga0070697_100028920
677 Ga0070697_100041326
678 Ga0070697_100063652
679 Ga0070697_100160632
680 Ga0070697_100210083
681 Ga0068853_100000495
682 Ga0070686_100081424
683 Ga0070695_100000293
684 Ga0070695_100000853
685 Ga0070695_100004479
686 Ga0070695_100014364
687 Ga0070695_100018841
688 Ga0070695_100090905
689 Ga0070695_100227238
690 Ga0070696_100015145
691 Ga0070693_100000128
692 Ga0070693_100013788
693 Ga0070665_100000021
694 Ga0070665_100488943
695 Ga0070704_100003447
696 Ga0070704_100089770
697 Ga0070704_100109291
698 Ga0070704_100118336
699 Ga0068855_100000113
700 Ga0070664_100051696
701 Ga0068859_100004214
702 Ga0068859_100460469
703 Ga0068864_100072347
704 Ga0068861_100001165
705 Ga0068861_100121596
706 Ga0068861_100134180
707 Ga0068870_10003391
708 Ga0068863_100002755
709 Ga0068863_100115614
710 Ga0068858_100015250
711 Ga0068858_100032585
712 Ga0068860_100005010
713 Ga0068860_100017894
714 Ga0068862_100019376
715 Ga0068862_100103994
716 Ga0068862_100207112
717 Ga0068862_100215478
718 Ga0081455_10000758
719 Ga0081539_10000021
720 Ga0070716_100002300
721 Ga0097621_100200300
722 Ga0068871_100272720
723 Ga0075430_100020276
724 Ga0075430_100190477
725 Ga0075430_100340098
726 Ga0075431_100004967
727 Ga0075431_100032827
728 Ga0075431_100135155
729 Ga0075431_100138454
730 Ga0075433_10021333
731 Ga0075433_10091846
732 Ga0075434_100006381
733 Ga0075434_100091577
734 Ga0075429_100001416
735 Ga0075429_100055651
736 Ga0075429_100337715
737 Ga0075436_100002401
738 Ga0075436_100069017
739 Ga0097620_100004214
740 Ga0097620_100460502
741 Ga0075435_100020631
742 Ga0075435_100022841
743 Ga0075435_100120239
744 Ga0075435_100417141
745 Ga0099794_10114088
746 Ga0105250_10000329
747 Ga0105240_10436956
748 Ga0111539_10020969
749 Ga0111539_10419718
750 Ga0105245_10388009
751 Ga0114129_10003541
752 Ga0114129_10014779
753 Ga0114129_10045716
754 Ga0114129_10140311
755 Ga0114129_10156199
756 Ga0114129_10321373
757 Ga0114129_10596025
758 Ga0105243_10000030
759 Ga0105243_10046698
760 Ga0105243_10468807
761 Ga0105241_10002463
762 Ga0105241_10053319
763 Ga0105242_10251548
764 Ga0105248_10083594
765 Ga0105248_10202817
766 Ga0105237_10228013
767 Ga0105249_10081790
768 Ga0105249_10172081
769 Ga0105246_10085282
770 Ga0105246_10086773
771 Ga0157373_10070462
772 Ga0157371_10000043
773 Ga0157371_10170636
774 Ga0157370_10044822
775 Ga0157378_10149506
776 Ga0157378_10434581
777 Ga0163162_10145306
778 Ga0163162_10433433
779 Ga0157372_10000113
780 Ga0157372_10147944
781 Ga0157375_10086105
782 Ga0157375_10164713
783 Ga0157375_10593407
784 Ga0157375_10736307
785 Ga0157380_10313873
786 Ga0157379_10003379
787 Ga0157379_10142436
788 Ga0163161_10329841
789 Ga0206353_11704518
790 Ga0209563_100053
791 Ga0209148_1000093
792 Ga0209455_1000045
793 Ga0209455_1020768
794 Ga0209758_1000001
795 Ga0207696_1000029
796 Ga0207647_10009233
797 Ga0207647_10104917
798 Ga0207647_10106901
799 Ga0207645_10000075
800 Ga0207645_10234534
801 Ga0207643_10000059
802 Ga0207705_10000308
803 Ga0207705_10009426
804 Ga0207705_10019183
805 Ga0207684_10004286
806 Ga0207684_10006021
807 Ga0207684_10015657
808 Ga0207654_10036675
809 Ga0207707_10000207
810 Ga0207695_10019788
811 Ga0207671_10002691
812 Ga0207693_10091544
813 Ga0207660_10000373
814 Ga0207660_10117246
815 Ga0207662_10171288
816 Ga0207657_10000209
817 Ga0207657_10003038
818 Ga0207657_10047821
819 Ga0207649_10000572
820 Ga0207652_10000105
821 Ga0207646_10034282
822 Ga0207646_10060151
823 Ga0207646_10082488
824 Ga0207694_10009171
825 Ga0207650_10009415
826 Ga0207650_10023144
827 Ga0207659_10109049
828 Ga0207690_10004637
829 Ga0207706_10031594
830 Ga0207706_10212796
831 Ga0207706_10219505
832 Ga0207686_10040277
833 Ga0207686_10107363
834 Ga0207709_10000137
835 Ga0207709_10021115
836 Ga0207669_10000031
837 Ga0207669_10000870
838 Ga0207704_10318495
839 Ga0207665_10003423
840 Ga0207711_10382980
841 Ga0207689_10000888
842 Ga0207689_10001012
843 Ga0207689_10062706
844 Ga0207689_10109141
845 Ga0207661_10088728
846 Ga0207679_10045399
847 Ga0207679_10199507
848 Ga0207667_10000069
849 Ga0207667_10000372
850 Ga0207667_10013067
851 Ga0207651_10032394
852 Ga0207712_10194352
853 Ga0207712_10375439
854 Ga0207668_10021830
855 Ga0207640_10002864
856 Ga0207703_10004565
857 Ga0207703_10012775
858 Ga0207639_10007499
859 Ga0207639_10026468
860 Ga0207678_10003942
861 Ga0207678_10013834
862 Ga0207678_10303872
863 Ga0207708_10008349
864 Ga0207708_10031849
865 Ga0207708_10101274
866 Ga0207702_10001935
867 Ga0207702_10031392
868 Ga0207641_10062529
869 Ga0207641_10095574
870 Ga0207648_10040575
871 Ga0207648_10556629
872 Ga0207676_10095511
873 Ga0207674_10000585
874 Ga0207674_10002536
875 Ga0207674_10030900
876 Ga0207675_100000699
877 Ga0207675_100021613
878 Ga0207675_100122412
879 Ga0207675_100397553
880 Ga0207683_10000199
881 Ga0207698_10053434
882 Ga0209969_1015329
883 Ga0209996_1000727
884 Ga0209984_1008650
885 Ga0209999_1001809
886 Ga0209970_1000700
887 Ga0210002_1007673
888 Ga0209983_1002041
889 Ga0209588_1010638
890 Ga0209971_1000044
891 Ga0209966_1000199
892 Ga0209998_10000093
893 Ga0209974_10014952
894 Ga0207428_10000069
895 Ga0268266_10000015
896 Ga0268265_10011825
897 Ga0268265_10034833
898 Ga0268265_10183181
899 Ga0268265_10196815
900 Ga0268264_10004094
901 Ga0268264_10021930
902 Ga0268264_10218286
903 Ga0268264_10560753
904 Ga0307517_10031140
905 Ga0307517_10045712
906 Ga0307513_10010010
907 Ga0307408_100005660
908 Ga0307408_100030543
909 Ga0307408_100064829
910 Ga0307408_100102181
911 Ga0316575_10006910
912 Ga0307405_10005307
913 Ga0316577_10098462
914 Ga0307413_10006730
915 Ga0307406_10041770
916 Ga0307407_10003194
917 Ga0307412_10013757
918 Ga0307409_100003130
919 Ga0307409_100244241
920 Ga0307416_100006893
921 Ga0307416_100226127
922 Ga0307416_100413568
923 Ga0307414_10188766
924 Ga0307411_10011733
925 Ga0307415_100071887
926 Ga0307415_100389481
927 Ga0316583_10016238
928 Ga0307510_10086192
929 Ga0373948_0018156
930 Ga0373960_0005142
931 Ga0373961_0021607
932 Ga0373931_0017202
933 Ga0373931_0017787
934 Ga0373931_0063317
935 Ga0316582_0000385
936 Ga0316584_0085690
937 Ga0316584_0091324
938 Ga0395899_0084302
939 Ga0395900_0310647
940 Ga0395905_0114790
941 Ga0395901_0342771
942 Ga0439448_0000964
943 Ga0439448_0021098
944 Ga0439464_0001318
945 Ga0453683_0000634
946 Ga0453683_0004120
947 Ga0453683_0018822
948 Ga0453683_0124423
949 Ga0453683_0188059
950 Ga0453684_0001260
951 Ga0453684_0004159
952 Ga0453684_0009138
953 Ga0453684_0405033
954 Ga0466970_0072773
955 Ga0451576_0013950
956 Ga0451576_0025057
957 Ga0451576_0142528
958 Ga0451576_0168364
959 Ga0451576_0285203
960 Ga0451576_0287183
961 Ga0451576_0563295
962 Ga0466958_0051700
963 Ga0495617_010765
964 Ga0495603_0037551
965 Ga0495650_0002700
966 Ga0495580_0008477
967 Ga0495580_0012996
968 Ga0495584_0011454
969 Ga0495585_0009855
970 Ga0495585_0051372
971 Ga0495596_0009243
972 Ga0495583_0004141
973 Ga0495583_0005152
974 Ga0495583_0020669
975 Ga0495606_0049132
976 Ga0495616_0052612
977 Ga0495637_0013598
978 Ga0495643_0001691
979 Ga0495643_0006852
980 Ga0495643_0128549
981 Ga0495648_0001164
982 Ga0495648_0039673
983 Ga0495663_0001245
984 Ga0495663_0006854
985 Ga0495642_0037220
986 Ga0495587_0064297
987 Ga0495609_0041291
988 Ga0495621_0001044
989 Ga0495597_0047887
990 Ga0495622_0051840
991 Ga0495633_0001474
992 Ga0495633_0028719
993 Ga0495668_0000084
994 Ga0495668_0054296
995 Ga0495611_0007168
996 Ga0495611_0055486
997 Ga0495625_0000774
998 Ga0495625_0002005
999 Ga0495625_0075999
1000 Ga0495625_0211940
1001 Ga0495659_0004869
1002 Ga0495659_0103615
1003 Ga0495661_0052952
1004 Ga0495669_0000128
1005 Ga0495669_0000296
1006 Ga0495669_0012049
1007 Ga0495669_0057143
1008 Ga0495670_0067756
1009 Ga0495670_0166831
1010 Ga0495649_0089823
1011 Ga0495600_0005154
1012 Ga0495636_0051324
1013 Ga0495687_000188
1014 Ga0495687_000300
1015 Ga0495677_0014303
1016 Ga0495681_0004087
1017 Ga0495686_0000425
1018 Ga0496101_0034063
1019 Ga0496102_0000320
1020 Ga0496102_0008626
1021 Ga0496102_0008779
1022 Ga0496102_0089257
1023 Ga0496102_0224825
1024 Ga0496103_0000605
1025 Ga0496103_0111116
1026 Ga0496105_0007007
1027 Ga0496106_0059784
1028 Ga0496106_0242667
1029 Ga0496106_0365171
1030 Ga0496107_0061512
1031 Ga0496108_0032201
1032 Ga0496111_0018188
1033 Ga0496114_0008875
1034 Ga0496115_0000061
1035 Ga0496116_0018914
1036 Ga0496117_0000281
1037 Ga0496117_0002869
1038 Ga0496118_0000555
1039 Ga0496118_0001180
1040 Ga0496119_0014547
1041 Ga0496119_0088653
1042 Ga0496121_0002679
1043 Ga0496121_0017666
1044 Ga0496121_0165184
1045 Ga0496123_0070355
1046 Ga0496124_0000266
1047 Ga0496125_0002307
1048 Ga0496125_0037905
1049 Ga0496126_0001074
1050 Ga0495682_0029017
1051 Ga0501031_0150848
1052 Ga0501033_0167358
1053 Ga0501036_0063999
1054 Ga0501036_0091533
1055 Ga0501036_0163930
1056 Ga0501039_0014613
1057 Ga0501039_0018956
1058 Ga0501039_0068062
1059 Ga0501039_0071531
1060 Ga0501039_0156216
1061 Ga0501039_0163717
1062 Ga0501039_0267013
1063 Ga0501040_0006756
1064 Ga0501040_0077069
1065 Ga0501040_0110246
1066 Ga0501040_0181241
1067 Ga0501042_0005155
1068 Ga0501042_0012046
1069 Ga0501042_0056315
1070 Ga0501042_0178687
1071 Ga0501042_0219496
1072 Ga0501042_0228134
1073 Ga0501046_0000318
1074 Ga0501046_0039212
1075 Ga0501046_0054045
1076 Ga0501046_0163054
1077 Ga0501046_0187290
1078 Ga0501046_0209911
1079 Ga0501047_0096508
1080 Ga0501048_0002450
1081 Ga0501048_0013817
1082 Ga0501048_0030595
1083 Ga0501048_0060790
1084 Ga0501048_0176924
1085 Ga0501067_0157517
1086 Ga0501068_0087759
1087 Ga0501070_0335278
1088 Ga0501071_0139442
1089 Ga0501072_0005549
1090 Ga0501072_0011092
1091 Ga0501072_0011266
1092 Ga0501072_0080036
1093 Ga0501072_0121417
1094 Ga0501072_0145812
1095 Ga0501074_0163365
1096 Ga0501074_0214578
1097 Ga0501075_0003798
1098 Ga0501075_0004318
1099 Ga0501075_0031760
1100 Ga0501075_0087427
1101 Ga0501075_0098369
1102 Ga0501075_0173170
1103 Ga0501076_0000232
1104 Ga0501076_0002991
1105 Ga0501076_0006570
1106 Ga0501076_0026953
1107 Ga0501076_0041464
1108 Ga0501076_0119578
1109 Ga0501076_0183262
1110 Ga0501076_0357307
1111 Ga0501077_0004658
1112 Ga0501077_0020213
1113 Ga0501077_0028534
1114 Ga0501079_0001218
1115 Ga0501079_0010346
1116 Ga0501079_0097723
1117 Ga0501079_0098559
1118 Ga0501079_0359205
1119 Ga0501080_0012976
1120 Ga0501080_0065668
1121 Ga0501081_0001454
1122 Ga0501081_0045326
1123 Ga0501081_0078956
1124 Ga0501081_0113676
1125 Ga0501081_0129898
1126 Ga0501083_0006003
1127 Ga0501083_0023463
1128 Ga0501083_0164867
1129 Ga0501035_0166993
1130 Ga0501044_0041252
1131 Ga0501045_0001729
1132 Ga0501045_0001994
1133 Ga0501045_0028116
1134 Ga0501045_0147316
1135 Ga0501045_0247929
1136 nmdc:mga05p37_109272_c1
1137 nmdc:mga05p37_156227_c1
1138 nmdc:mga05p37_159373_c1
1139 nmdc:mga05p37_178357_c1
1140 nmdc:mga05p37_27381_c1
1141 nmdc:mga05p37_287_c1
1142 nmdc:mga05p37_35133_c2
1143 nmdc:mga05p37_531334_c1
1144 nmdc:mga05p37_72092_c1
1145 nmdc:mga09592_101212_c1
1146 nmdc:mga09592_21475_c1
1147 nmdc:mga09592_224555_c1
1148 nmdc:mga0qj67_138855_c1
1149 nmdc:mga0qj67_3168_c1
1150 nmdc:mga06r32_4805_c1
1151 nmdc:mga06r32_6363_c1
1152 nmdc:mga06r32_82222_c1
1153 nmdc:mga06r32_8573_c1
1154 nmdc:mga06r32_96694_c1
1155 nmdc:mga08y16_199186_c1
1156 nmdc:mga08y16_24299_c1
1157 nmdc:mga08y16_3030_c1
1158 nmdc:mga0n895_24928_c1
1159 nmdc:mga0n895_557_c1
1160 nmdc:mga0n895_89084_c1
1161 nmdc:mga0rr50_144323_c1
1162 nmdc:mga0rr50_296127_c1
1163 nmdc:mga0rr50_489_c1
1164 nmdc:mga0rr50_94045_c1
1165 nmdc:mga08x19_174553_c1
1166 nmdc:mga08x19_74051_c1
1167 nmdc:mga08x19_7744_c1
1168 nmdc:mga0a205_111229_c1
1169 nmdc:mga0a205_13506_c1
1170 nmdc:mga0a205_27986_c1
1171 nmdc:mga0a205_3208_c1
1172 nmdc:mga0a205_386489_c1
1173 nmdc:mga0a205_449658_c1
1174 Ga0500610_0000569
1175 Ga0500595_001983
1176 Ga0500642_0008093
1177 Ga0500645_000005
1178 Ga0500596_001504
1179 Ga0501084_0012559
1180 Ga0501084_0023480
1181 Ga0501084_0024538
1182 Ga0501084_0027530
1183 Ga0501084_0048217
1184 Ga0501084_0170289
1185 Ga0501084_0183698
1186 Ga0501082_0000423
1187 Ga0501082_0014386
1188 Ga0501082_0018328
1189 Ga0501082_0023539
1190 Ga0501082_0033958
1191 Ga0501082_0087489
1192 Ga0530510_0000618
1193 Ga0530510_0007404
1194 Ga0530510_0012658
1195 Ga0530510_0113245
1196 Ga0530510_0146092
1197 2904509077
1198 8054564291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

78

381

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9437 2 314
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9424 2 314
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9395 1 314
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9373 2 314
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9282 1 314
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9142 1 314 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9107 3 313 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9061 3 312 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8996 3 313 3.20.20.100
af_Q0D8N4_49_369_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8954 4 313 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A520ITF2-F1-model_v4 Aldo/keto reductase 0.9935 179 314 GO:0005829
AF-A0A520ITF2-F1-model_v4 Aldo/keto reductase 0.9791 179 314 GO:0005829
AF-A0A1W9HIC9-F1-model_v4 Alcohol dehydrogenase 0.9789 4 284 GO:0005829
AF-A0A529I2A4-F1-model_v4 deleted 0.9787 96 314
AF-A0A435G3J2-F1-model_v4 Aldo/keto reductase 0.9759 111 314 GO:0005829

Map