F467899

General Info

Members Datasets Scaffolds Average Seq Length
599 328 1198 277

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0254947|Ga0466966_0254947_83_1045
Length 320
Sequence VPSSSAQADDPVSAAREGLFRLRRLLDAPLSRGMTEVDESRLMKKWNMIIDVAECTNCNLCTLAAMDEYVDNEWPGYSAPMPKHGHKWINILQKERGQMPMIDIAYVPTMCNHCDDAPCMKADTGGAITKRGDGIVLIDPVKAKGRKELVEACPYGHIWWNDELQLPQHWTFDAHLIDQGWQQTRGQQSCPTGAMRAIKVEDDEMARLASDEKLEVMRPELGSRPRVYYRNLWRYSKCFIGGSVAEEKNGTVDCVEGASVQLLKDGSSVAVTTTDNYGDFKFDKLDEDSGRYTVQIFSSGRSKTIEATLGASINLGEIRL

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
99 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 10.35
Rhizosphere 87.31
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0254947 3300044684 Bacteria 1057
2 SwRhRL2b_contig_1831614 2162886007 Unclassified 1799
3 2214544920 2209111006 Bacteria 20198
4 ARcpr5oldR_c000395 3300000041 Bacteria 6066
5 ARSoilYngRDRAFT_c00032 3300000042 Bacteria 21998
6 ARcpr5yngRDRAFT_c000061 3300000043 Bacteria 17653
7 ARSoilOldRDRAFT_c000136 3300000044 Bacteria 12915
8 ARCol0oldRDRAFT_c00446 3300000045 Unclassified 3929
9 ARCol0yngRDRAFT_1000139 3300000652 Bacteria 12910
10 JGI24752J21851_1012071 3300001976 Bacteria 1130
11 JGI24743J22301_10007812 3300001991 Bacteria 1863
12 JGI24744J21845_10006076 3300002077 Bacteria 2505
13 JGI24034J26672_10009452 3300002239 Bacteria 1439
14 rootH1_10356764 3300003323 Bacteria 2169
15 Ga0065716_1001581 3300005277 Bacteria 5878
16 Ga0065704_10080762 3300005289 Unclassified 3884
17 Ga0065707_10121940 3300005295 Bacteria 2099
18 Ga0070676_10015980 3300005328 Bacteria 4144
19 Ga0070676_10044243 3300005328 Bacteria 2591
20 Ga0070683_100039525 3300005329 Bacteria 4331
21 Ga0070683_100503720 3300005329 Bacteria 1157
22 Ga0070690_100024154 3300005330 Bacteria 3738
23 Ga0070690_100036744 3300005330 Bacteria 3081
24 Ga0070690_100190943 3300005330 Bacteria 1420
25 Ga0070670_100178055 3300005331 Bacteria 1846
26 Ga0070666_10344930 3300005335 Bacteria 1065
27 Ga0070680_100036582 3300005336 Bacteria 3966
28 Ga0070680_100249408 3300005336 Bacteria 1501
29 Ga0070682_100187077 3300005337 Unclassified 1451
30 Ga0068868_100201031 3300005338 Bacteria 1661
31 Ga0070660_100135248 3300005339 Bacteria 1975
32 Ga0070689_100016595 3300005340 Bacteria 5391
33 Ga0070689_100136274 3300005340 Bacteria 1971
34 Ga0070687_100021169 3300005343 Bacteria 3052
35 Ga0070661_100503256 3300005344 Bacteria 970
36 Ga0070692_10044090 3300005345 Bacteria 2297
37 Ga0070668_100137467 3300005347 Bacteria 1966
38 Ga0070668_100262438 3300005347 Bacteria 1437
39 Ga0070669_100163818 3300005353 Bacteria 1730
40 Ga0070675_100230920 3300005354 Bacteria 1614
41 Ga0070674_100099820 3300005356 Bacteria 2113
42 Ga0070673_100024556 3300005364 Bacteria 4422
43 Ga0070659_100037562 3300005366 Bacteria 3776
44 Ga0070659_100220380 3300005366 Bacteria 1565
45 Ga0070667_100297621 3300005367 Bacteria 1452
46 Ga0070709_10051784 3300005434 Bacteria 2578
47 Ga0070709_10228144 3300005434 Bacteria 1331
48 Ga0070701_10037485 3300005438 Bacteria 2448
49 Ga0070701_10083067 3300005438 Bacteria 1738
50 Ga0070711_100036661 3300005439 Bacteria 3286
51 Ga0070711_100196436 3300005439 Bacteria 1554
52 Ga0070700_100045009 3300005441 Unclassified 2721
53 Ga0070663_100191118 3300005455 Bacteria 1593
54 Ga0070678_100241562 3300005456 Unclassified 1510
55 Ga0070662_100055926 3300005457 Unclassified 2864
56 Ga0070662_100132786 3300005457 Unclassified 1921
57 Ga0070681_10000708 3300005458 Bacteria 27710
58 Ga0068867_100065507 3300005459 Unclassified 2704
59 Ga0068867_100110735 3300005459 Bacteria 2109
60 Ga0070685_10041462 3300005466 Bacteria 2622
61 Ga0070685_10062402 3300005466 Unclassified 2185
62 Ga0070685_10385623 3300005466 Bacteria 967
63 Ga0070699_100012813 3300005518 Bacteria 7228
64 Ga0070699_100185807 3300005518 Bacteria 1845
65 Ga0070679_100206770 3300005530 Bacteria 1927
66 Ga0068853_100199266 3300005539 Bacteria 1821
67 Ga0070672_100407901 3300005543 Unclassified 1165
68 Ga0070686_100149468 3300005544 Bacteria 1634
69 Ga0070686_100347079 3300005544 Bacteria 1114
70 Ga0070686_100524080 3300005544 Bacteria 923
71 Ga0070665_100549906 3300005548 Bacteria 1167
72 Ga0070704_100064974 3300005549 Bacteria 2625
73 Ga0070704_100101533 3300005549 Bacteria 2168
74 Ga0070704_100194567 3300005549 Bacteria 1633
75 Ga0070664_100148659 3300005564 Bacteria 2067
76 Ga0068857_100281175 3300005577 Bacteria 1531
77 Ga0068854_100390104 3300005578 Bacteria 1149
78 Ga0068856_100114199 3300005614 Bacteria 2700
79 Ga0070702_100457015 3300005615 Bacteria 928
80 Ga0068859_100080058 3300005617 Unclassified 3307
81 Ga0068859_100295304 3300005617 Bacteria 1714
82 Ga0068859_100802394 3300005617 Unclassified 1029
83 Ga0068864_100084336 3300005618 Bacteria 2791
84 Ga0068851_10121712 3300005834 Unclassified 1403
85 Ga0068863_100156520 3300005841 Unclassified 2182
86 Ga0068863_100439796 3300005841 Bacteria 1279
87 Ga0068858_100036593 3300005842 Bacteria 4550
88 Ga0068858_100092607 3300005842 Unclassified 2813
89 Ga0068858_100123637 3300005842 Unclassified 2421
90 Ga0068860_100181946 3300005843 Bacteria 2031
91 Ga0068862_100074065 3300005844 Unclassified 2943
92 Ga0081455_10001860 3300005937 Bacteria 25395
93 Ga0081455_10010994 3300005937 Bacteria 9123
94 Ga0081455_10080462 3300005937 Bacteria 2671
95 Ga0081455_10187941 3300005937 Bacteria 1559
96 Ga0081455_10342494 3300005937 Bacteria 1057
97 Ga0081538_10005698 3300005981 Bacteria 11139
98 Ga0081538_10166423 3300005981 Bacteria 970
99 Ga0081540_1000183 3300005983 Bacteria 65356
100 Ga0081540_1005670 3300005983 Bacteria 9277
101 Ga0081540_1009789 3300005983 Bacteria 6562
102 Ga0081540_1033395 3300005983 Bacteria 2795
103 Ga0081540_1120576 3300005983 Bacteria 1089
104 Ga0070717_10294861 3300006028 Bacteria 1441
105 Ga0075365_10011942 3300006038 Bacteria 5131
106 Ga0075365_10038703 3300006038 Bacteria 3102
107 Ga0075365_10104603 3300006038 Bacteria 1941
108 Ga0070715_10058674 3300006163 Bacteria 1681
109 Ga0070715_10109261 3300006163 Bacteria 1302
110 Ga0070712_100025865 3300006175 Bacteria 3905
111 Ga0070712_100203881 3300006175 Bacteria 1555
112 Ga0075362_10066258 3300006177 Bacteria 1641
113 Ga0075367_10055853 3300006178 Bacteria 2344
114 Ga0075367_10148416 3300006178 Bacteria 1454
115 Ga0097621_100059768 3300006237 Bacteria 3122
116 Ga0075428_100030815 3300006844 Bacteria 5931
117 Ga0075428_100051979 3300006844 Bacteria 4493
118 Ga0075430_100000311 3300006846 Bacteria 34566
119 Ga0075430_100128605 3300006846 Bacteria 2111
120 Ga0075430_100246339 3300006846 Bacteria 1481
121 Ga0075431_100045787 3300006847 Bacteria 4509
122 Ga0075431_100170064 3300006847 Bacteria 2239
123 Ga0075431_100207312 3300006847 Bacteria 2004
124 Ga0075431_100793293 3300006847 Bacteria 921
125 Ga0075433_10117018 3300006852 Unclassified 2365
126 Ga0075433_10450788 3300006852 Unclassified 1134
127 Ga0075434_100005301 3300006871 Bacteria 11729
128 Ga0075434_100220232 3300006871 Bacteria 1917
129 Ga0075429_100070188 3300006880 Bacteria 3050
130 Ga0075429_100169660 3300006880 Bacteria 1911
131 Ga0075436_100064018 3300006914 Bacteria 2542
132 Ga0075436_100131530 3300006914 Bacteria 1755
133 Ga0097620_100080058 3300006931 Unclassified 3307
134 Ga0097620_100295304 3300006931 Bacteria 1714
135 Ga0097620_100802480 3300006931 Unclassified 1029
136 Ga0099794_10007525 3300007265 Bacteria 4480
137 Ga0099794_10084631 3300007265 Bacteria 1568
138 Ga0099795_10008849 3300007788 Bacteria 2895
139 Ga0105240_10118655 3300009093 Bacteria 3188
140 Ga0111539_10005693 3300009094 Bacteria 16124
141 Ga0111539_10609068 3300009094 Bacteria 1272
142 Ga0111539_11377508 3300009094 Bacteria 818
143 Ga0105245_10074900 3300009098 Bacteria 3081
144 Ga0114129_10009721 3300009147 Bacteria 13721
145 Ga0114129_10024961 3300009147 Bacteria 8474
146 Ga0114129_10128924 3300009147 Bacteria 3476
147 Ga0114129_10191202 3300009147 Bacteria 2779
148 Ga0114129_10218131 3300009147 Bacteria 2575
149 Ga0114129_10357825 3300009147 Bacteria 1932
150 Ga0114129_10388389 3300009147 Bacteria 1842
151 Ga0105241_10321271 3300009174 Bacteria 1335
152 Ga0105242_10186229 3300009176 Bacteria 1835
153 Ga0105248_10097526 3300009177 Bacteria 3312
154 Ga0105248_10183124 3300009177 Bacteria 2360
155 Ga0105248_10456875 3300009177 Bacteria 1439
156 Ga0105237_10080387 3300009545 Bacteria 3250
157 Ga0105238_10327002 3300009551 Unclassified 1519
158 Ga0105249_10158485 3300009553 Unclassified 2185
159 Ga0105249_10537932 3300009553 Bacteria 1218
160 Ga0105246_10103964 3300011119 Bacteria 2074
161 Ga0157344_1000470 3300012476 Bacteria 1578
162 Ga0157323_1003505 3300012495 Bacteria 950
163 Ga0157373_10238475 3300013100 Bacteria 1285
164 Ga0157370_10005113 3300013104 Bacteria 14793
165 Ga0157374_10567377 3300013296 Unclassified 1143
166 Ga0157378_10167721 3300013297 Bacteria 2058
167 Ga0163162_10166546 3300013306 Bacteria 2328
168 Ga0163162_10316386 3300013306 Bacteria 1693
169 Ga0163162_10510694 3300013306 Bacteria 1332
170 Ga0157372_10035808 3300013307 Bacteria 5466
171 Ga0157372_10296489 3300013307 Bacteria 1881
172 Ga0157372_10625198 3300013307 Bacteria 1255
173 Ga0157375_10148696 3300013308 Bacteria 2476
174 Ga0157375_10276789 3300013308 Bacteria 1841
175 Ga0163163_10039201 3300014325 Bacteria 4622
176 Ga0163163_10188340 3300014325 Unclassified 2112
177 Ga0157380_10221660 3300014326 Bacteria 1692
178 Ga0182008_10113814 3300014497 Unclassified 1341
179 Ga0157377_10061450 3300014745 Bacteria 2147
180 Ga0157376_10040052 3300014969 Bacteria 3827
181 Ga0157376_10097644 3300014969 Bacteria 2559
182 Ga0163161_10093783 3300017792 Bacteria 2224
183 Ga0207656_10017789 3300025321 Unclassified 2789
184 Ga0207682_10045090 3300025893 Bacteria 1809
185 Ga0207692_10315850 3300025898 Bacteria 955
186 Ga0207710_10106633 3300025900 Bacteria 1327
187 Ga0207688_10022504 3300025901 Bacteria 3449
188 Ga0207680_10105409 3300025903 Bacteria 1819
189 Ga0207647_10014286 3300025904 Bacteria 5477
190 Ga0207685_10061019 3300025905 Bacteria 1493
191 Ga0207685_10067547 3300025905 Bacteria 1438
192 Ga0207699_10012929 3300025906 Bacteria 4256
193 Ga0207645_10019185 3300025907 Bacteria 4488
194 Ga0207643_10000872 3300025908 Bacteria 18178
195 Ga0207684_10158518 3300025910 Bacteria 1948
196 Ga0207707_10023677 3300025912 Bacteria 5370
197 Ga0207707_10179340 3300025912 Bacteria 1849
198 Ga0207693_10008359 3300025915 Bacteria 8471
199 Ga0207693_10038010 3300025915 Bacteria 3792
200 Ga0207693_10040307 3300025915 Bacteria 3678
201 Ga0207693_10077132 3300025915 Bacteria 2609
202 Ga0207663_10115023 3300025916 Bacteria 1832
203 Ga0207660_10004266 3300025917 Bacteria 9319
204 Ga0207662_10007580 3300025918 Bacteria 5912
205 Ga0207657_10023526 3300025919 Bacteria 5735
206 Ga0207652_10010306 3300025921 Bacteria 7524
207 Ga0207659_10291224 3300025926 Bacteria 1338
208 Ga0207687_10396859 3300025927 Bacteria 1134
209 Ga0207700_10142650 3300025928 Bacteria 1970
210 Ga0207644_10035189 3300025931 Bacteria 3508
211 Ga0207690_10242211 3300025932 Unclassified 1389
212 Ga0207706_10056684 3300025933 Unclassified 3454
213 Ga0207706_10272722 3300025933 Unclassified 1476
214 Ga0207686_10135763 3300025934 Bacteria 1693
215 Ga0207709_10320725 3300025935 Unclassified 1159
216 Ga0207670_10002139 3300025936 Bacteria 10336
217 Ga0207670_10189690 3300025936 Bacteria 1555
218 Ga0207670_10416597 3300025936 Bacteria 1077
219 Ga0207669_10020543 3300025937 Bacteria 3467
220 Ga0207669_10046523 3300025937 Bacteria 2564
221 Ga0207704_10092037 3300025938 Bacteria 1994
222 Ga0207665_10006295 3300025939 Bacteria 7873
223 Ga0207665_10157812 3300025939 Bacteria 1629
224 Ga0207691_10007735 3300025940 Bacteria 10345
225 Ga0207711_10003367 3300025941 Bacteria 13852
226 Ga0207711_10390130 3300025941 Bacteria 1293
227 Ga0207661_10346787 3300025944 Bacteria 1339
228 Ga0207679_10167690 3300025945 Bacteria 1804
229 Ga0207668_10028831 3300025972 Bacteria 3634
230 Ga0207658_10166521 3300025986 Bacteria 1811
231 Ga0207703_10210367 3300026035 Bacteria 1734
232 Ga0207703_10612983 3300026035 Bacteria 1030
233 Ga0207639_10049286 3300026041 Bacteria 3193
234 Ga0207678_10005238 3300026067 Bacteria 11614
235 Ga0207708_10005514 3300026075 Bacteria 9339
236 Ga0207708_10059087 3300026075 Unclassified 2926
237 Ga0207641_10284515 3300026088 Bacteria 1556
238 Ga0207648_10028821 3300026089 Bacteria 4922
239 Ga0207648_10117889 3300026089 Unclassified 2333
240 Ga0207676_10034428 3300026095 Bacteria 3835
241 Ga0207674_10058822 3300026116 Bacteria 3892
242 Ga0207675_100035978 3300026118 Bacteria 4618
243 Ga0207683_10051673 3300026121 Bacteria 3601
244 Ga0207698_10130895 3300026142 Unclassified 2143
245 Ga0209179_1008104 3300027512 Bacteria 1760
246 Ga0207428_10004567 3300027907 Bacteria 13120
247 Ga0207428_10173195 3300027907 Bacteria 1633
248 Ga0207428_10343874 3300027907 Bacteria 1098
249 Ga0265357_1000526 3300028023 Bacteria 2290
250 Ga0268266_10341305 3300028379 Unclassified 1406
251 Ga0268266_10623664 3300028379 Bacteria 1037
252 Ga0268265_10070804 3300028380 Unclassified 2713
253 Ga0268265_10280953 3300028380 Bacteria 1489
254 Ga0265337_1001529 3300028556 Bacteria 11350
255 Ga0265338_10010460 3300028800 Bacteria 10872
256 Ga0265770_1020447 3300030878 Bacteria 1046
257 Ga0265760_10029890 3300031090 Unclassified 1603
258 Ga0265330_10024010 3300031235 Unclassified 2766
259 Ga0265332_10001364 3300031238 Bacteria 13853
260 Ga0265325_10035404 3300031241 Bacteria 2652
261 Ga0265325_10058454 3300031241 Bacteria 1964
262 Ga0265340_10009578 3300031247 Bacteria 5194
263 Ga0265340_10143968 3300031247 Unclassified 1089
264 Ga0265339_10000133 3300031249 Bacteria 60726
265 Ga0265331_10010346 3300031250 Bacteria 5167
266 Ga0265316_10191371 3300031344 Bacteria 1520
267 Ga0265313_10000491 3300031595 Bacteria 41687
268 Ga0265314_10010268 3300031711 Bacteria 7827
269 Ga0265342_10000328 3300031712 Bacteria 53590
270 Ga0316578_10059481 3300031728 Bacteria 2248
271 Ga0373930_0000042 3300034816 Bacteria 11263
272 Ga0373948_0000129 3300034817 Bacteria 7918
273 Ga0373950_0001254 3300034818 Unclassified 3278
274 Ga0373938_0000030 3300034957 Bacteria 18683
275 Ga0373938_0021761 3300034957 Bacteria 1303
276 Ga0373926_0118501 3300035083 Bacteria 997
277 Ga0373928_0000123 3300035084 Bacteria 14455
278 Ga0373928_0021523 3300035084 Bacteria 1361
279 Ga0373929_0000703 3300035085 Bacteria 6477
280 Ga0373934_0017783 3300035086 Bacteria 2716
281 Ga0373934_0039593 3300035086 Bacteria 1859
282 Ga0373940_0000022 3300035088 Bacteria 17194
283 Ga0373944_0006259 3300035089 Bacteria 3154
284 Ga0373949_0000438 3300035090 Bacteria 14335
285 Ga0373951_0004506 3300035091 Unclassified 3301
286 Ga0373952_0000180 3300035092 Bacteria 9797
287 Ga0373923_0032815 3300035111 Bacteria 2099
288 Ga0373923_0121884 3300035111 Bacteria 1166
289 Ga0373932_0000683 3300035112 Bacteria 10253
290 Ga0373932_0014144 3300035112 Bacteria 2001
291 Ga0373936_0001692 3300035113 Bacteria 8090
292 Ga0373939_0000329 3300035114 Bacteria 12192
293 Ga0373941_0000049 3300035115 Bacteria 17770
294 Ga0373945_0005566 3300035116 Unclassified 4037
295 Ga0373945_0008967 3300035116 Bacteria 3270
296 Ga0373953_0161825 3300035117 Bacteria 962
297 Ga0373954_0013000 3300035118 Bacteria 3706
298 Ga0373954_0065137 3300035118 Bacteria 1724
299 Ga0373954_0089043 3300035118 Bacteria 1481
300 Ga0373954_0094761 3300035118 Bacteria 1437
301 Ga0373956_0003856 3300035119 Bacteria 6027
302 Ga0373956_0149576 3300035119 Bacteria 1098
303 Ga0373957_0017204 3300035120 Bacteria 2514
304 Ga0373960_0000240 3300035121 Bacteria 10234
305 Ga0373943_0005937 3300035170 Bacteria 5479
306 Ga0373943_0074089 3300035170 Bacteria 1730
307 Ga0373943_0094098 3300035170 Bacteria 1556
308 Ga0373946_0010660 3300035171 Bacteria 3408
309 Ga0373946_0040899 3300035171 Unclassified 1899
310 Ga0373955_0357529 3300035172 Unclassified 885
311 Ga0373961_0001448 3300035241 Bacteria 6991
312 Ga0373962_0000637 3300035242 Bacteria 7969
313 Ga0316574_0000202 3300035398 Bacteria 20869
314 Ga0373924_0002618 3300035410 Bacteria 6074
315 Ga0373924_0003107 3300035410 Bacteria 5667
316 Ga0373924_0038587 3300035410 Bacteria 1949
317 Ga0373931_0002197 3300035691 Bacteria 8618
318 Ga0373931_0014415 3300035691 Unclassified 3863
319 Ga0373931_0161493 3300035691 Bacteria 1314
320 Ga0373935_0000337 3300035692 Bacteria 23756
321 Ga0373935_0025186 3300035692 Bacteria 3666
322 Ga0373935_0043417 3300035692 Bacteria 2829
323 Ga0373935_0045529 3300035692 Bacteria 2769
324 Ga0373935_0318938 3300035692 Bacteria 1102
325 Ga0373927_0010461 3300035695 Bacteria 6184
326 Ga0373927_0017168 3300035695 Bacteria 4769
327 Ga0373927_0017198 3300035695 Bacteria 4763
328 Ga0373927_0048991 3300035695 Bacteria 2732
329 Ga0373927_0122483 3300035695 Bacteria 1697
330 Ga0373927_0205603 3300035695 Unclassified 1293
331 Ga0373927_0229033 3300035695 Bacteria 1221
332 Ga0373933_0001345 3300035724 Bacteria 14486
333 Ga0373933_0008931 3300035724 Bacteria 5466
334 Ga0373933_0124154 3300035724 Bacteria 1619
335 Ga0373947_0009229 3300035725 Bacteria 5669
336 Ga0373947_0020264 3300035725 Bacteria 3838
337 Ga0373947_0074759 3300035725 Bacteria 2086
338 Ga0373947_0101560 3300035725 Bacteria 1808
339 Ga0373947_0138367 3300035725 Bacteria 1560
340 Ga0373947_0163332 3300035725 Bacteria 1441
341 Ga0373947_0181537 3300035725 Bacteria 1370
342 Ga0373937_0000597 3300036401 Bacteria 31969
343 Ga0373937_0000934 3300036401 Bacteria 24791
344 Ga0373937_0008587 3300036401 Bacteria 8872
345 Ga0373937_0031848 3300036401 Bacteria 4780
346 Ga0373937_0229462 3300036401 Bacteria 1748
347 Ga0316584_0108806 3300036712 Bacteria 2074
348 Ga0373925_0000741 3300037068 Bacteria 29997
349 Ga0373925_0019319 3300037068 Bacteria 4955
350 Ga0373925_0040893 3300037068 Bacteria 3434
351 Ga0373925_0099428 3300037068 Bacteria 2234
352 Ga0373925_0110476 3300037068 Bacteria 2123
353 Ga0373925_0164119 3300037068 Bacteria 1751
354 Ga0373925_0182167 3300037068 Bacteria 1663
355 Ga0373925_0463873 3300037068 Unclassified 1038
356 Ga0373925_0500799 3300037068 Bacteria 997
357 Ga0436364_1223108 3300037853 Bacteria 3679
358 Ga0395901_0367919 3300038443 Bacteria 1481
359 Ga0436365_1676454 3300039437 Unclassified 2576
360 Ga0436360_0330917 3300039438 Bacteria 2392
361 Ga0436361_1044138 3300039447 Bacteria 5868
362 Ga0436363_1667002 3300039450 Bacteria 1536
363 Ga0466963_0161058 3300044694 Bacteria 1562
364 Ga0453684_0106785 3300044712 Unclassified 3411
365 Ga0466957_0043673 3300044842 Bacteria 2715
366 Ga0466959_0125017 3300045049 Bacteria 1826
367 Ga0451576_0066990 3300045051 Unclassified 3737
368 Ga0495592_0000188 3300046454 Bacteria 54485
369 Ga0495592_0082174 3300046454 Bacteria 2329
370 Ga0495603_0018977 3300046455 Bacteria 4162
371 Ga0495629_0046228 3300046459 Bacteria 3053
372 Ga0495629_0092404 3300046459 Bacteria 2112
373 Ga0495629_0103854 3300046459 Bacteria 1982
374 Ga0495651_0012463 3300046462 Bacteria 6557
375 Ga0495651_0014205 3300046462 Bacteria 6155
376 Ga0495653_0000198 3300046463 Bacteria 49009
377 Ga0495653_0047651 3300046463 Bacteria 3314
378 Ga0495582_0058040 3300046473 Bacteria 2134
379 Ga0495582_0089684 3300046473 Bacteria 1714
380 Ga0495582_0091039 3300046473 Bacteria 1701
381 Ga0495605_0076281 3300046474 Bacteria 1575
382 Ga0495662_0000720 3300046476 Bacteria 15794
383 Ga0495662_0004951 3300046476 Bacteria 6665
384 Ga0495664_0000002 3300046477 Bacteria 625183
385 Ga0495664_0000375 3300046477 Bacteria 21707
386 Ga0495584_0000293 3300046491 Bacteria 35341
387 Ga0495584_0018615 3300046491 Bacteria 3530
388 Ga0495585_0138323 3300046492 Bacteria 1277
389 Ga0495608_0000009 3300046511 Bacteria 266614
390 Ga0495618_0000005 3300046514 Bacteria 230421
391 Ga0495618_0004650 3300046514 Bacteria 8399
392 Ga0495628_0000002 3300046516 Bacteria 589399
393 Ga0495628_0080850 3300046516 Bacteria 2525
394 Ga0495630_0000614 3300046517 Bacteria 25848
395 Ga0495630_0017955 3300046517 Bacteria 5190
396 Ga0495630_0036987 3300046517 Bacteria 3650
397 Ga0495644_0092159 3300046523 Bacteria 1144
398 Ga0495644_0155522 3300046523 Bacteria 876
399 Ga0495663_0041205 3300046525 Unclassified 1404
400 Ga0495666_0091424 3300046526 Bacteria 1436
401 Ga0495652_0000004 3300046529 Bacteria 588877
402 Ga0495652_0040209 3300046529 Bacteria 4041
403 Ga0495665_0107591 3300046531 Bacteria 1463
404 Ga0495640_0000005 3300046533 Bacteria 318271
405 Ga0495640_0006783 3300046533 Bacteria 9035
406 Ga0495640_0158241 3300046533 Bacteria 1453
407 Ga0495640_0159682 3300046533 Bacteria 1445
408 Ga0495586_0084897 3300046535 Bacteria 1743
409 Ga0495586_0177770 3300046535 Bacteria 1203
410 Ga0495587_0000007 3300046536 Bacteria 290788
411 Ga0495587_0196043 3300046536 Bacteria 1143
412 Ga0495609_0145750 3300046538 Bacteria 1009
413 Ga0495645_0000003 3300046543 Bacteria 570133
414 Ga0495645_0012230 3300046543 Bacteria 6044
415 Ga0495633_0059262 3300046558 Bacteria 1796
416 Ga0495633_0214064 3300046558 Bacteria 883
417 Ga0495667_0000002 3300046559 Bacteria 437535
418 Ga0495667_0060226 3300046559 Bacteria 2490
419 Ga0495667_0179533 3300046559 Unclassified 1359
420 Ga0495668_0166948 3300046616 Bacteria 1206
421 Ga0495634_0000129 3300046642 Bacteria 65082
422 Ga0495634_0094839 3300046642 Unclassified 1933
423 Ga0495634_0224304 3300046642 Bacteria 1159
424 Ga0495635_0000289 3300046663 Bacteria 32189
425 Ga0495635_0022667 3300046663 Bacteria 4377
426 Ga0495635_0024750 3300046663 Bacteria 4184
427 Ga0495657_0000781 3300046675 Bacteria 28299
428 Ga0495657_0015918 3300046675 Bacteria 5489
429 Ga0495599_0000001 3300046678 Bacteria 537563
430 Ga0495623_0000001 3300046679 Bacteria 313861
431 Ga0495623_0025557 3300046679 Bacteria 3804
432 Ga0495646_0000013 3300046680 Bacteria 159700
433 Ga0495646_0122495 3300046680 Bacteria 1470
434 Ga0495647_0030190 3300046681 Bacteria 2010
435 Ga0495658_0106054 3300046683 Bacteria 1684
436 Ga0495658_0114725 3300046683 Bacteria 1623
437 Ga0495658_0192531 3300046683 Bacteria 1268
438 Ga0495669_0135910 3300046684 Bacteria 1159
439 Ga0495613_0073747 3300046689 Bacteria 2486
440 Ga0495613_0183065 3300046689 Unclassified 1483
441 Ga0495624_0034192 3300046690 Bacteria 3289
442 Ga0495624_0068235 3300046690 Bacteria 2217
443 Ga0495670_0065940 3300046691 Bacteria 1826
444 Ga0495649_0058802 3300046694 Bacteria 2071
445 Ga0495600_0000233 3300046809 Bacteria 30755
446 Ga0495600_0414162 3300046809 Bacteria 837
447 Ga0495581_0014853 3300047315 Bacteria 4517
448 Ga0495581_0057301 3300047315 Bacteria 2249
449 Ga0495581_0061810 3300047315 Bacteria 2164
450 Ga0495581_0174679 3300047315 Bacteria 1256
451 Ga0495604_0000005 3300047317 Bacteria 424516
452 Ga0495604_0238484 3300047317 Bacteria 1245
453 Ga0495674_0000003 3300047319 Bacteria 562126
454 Ga0495674_0026624 3300047319 Bacteria 5291
455 Ga0495674_0138498 3300047319 Bacteria 2047
456 Ga0495674_0205843 3300047319 Bacteria 1631
457 Ga0495674_0234323 3300047319 Bacteria 1514
458 Ga0495676_0059847 3300047321 Bacteria 2988
459 Ga0495676_0144694 3300047321 Bacteria 1699
460 Ga0495680_0000002 3300047322 Bacteria 197533
461 Ga0495680_0292774 3300047322 Bacteria 1145
462 Ga0495675_0000437 3300047444 Bacteria 27820
463 Ga0495684_0000020 3300047471 Bacteria 148507
464 Ga0495684_0002950 3300047471 Bacteria 13397
465 Ga0495684_0025573 3300047471 Bacteria 4535
466 Ga0495593_0020549 3300047673 Bacteria 3697
467 Ga0495602_0000027 3300048088 Bacteria 145010
468 Ga0495602_0006017 3300048088 Bacteria 12738
469 Ga0495602_0114719 3300048088 Bacteria 2181
470 Ga0496100_0001551 3300048903 Bacteria 11289
471 Ga0496100_0058396 3300048903 Bacteria 2531
472 Ga0496101_0001012 3300048904 Bacteria 16558
473 Ga0496101_0033510 3300048904 Bacteria 3623
474 Ga0496101_0325923 3300048904 Bacteria 1205
475 Ga0496101_0391724 3300048904 Bacteria 1093
476 Ga0496102_0033538 3300048905 Bacteria 4614
477 Ga0496102_0062761 3300048905 Unclassified 3402
478 Ga0496102_0073679 3300048905 Bacteria 3138
479 Ga0496102_0094133 3300048905 Unclassified 2776
480 Ga0496102_0146468 3300048905 Bacteria 2217
481 Ga0496102_0173890 3300048905 Bacteria 2027
482 Ga0496102_0641566 3300048905 Bacteria 985
483 Ga0496103_0091513 3300048906 Bacteria 1919
484 Ga0496103_0363260 3300048906 Bacteria 931
485 Ga0496104_0000629 3300048907 Bacteria 30223
486 Ga0496104_0001130 3300048907 Bacteria 22846
487 Ga0496104_0001756 3300048907 Bacteria 18725
488 Ga0496104_0098229 3300048907 Bacteria 2803
489 Ga0496105_0001322 3300048908 Bacteria 17343
490 Ga0496105_0019711 3300048908 Bacteria 5441
491 Ga0496105_0040140 3300048908 Bacteria 3858
492 Ga0496105_0124346 3300048908 Bacteria 2126
493 Ga0496105_0192272 3300048908 Unclassified 1668
494 Ga0496105_0335131 3300048908 Bacteria 1210
495 Ga0496106_0014871 3300048909 Bacteria 5757
496 Ga0496106_0022634 3300048909 Bacteria 4670
497 Ga0496106_0077696 3300048909 Bacteria 2546
498 Ga0496106_0099112 3300048909 Bacteria 2259
499 Ga0496106_0297069 3300048909 Unclassified 1295
500 Ga0496106_0662152 3300048909 Bacteria 834
501 Ga0496107_0065946 3300048910 Bacteria 2624
502 Ga0496107_0244389 3300048910 Bacteria 1335
503 Ga0496108_0002891 3300048911 Bacteria 13786
504 Ga0496108_0009174 3300048911 Bacteria 8006
505 Ga0496108_0211421 3300048911 Bacteria 1684
506 Ga0496109_0002809 3300048912 Bacteria 14583
507 Ga0496109_0036314 3300048912 Bacteria 4447
508 Ga0496109_0145202 3300048912 Bacteria 2219
509 Ga0496109_0269106 3300048912 Unclassified 1605
510 Ga0496110_0024942 3300048913 Bacteria 5103
511 Ga0496110_0042460 3300048913 Bacteria 3969
512 Ga0496110_0131951 3300048913 Bacteria 2256
513 Ga0496110_0623954 3300048913 Bacteria 977
514 Ga0496111_0030271 3300048914 Unclassified 3849
515 Ga0496111_0096207 3300048914 Bacteria 2173
516 Ga0496111_0149255 3300048914 Bacteria 1734
517 Ga0496112_0009460 3300048915 Bacteria 8783
518 Ga0496112_0102058 3300048915 Bacteria 2838
519 Ga0496112_0154440 3300048915 Bacteria 2262
520 Ga0496112_0165948 3300048915 Bacteria 2174
521 Ga0496113_0072484 3300048916 Bacteria 2621
522 Ga0496113_0175849 3300048916 Bacteria 1696
523 Ga0496114_0032157 3300048917 Bacteria 4317
524 Ga0496114_0075244 3300048917 Unclassified 2844
525 Ga0496114_0088863 3300048917 Bacteria 2621
526 Ga0496115_0022900 3300048918 Bacteria 4846
527 Ga0496115_0025523 3300048918 Bacteria 4601
528 Ga0496115_0054644 3300048918 Bacteria 3207
529 Ga0496115_0072173 3300048918 Bacteria 2800
530 Ga0496115_0100877 3300048918 Bacteria 2366
531 Ga0496115_0293449 3300048918 Bacteria 1333
532 Ga0501036_0476081 3300049572 Bacteria 1040
533 Ga0501037_0420029 3300049573 Bacteria 915
534 Ga0501047_0140762 3300049581 Bacteria 2291
535 Ga0501048_0206598 3300049582 Bacteria 1393
536 Ga0501070_0050832 3300049586 Bacteria 3440
537 Ga0501072_0120885 3300049588 Bacteria 2087
538 Ga0501072_0251235 3300049588 Bacteria 1408
539 Ga0501073_0288328 3300049589 Bacteria 1133
540 Ga0501075_0023405 3300049591 Unclassified 4523
541 Ga0501075_0657910 3300049591 Bacteria 799
542 Ga0501077_0014216 3300049593 Bacteria 4998
543 Ga0501079_0283763 3300049741 Bacteria 1295
544 Ga0501079_0355756 3300049741 Bacteria 1147
545 Ga0501081_0003438 3300049743 Bacteria 10104
546 Ga0501044_0389579 3300049823 Bacteria 1307
547 nmdc:mga03683_40001_c1 3300050489 Unclassified 1921
548 nmdc:mga0yw44_918_c1 3300050492 Bacteria 11147
549 nmdc:mga06z11_309953_c1 3300050494 Bacteria 940
550 nmdc:mga06z11_38348_c1 3300050494 Bacteria 2379
551 nmdc:mga05p37_130171_c1 3300050507 Bacteria 1949
552 nmdc:mga05p37_137391_c1 3300050507 Bacteria 2996
553 nmdc:mga05p37_25897_c1 3300050507 Bacteria 7131
554 nmdc:mga05p37_64007_c1 3300050507 Bacteria 4525
555 nmdc:mga05p37_9175_c1 3300050507 Bacteria 11692
556 nmdc:mga09592_118300_c1 3300050508 Unclassified 2274
557 nmdc:mga09592_253335_c1 3300050508 Bacteria 1526
558 nmdc:mga0qj67_111_c1 3300050509 Bacteria 53806
559 nmdc:mga0qj67_29143_c1 3300050509 Bacteria 4287
560 nmdc:mga06r32_165598_c2 3300050510 Bacteria 1632
561 nmdc:mga06r32_70468_c1 3300050510 Bacteria 3381
562 nmdc:mga08y16_120737_c1 3300050511 Bacteria 2727
563 nmdc:mga08y16_15633_c1 3300050511 Bacteria 7982
564 nmdc:mga08y16_299076_c1 3300050511 Bacteria 1659
565 nmdc:mga08y16_36613_c1 3300050511 Bacteria 5153
566 nmdc:mga0n895_215308_c1 3300050512 Bacteria 1950
567 nmdc:mga0n895_512431_c1 3300050512 Bacteria 1208
568 nmdc:mga0rr50_440609_c1 3300050513 Bacteria 1103
569 nmdc:mga08x19_159289_c1 3300050514 Bacteria 1532
570 nmdc:mga08x19_80903_c1 3300050514 Bacteria 2133
571 nmdc:mga0a205_317162_c1 3300050515 Bacteria 1430
572 nmdc:mga0a205_31909_c1 3300050515 Bacteria 5049
573 nmdc:mga0a205_81197_c1 3300050515 Bacteria 3132
574 Ga0495601_0000010 3300053077 Bacteria 266222
575 Ga0495601_0008245 3300053077 Bacteria 6148
576 Ga0495601_0024234 3300053077 Bacteria 3737
577 Ga0495601_0121364 3300053077 Bacteria 1697
578 Ga0495612_0000002 3300053078 Bacteria 310466
579 Ga0495612_0000697 3300053078 Bacteria 13585
580 Ga0495612_0009258 3300053078 Bacteria 3996
581 Ga0495612_0168114 3300053078 Bacteria 959
582 Ga0495595_0000184 3300053084 Bacteria 25097
583 Ga0495595_0000714 3300053084 Bacteria 12676
584 Ga0495595_0063414 3300053084 Unclassified 1735
585 Ga0495619_0000002 3300053085 Bacteria 530226
586 Ga0495619_0009180 3300053085 Bacteria 6245
587 Ga0495619_0018329 3300053085 Bacteria 4441
588 Ga0495619_0055176 3300053085 Bacteria 2631
589 Ga0495619_0057164 3300053085 Unclassified 2588
590 Ga0495619_0061884 3300053085 Bacteria 2491
591 Ga0495619_0187824 3300053085 Bacteria 1430
592 Ga0495619_0274712 3300053085 Bacteria 1168
593 Ga0501084_0032380 3300054114 Unclassified 4373
594 Ga0501084_0056755 3300054114 Bacteria 3276
595 Ga0501082_0150963 3300060353 Bacteria 2018
596 Ga0501082_0262109 3300060353 Bacteria 1504
597 Ga0501082_0309010 3300060353 Bacteria 1377
598 Ga0501082_0325657 3300060353 Bacteria 1339
599 Ga0530510_0210498 3300061734 Bacteria 1445
600 Ga0466966_0254947
601 SwRhRL2b_contig_1831614
602 2214544920
603 ARcpr5oldR_c000395
604 ARSoilYngRDRAFT_c00032
605 ARcpr5yngRDRAFT_c000061
606 ARSoilOldRDRAFT_c000136
607 ARCol0oldRDRAFT_c00446
608 ARCol0yngRDRAFT_1000139
609 JGI24752J21851_1012071
610 JGI24743J22301_10007812
611 JGI24744J21845_10006076
612 JGI24034J26672_10009452
613 rootH1_10356764
614 Ga0065716_1001581
615 Ga0065704_10080762
616 Ga0065707_10121940
617 Ga0070676_10015980
618 Ga0070676_10044243
619 Ga0070683_100039525
620 Ga0070683_100503720
621 Ga0070690_100024154
622 Ga0070690_100036744
623 Ga0070690_100190943
624 Ga0070670_100178055
625 Ga0070666_10344930
626 Ga0070680_100036582
627 Ga0070680_100249408
628 Ga0070682_100187077
629 Ga0068868_100201031
630 Ga0070660_100135248
631 Ga0070689_100016595
632 Ga0070689_100136274
633 Ga0070687_100021169
634 Ga0070661_100503256
635 Ga0070692_10044090
636 Ga0070668_100137467
637 Ga0070668_100262438
638 Ga0070669_100163818
639 Ga0070675_100230920
640 Ga0070674_100099820
641 Ga0070673_100024556
642 Ga0070659_100037562
643 Ga0070659_100220380
644 Ga0070667_100297621
645 Ga0070709_10051784
646 Ga0070709_10228144
647 Ga0070701_10037485
648 Ga0070701_10083067
649 Ga0070711_100036661
650 Ga0070711_100196436
651 Ga0070700_100045009
652 Ga0070663_100191118
653 Ga0070678_100241562
654 Ga0070662_100055926
655 Ga0070662_100132786
656 Ga0070681_10000708
657 Ga0068867_100065507
658 Ga0068867_100110735
659 Ga0070685_10041462
660 Ga0070685_10062402
661 Ga0070685_10385623
662 Ga0070699_100012813
663 Ga0070699_100185807
664 Ga0070679_100206770
665 Ga0068853_100199266
666 Ga0070672_100407901
667 Ga0070686_100149468
668 Ga0070686_100347079
669 Ga0070686_100524080
670 Ga0070665_100549906
671 Ga0070704_100064974
672 Ga0070704_100101533
673 Ga0070704_100194567
674 Ga0070664_100148659
675 Ga0068857_100281175
676 Ga0068854_100390104
677 Ga0068856_100114199
678 Ga0070702_100457015
679 Ga0068859_100080058
680 Ga0068859_100295304
681 Ga0068859_100802394
682 Ga0068864_100084336
683 Ga0068851_10121712
684 Ga0068863_100156520
685 Ga0068863_100439796
686 Ga0068858_100036593
687 Ga0068858_100092607
688 Ga0068858_100123637
689 Ga0068860_100181946
690 Ga0068862_100074065
691 Ga0081455_10001860
692 Ga0081455_10010994
693 Ga0081455_10080462
694 Ga0081455_10187941
695 Ga0081455_10342494
696 Ga0081538_10005698
697 Ga0081538_10166423
698 Ga0081540_1000183
699 Ga0081540_1005670
700 Ga0081540_1009789
701 Ga0081540_1033395
702 Ga0081540_1120576
703 Ga0070717_10294861
704 Ga0075365_10011942
705 Ga0075365_10038703
706 Ga0075365_10104603
707 Ga0070715_10058674
708 Ga0070715_10109261
709 Ga0070712_100025865
710 Ga0070712_100203881
711 Ga0075362_10066258
712 Ga0075367_10055853
713 Ga0075367_10148416
714 Ga0097621_100059768
715 Ga0075428_100030815
716 Ga0075428_100051979
717 Ga0075430_100000311
718 Ga0075430_100128605
719 Ga0075430_100246339
720 Ga0075431_100045787
721 Ga0075431_100170064
722 Ga0075431_100207312
723 Ga0075431_100793293
724 Ga0075433_10117018
725 Ga0075433_10450788
726 Ga0075434_100005301
727 Ga0075434_100220232
728 Ga0075429_100070188
729 Ga0075429_100169660
730 Ga0075436_100064018
731 Ga0075436_100131530
732 Ga0097620_100080058
733 Ga0097620_100295304
734 Ga0097620_100802480
735 Ga0099794_10007525
736 Ga0099794_10084631
737 Ga0099795_10008849
738 Ga0105240_10118655
739 Ga0111539_10005693
740 Ga0111539_10609068
741 Ga0111539_11377508
742 Ga0105245_10074900
743 Ga0114129_10009721
744 Ga0114129_10024961
745 Ga0114129_10128924
746 Ga0114129_10191202
747 Ga0114129_10218131
748 Ga0114129_10357825
749 Ga0114129_10388389
750 Ga0105241_10321271
751 Ga0105242_10186229
752 Ga0105248_10097526
753 Ga0105248_10183124
754 Ga0105248_10456875
755 Ga0105237_10080387
756 Ga0105238_10327002
757 Ga0105249_10158485
758 Ga0105249_10537932
759 Ga0105246_10103964
760 Ga0157344_1000470
761 Ga0157323_1003505
762 Ga0157373_10238475
763 Ga0157370_10005113
764 Ga0157374_10567377
765 Ga0157378_10167721
766 Ga0163162_10166546
767 Ga0163162_10316386
768 Ga0163162_10510694
769 Ga0157372_10035808
770 Ga0157372_10296489
771 Ga0157372_10625198
772 Ga0157375_10148696
773 Ga0157375_10276789
774 Ga0163163_10039201
775 Ga0163163_10188340
776 Ga0157380_10221660
777 Ga0182008_10113814
778 Ga0157377_10061450
779 Ga0157376_10040052
780 Ga0157376_10097644
781 Ga0163161_10093783
782 Ga0207656_10017789
783 Ga0207682_10045090
784 Ga0207692_10315850
785 Ga0207710_10106633
786 Ga0207688_10022504
787 Ga0207680_10105409
788 Ga0207647_10014286
789 Ga0207685_10061019
790 Ga0207685_10067547
791 Ga0207699_10012929
792 Ga0207645_10019185
793 Ga0207643_10000872
794 Ga0207684_10158518
795 Ga0207707_10023677
796 Ga0207707_10179340
797 Ga0207693_10008359
798 Ga0207693_10038010
799 Ga0207693_10040307
800 Ga0207693_10077132
801 Ga0207663_10115023
802 Ga0207660_10004266
803 Ga0207662_10007580
804 Ga0207657_10023526
805 Ga0207652_10010306
806 Ga0207659_10291224
807 Ga0207687_10396859
808 Ga0207700_10142650
809 Ga0207644_10035189
810 Ga0207690_10242211
811 Ga0207706_10056684
812 Ga0207706_10272722
813 Ga0207686_10135763
814 Ga0207709_10320725
815 Ga0207670_10002139
816 Ga0207670_10189690
817 Ga0207670_10416597
818 Ga0207669_10020543
819 Ga0207669_10046523
820 Ga0207704_10092037
821 Ga0207665_10006295
822 Ga0207665_10157812
823 Ga0207691_10007735
824 Ga0207711_10003367
825 Ga0207711_10390130
826 Ga0207661_10346787
827 Ga0207679_10167690
828 Ga0207668_10028831
829 Ga0207658_10166521
830 Ga0207703_10210367
831 Ga0207703_10612983
832 Ga0207639_10049286
833 Ga0207678_10005238
834 Ga0207708_10005514
835 Ga0207708_10059087
836 Ga0207641_10284515
837 Ga0207648_10028821
838 Ga0207648_10117889
839 Ga0207676_10034428
840 Ga0207674_10058822
841 Ga0207675_100035978
842 Ga0207683_10051673
843 Ga0207698_10130895
844 Ga0209179_1008104
845 Ga0207428_10004567
846 Ga0207428_10173195
847 Ga0207428_10343874
848 Ga0265357_1000526
849 Ga0268266_10341305
850 Ga0268266_10623664
851 Ga0268265_10070804
852 Ga0268265_10280953
853 Ga0265337_1001529
854 Ga0265338_10010460
855 Ga0265770_1020447
856 Ga0265760_10029890
857 Ga0265330_10024010
858 Ga0265332_10001364
859 Ga0265325_10035404
860 Ga0265325_10058454
861 Ga0265340_10009578
862 Ga0265340_10143968
863 Ga0265339_10000133
864 Ga0265331_10010346
865 Ga0265316_10191371
866 Ga0265313_10000491
867 Ga0265314_10010268
868 Ga0265342_10000328
869 Ga0316578_10059481
870 Ga0373930_0000042
871 Ga0373948_0000129
872 Ga0373950_0001254
873 Ga0373938_0000030
874 Ga0373938_0021761
875 Ga0373926_0118501
876 Ga0373928_0000123
877 Ga0373928_0021523
878 Ga0373929_0000703
879 Ga0373934_0017783
880 Ga0373934_0039593
881 Ga0373940_0000022
882 Ga0373944_0006259
883 Ga0373949_0000438
884 Ga0373951_0004506
885 Ga0373952_0000180
886 Ga0373923_0032815
887 Ga0373923_0121884
888 Ga0373932_0000683
889 Ga0373932_0014144
890 Ga0373936_0001692
891 Ga0373939_0000329
892 Ga0373941_0000049
893 Ga0373945_0005566
894 Ga0373945_0008967
895 Ga0373953_0161825
896 Ga0373954_0013000
897 Ga0373954_0065137
898 Ga0373954_0089043
899 Ga0373954_0094761
900 Ga0373956_0003856
901 Ga0373956_0149576
902 Ga0373957_0017204
903 Ga0373960_0000240
904 Ga0373943_0005937
905 Ga0373943_0074089
906 Ga0373943_0094098
907 Ga0373946_0010660
908 Ga0373946_0040899
909 Ga0373955_0357529
910 Ga0373961_0001448
911 Ga0373962_0000637
912 Ga0316574_0000202
913 Ga0373924_0002618
914 Ga0373924_0003107
915 Ga0373924_0038587
916 Ga0373931_0002197
917 Ga0373931_0014415
918 Ga0373931_0161493
919 Ga0373935_0000337
920 Ga0373935_0025186
921 Ga0373935_0043417
922 Ga0373935_0045529
923 Ga0373935_0318938
924 Ga0373927_0010461
925 Ga0373927_0017168
926 Ga0373927_0017198
927 Ga0373927_0048991
928 Ga0373927_0122483
929 Ga0373927_0205603
930 Ga0373927_0229033
931 Ga0373933_0001345
932 Ga0373933_0008931
933 Ga0373933_0124154
934 Ga0373947_0009229
935 Ga0373947_0020264
936 Ga0373947_0074759
937 Ga0373947_0101560
938 Ga0373947_0138367
939 Ga0373947_0163332
940 Ga0373947_0181537
941 Ga0373937_0000597
942 Ga0373937_0000934
943 Ga0373937_0008587
944 Ga0373937_0031848
945 Ga0373937_0229462
946 Ga0316584_0108806
947 Ga0373925_0000741
948 Ga0373925_0019319
949 Ga0373925_0040893
950 Ga0373925_0099428
951 Ga0373925_0110476
952 Ga0373925_0164119
953 Ga0373925_0182167
954 Ga0373925_0463873
955 Ga0373925_0500799
956 Ga0436364_1223108
957 Ga0395901_0367919
958 Ga0436365_1676454
959 Ga0436360_0330917
960 Ga0436361_1044138
961 Ga0436363_1667002
962 Ga0466963_0161058
963 Ga0453684_0106785
964 Ga0466957_0043673
965 Ga0466959_0125017
966 Ga0451576_0066990
967 Ga0495592_0000188
968 Ga0495592_0082174
969 Ga0495603_0018977
970 Ga0495629_0046228
971 Ga0495629_0092404
972 Ga0495629_0103854
973 Ga0495651_0012463
974 Ga0495651_0014205
975 Ga0495653_0000198
976 Ga0495653_0047651
977 Ga0495582_0058040
978 Ga0495582_0089684
979 Ga0495582_0091039
980 Ga0495605_0076281
981 Ga0495662_0000720
982 Ga0495662_0004951
983 Ga0495664_0000002
984 Ga0495664_0000375
985 Ga0495584_0000293
986 Ga0495584_0018615
987 Ga0495585_0138323
988 Ga0495608_0000009
989 Ga0495618_0000005
990 Ga0495618_0004650
991 Ga0495628_0000002
992 Ga0495628_0080850
993 Ga0495630_0000614
994 Ga0495630_0017955
995 Ga0495630_0036987
996 Ga0495644_0092159
997 Ga0495644_0155522
998 Ga0495663_0041205
999 Ga0495666_0091424
1000 Ga0495652_0000004
1001 Ga0495652_0040209
1002 Ga0495665_0107591
1003 Ga0495640_0000005
1004 Ga0495640_0006783
1005 Ga0495640_0158241
1006 Ga0495640_0159682
1007 Ga0495586_0084897
1008 Ga0495586_0177770
1009 Ga0495587_0000007
1010 Ga0495587_0196043
1011 Ga0495609_0145750
1012 Ga0495645_0000003
1013 Ga0495645_0012230
1014 Ga0495633_0059262
1015 Ga0495633_0214064
1016 Ga0495667_0000002
1017 Ga0495667_0060226
1018 Ga0495667_0179533
1019 Ga0495668_0166948
1020 Ga0495634_0000129
1021 Ga0495634_0094839
1022 Ga0495634_0224304
1023 Ga0495635_0000289
1024 Ga0495635_0022667
1025 Ga0495635_0024750
1026 Ga0495657_0000781
1027 Ga0495657_0015918
1028 Ga0495599_0000001
1029 Ga0495623_0000001
1030 Ga0495623_0025557
1031 Ga0495646_0000013
1032 Ga0495646_0122495
1033 Ga0495647_0030190
1034 Ga0495658_0106054
1035 Ga0495658_0114725
1036 Ga0495658_0192531
1037 Ga0495669_0135910
1038 Ga0495613_0073747
1039 Ga0495613_0183065
1040 Ga0495624_0034192
1041 Ga0495624_0068235
1042 Ga0495670_0065940
1043 Ga0495649_0058802
1044 Ga0495600_0000233
1045 Ga0495600_0414162
1046 Ga0495581_0014853
1047 Ga0495581_0057301
1048 Ga0495581_0061810
1049 Ga0495581_0174679
1050 Ga0495604_0000005
1051 Ga0495604_0238484
1052 Ga0495674_0000003
1053 Ga0495674_0026624
1054 Ga0495674_0138498
1055 Ga0495674_0205843
1056 Ga0495674_0234323
1057 Ga0495676_0059847
1058 Ga0495676_0144694
1059 Ga0495680_0000002
1060 Ga0495680_0292774
1061 Ga0495675_0000437
1062 Ga0495684_0000020
1063 Ga0495684_0002950
1064 Ga0495684_0025573
1065 Ga0495593_0020549
1066 Ga0495602_0000027
1067 Ga0495602_0006017
1068 Ga0495602_0114719
1069 Ga0496100_0001551
1070 Ga0496100_0058396
1071 Ga0496101_0001012
1072 Ga0496101_0033510
1073 Ga0496101_0325923
1074 Ga0496101_0391724
1075 Ga0496102_0033538
1076 Ga0496102_0062761
1077 Ga0496102_0073679
1078 Ga0496102_0094133
1079 Ga0496102_0146468
1080 Ga0496102_0173890
1081 Ga0496102_0641566
1082 Ga0496103_0091513
1083 Ga0496103_0363260
1084 Ga0496104_0000629
1085 Ga0496104_0001130
1086 Ga0496104_0001756
1087 Ga0496104_0098229
1088 Ga0496105_0001322
1089 Ga0496105_0019711
1090 Ga0496105_0040140
1091 Ga0496105_0124346
1092 Ga0496105_0192272
1093 Ga0496105_0335131
1094 Ga0496106_0014871
1095 Ga0496106_0022634
1096 Ga0496106_0077696
1097 Ga0496106_0099112
1098 Ga0496106_0297069
1099 Ga0496106_0662152
1100 Ga0496107_0065946
1101 Ga0496107_0244389
1102 Ga0496108_0002891
1103 Ga0496108_0009174
1104 Ga0496108_0211421
1105 Ga0496109_0002809
1106 Ga0496109_0036314
1107 Ga0496109_0145202
1108 Ga0496109_0269106
1109 Ga0496110_0024942
1110 Ga0496110_0042460
1111 Ga0496110_0131951
1112 Ga0496110_0623954
1113 Ga0496111_0030271
1114 Ga0496111_0096207
1115 Ga0496111_0149255
1116 Ga0496112_0009460
1117 Ga0496112_0102058
1118 Ga0496112_0154440
1119 Ga0496112_0165948
1120 Ga0496113_0072484
1121 Ga0496113_0175849
1122 Ga0496114_0032157
1123 Ga0496114_0075244
1124 Ga0496114_0088863
1125 Ga0496115_0022900
1126 Ga0496115_0025523
1127 Ga0496115_0054644
1128 Ga0496115_0072173
1129 Ga0496115_0100877
1130 Ga0496115_0293449
1131 Ga0501036_0476081
1132 Ga0501037_0420029
1133 Ga0501047_0140762
1134 Ga0501048_0206598
1135 Ga0501070_0050832
1136 Ga0501072_0120885
1137 Ga0501072_0251235
1138 Ga0501073_0288328
1139 Ga0501075_0023405
1140 Ga0501075_0657910
1141 Ga0501077_0014216
1142 Ga0501079_0283763
1143 Ga0501079_0355756
1144 Ga0501081_0003438
1145 Ga0501044_0389579
1146 nmdc:mga03683_40001_c1
1147 nmdc:mga0yw44_918_c1
1148 nmdc:mga06z11_309953_c1
1149 nmdc:mga06z11_38348_c1
1150 nmdc:mga05p37_130171_c1
1151 nmdc:mga05p37_137391_c1
1152 nmdc:mga05p37_25897_c1
1153 nmdc:mga05p37_64007_c1
1154 nmdc:mga05p37_9175_c1
1155 nmdc:mga09592_118300_c1
1156 nmdc:mga09592_253335_c1
1157 nmdc:mga0qj67_111_c1
1158 nmdc:mga0qj67_29143_c1
1159 nmdc:mga06r32_165598_c2
1160 nmdc:mga06r32_70468_c1
1161 nmdc:mga08y16_120737_c1
1162 nmdc:mga08y16_15633_c1
1163 nmdc:mga08y16_299076_c1
1164 nmdc:mga08y16_36613_c1
1165 nmdc:mga0n895_215308_c1
1166 nmdc:mga0n895_512431_c1
1167 nmdc:mga0rr50_440609_c1
1168 nmdc:mga08x19_159289_c1
1169 nmdc:mga08x19_80903_c1
1170 nmdc:mga0a205_317162_c1
1171 nmdc:mga0a205_31909_c1
1172 nmdc:mga0a205_81197_c1
1173 Ga0495601_0000010
1174 Ga0495601_0008245
1175 Ga0495601_0024234
1176 Ga0495601_0121364
1177 Ga0495612_0000002
1178 Ga0495612_0000697
1179 Ga0495612_0009258
1180 Ga0495612_0168114
1181 Ga0495595_0000184
1182 Ga0495595_0000714
1183 Ga0495595_0063414
1184 Ga0495619_0000002
1185 Ga0495619_0009180
1186 Ga0495619_0018329
1187 Ga0495619_0055176
1188 Ga0495619_0057164
1189 Ga0495619_0061884
1190 Ga0495619_0187824
1191 Ga0495619_0274712
1192 Ga0501084_0032380
1193 Ga0501084_0056755
1194 Ga0501082_0150963
1195 Ga0501082_0262109
1196 Ga0501082_0309010
1197 Ga0501082_0325657
1198 Ga0530510_0210498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13247

Fer4_11

4Fe-4S dicluster domain

102

200

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.9583 1 277
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.9549 1 277
2vpw-assembly1.cif.gz_F polysulfide reductase with bound menaquinone 0.8773 1 188
4zjh-assembly1.cif.gz_A crystal structure of native alpha-2-macroglobulin from escherichia coli spanning domains nie-mg1. 0.8669 210 262
5ch7-assembly1.cif.gz_B crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps 0.8434 2 186
ID Description Score Start End Superfamily
1vldX02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9662 71 127 3.30.70.20
1vldX02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9502 71 127 3.30.70.20
1ti2D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9442 1 188 3.30.70.20
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9433 189 277 2.60.40.10
1ti2D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9374 1 188 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A244DU35-F1-model_v4 deleted 0.9905 194 277
AF-A0A7C7BRX5-F1-model_v4 Oxidoreductase 0.9853 1 277 GO:0051539
AF-A0A524HNG6-F1-model_v4 Oxidoreductase 0.9851 1 187 GO:0051539
AF-A0A7C7Y7J7-F1-model_v4 Oxidoreductase 0.985 1 277 GO:0051539
AF-A0A2S6TBT0-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9848 24 277 GO:0051539

Map