F467940

General Info

Members Datasets Scaffolds Average Seq Length
600 389 1200 261

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10160409|Ga0065704_101604092
Length 298
Sequence MTSGLTPNTAFHPVWPIKRRVFALNPYHCSRVRDKPMNNRPTVLITGASTGIGAVYAERFAQRGHDLVLVARDHVRLQTLATKLRSEHSVAIDVLQADLTQLSDLVKVEARLRDDASIGILVNNAGAAQSGTFIEQSTDSVAHLVALNTTALVRLASAVAPRLAKAGNGAIINIGSVVGLAPELGMSVYGATKAFVLFLSQGLSLELSPQGVYVQAVLPAATRTEIWDRAGIDINTLNEIMEVGDLVDAALVGFDRREPVTIPPLQEAERWDVLQTARQGLLSQLKQSVVAQRYQTKA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
50 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
85 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
98 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
99 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
100 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
101 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
102 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
103 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
104 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
105 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
106 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
107 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
108 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
109 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
110 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
111 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
112 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
113 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
114 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
115 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
116 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
117 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
118 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
119 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
122 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
123 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
204 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
205 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
216 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
217 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
218 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
219 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
220 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
221 2511231004 Pseudomonas sp. GM102 Isolate Nodule
222 2511231010 Pseudomonas sp. GM25 Isolate Nodule
223 2511231016 Pseudomonas sp. GM50 Isolate Nodule
224 2511231018 Pseudomonas sp. GM60 Isolate Nodule
225 2511231022 Pseudomonas sp. GM79 Isolate Nodule
226 2511231023 Pseudomonas sp. GM80 Isolate Nodule
227 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
228 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
229 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
230 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
231 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
232 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
233 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
234 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
235 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
236 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
237 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
238 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
239 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
240 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
241 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
242 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
243 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
244 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
245 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
246 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
247 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
248 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
249 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
250 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
251 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
252 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
253 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
254 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
255 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
256 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
257 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
258 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
259 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
260 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
261 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
262 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
263 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
264 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
265 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
266 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
267 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
268 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
269 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
270 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
271 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
272 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
273 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
274 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
275 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
276 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
277 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
278 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
279 2643221610 Ensifer sp. Root74 Isolate Unclassified
280 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
281 2643221675 Ensifer sp. Root1298 Isolate Unclassified
282 2643221680 Ensifer sp. Root1312 Isolate Unclassified
283 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
284 2643221726 Ensifer sp. Root954 Isolate Unclassified
285 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
286 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
287 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
288 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
289 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
290 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
291 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
292 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
293 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
294 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
295 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
296 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
297 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
298 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
299 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
300 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
301 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
302 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
303 2773857673 Pseudomonas sp. 443 Isolate Unclassified
304 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
305 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
306 2784132063 Pseudomonas sp. 424 Isolate Unclassified
307 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
308 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
309 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
310 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
311 2818991467 Bosea vestrisii 3192 Isolate Unclassified
312 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
313 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
314 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
315 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
316 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
317 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
318 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
319 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
320 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
321 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
322 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
323 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
324 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
325 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
326 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
327 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
328 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
329 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
330 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
331 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
332 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
333 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
334 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
335 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
336 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
337 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
338 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
339 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
340 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
341 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
342 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
343 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
344 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
345 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
346 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
347 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
348 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
349 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
350 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
351 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
352 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
353 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
354 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
355 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
356 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
357 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
358 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
359 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
360 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
361 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
362 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
363 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
364 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
365 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
366 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
367 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
368 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
369 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
370 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
371 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
372 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
373 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
374 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
375 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
376 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
377 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
378 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
379 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
380 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
381 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
382 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
383 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
384 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
385 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
386 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
387 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
388 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
389 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.67
Metatranscriptomes 0
Isolates 29.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 5.83
Rhizoplane 7.5
Rhizosphere 56.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10160409 3300005289 Bacteria 1347
2 SwRhRL2b_contig_1366508 2162886007 Bacteria 5332
3 JGI25162J39368_1000004 3300002737 Bacteria 441040
4 JGI25164J39214_1000026 3300002772 Bacteria 156863
5 JGI25165J46597_1000011 3300003214 Bacteria 441040
6 JGI25153J46596_10036842 3300003215 Bacteria 1562
7 Ga0055539_1000036 3300003752 Bacteria 216576
8 Ga0055533_1000046 3300003756 Bacteria 216576
9 Ga0055533_1000353 3300003756 Bacteria 19714
10 Ga0055532_1000032 3300003758 Bacteria 216568
11 Ga0055525_1000217 3300003759 Bacteria 62978
12 Ga0055525_1002000 3300003759 Bacteria 2512
13 Ga0055535_1005166 3300003761 Bacteria 2942
14 Ga0055524_1004630 3300003775 Bacteria 6312
15 Ga0055524_1008145 3300003775 Bacteria 4379
16 Ga0055536_1000013 3300003781 Bacteria 240693
17 Ga0055536_1000032 3300003781 Bacteria 150527
18 Ga0055536_1000277 3300003781 Bacteria 39159
19 Ga0055528_1000018 3300003790 Bacteria 155302
20 Ga0055530_10000004 3300003791 Bacteria 231465
21 Ga0055530_10000029 3300003791 Bacteria 127049
22 Ga0055530_10000062 3300003791 Bacteria 94942
23 Ga0055530_10000648 3300003791 Bacteria 29930
24 Ga0055540_1000008 3300003792 Bacteria 309635
25 Ga0055540_1000017 3300003792 Bacteria 231465
26 Ga0055540_1000166 3300003792 Bacteria 65613
27 Ga0055531_10000242 3300003794 Bacteria 59638
28 Ga0055541_1000024 3300003841 Bacteria 216576
29 Ga0065714_10002302 3300005288 Bacteria 45300
30 Ga0065714_10008929 3300005288 Bacteria 4155
31 Ga0065714_10072254 3300005288 Bacteria 3402
32 Ga0065714_10082726 3300005288 Bacteria 2290
33 Ga0065704_10038423 3300005289 Bacteria 1188
34 Ga0065704_10070262 3300005289 Bacteria 45316
35 Ga0065704_10111062 3300005289 Bacteria 1965
36 Ga0070670_100000034 3300005331 Bacteria 158067
37 Ga0070670_100000381 3300005331 Bacteria 36865
38 Ga0070670_100002591 3300005331 Bacteria 14942
39 Ga0070668_100125963 3300005347 Bacteria 2052
40 Ga0070669_100000259 3300005353 Bacteria 43326
41 Ga0070667_100534870 3300005367 Bacteria 1076
42 Ga0070662_100002140 3300005457 Bacteria 12105
43 Ga0068853_100074172 3300005539 Bacteria 2968
44 Ga0068851_10007430 3300005834 Bacteria 5031
45 Ga0075364_10097464 3300006051 Bacteria 1956
46 Ga0075364_10230563 3300006051 Bacteria 1257
47 Ga0075432_10000821 3300006058 Bacteria 9721
48 Ga0075432_10005619 3300006058 Bacteria 4271
49 Ga0075369_10094846 3300006186 Bacteria 1334
50 Ga0105251_10000207 3300009011 Bacteria 59294
51 Ga0105251_10008072 3300009011 Bacteria 6377
52 Ga0105251_10011506 3300009011 Bacteria 5052
53 Ga0105244_10018340 3300009036 Bacteria 3928
54 Ga0105244_10034292 3300009036 Bacteria 2673
55 Ga0105244_10053034 3300009036 Bacteria 2062
56 Ga0105250_10000207 3300009092 Bacteria 49366
57 Ga0105250_10000353 3300009092 Bacteria 35144
58 Ga0105250_10001427 3300009092 Bacteria 12904
59 Ga0105250_10017372 3300009092 Bacteria 2926
60 Ga0105243_10000170 3300009148 Bacteria 74646
61 Ga0105243_10002467 3300009148 Bacteria 15446
62 Ga0105243_10080694 3300009148 Bacteria 2654
63 Ga0105248_10252084 3300009177 Bacteria 1987
64 Ga0105237_10208062 3300009545 Bacteria 1957
65 Ga0105249_10569842 3300009553 Bacteria 1185
66 Ga0157345_1000001 3300012498 Bacteria 152919
67 Ga0157373_10002166 3300013100 Bacteria 14871
68 Ga0157373_10015520 3300013100 Bacteria 5569
69 Ga0157373_10088366 3300013100 Bacteria 2183
70 Ga0157371_10002985 3300013102 Bacteria 15712
71 Ga0157371_10011312 3300013102 Bacteria 6887
72 Ga0157370_10056689 3300013104 Bacteria 3729
73 Ga0157369_10011709 3300013105 Bacteria 9958
74 Ga0157369_10206262 3300013105 Bacteria 2061
75 Ga0163162_10441039 3300013306 Bacteria 1434
76 Ga0157372_10000821 3300013307 Bacteria 33625
77 Ga0182008_10000429 3300014497 Bacteria 32349
78 Ga0182008_10004315 3300014497 Bacteria 8325
79 Ga0182008_10005140 3300014497 Bacteria 7507
80 Ga0182008_10007005 3300014497 Bacteria 6250
81 Ga0182006_1000677 3300015261 Bacteria 23894
82 Ga0182006_1001013 3300015261 Bacteria 18374
83 Ga0182006_1006763 3300015261 Bacteria 5296
84 Ga0182007_10000766 3300015262 Bacteria 18016
85 Ga0182007_10001255 3300015262 Bacteria 13789
86 Ga0182005_1002698 3300015265 Bacteria 6225
87 Ga0182005_1005588 3300015265 Bacteria 3916
88 Ga0163161_10011334 3300017792 Bacteria 6180
89 Ga0163161_10022604 3300017792 Bacteria 4429
90 Ga0163161_10030055 3300017792 Bacteria 3864
91 Ga0163161_10031082 3300017792 Bacteria 3803
92 Ga0209435_101329 3300025206 Bacteria 3210
93 Ga0209760_100105 3300025207 Bacteria 64565
94 Ga0209784_100017 3300025224 Bacteria 472003
95 Ga0209566_100014 3300025225 Bacteria 472003
96 Ga0209674_100028 3300025226 Bacteria 472003
97 Ga0209147_100038 3300025229 Bacteria 314497
98 Ga0209563_100032 3300025230 Bacteria 472003
99 Ga0207427_100003 3300025231 Bacteria 1035004
100 Ga0209437_100002 3300025233 Bacteria 1574801
101 Ga0209258_100197 3300025242 Bacteria 124028
102 Ga0209646_1000171 3300025246 Bacteria 84951
103 Ga0209677_100018 3300025253 Bacteria 472003
104 Ga0209759_1021150 3300025256 Bacteria 1490
105 Ga0209233_1000004 3300025261 Bacteria 1574798
106 Ga0209673_1000055 3300025273 Bacteria 272768
107 Ga0209675_1002987 3300025291 Bacteria 8330
108 Ga0209676_1000002 3300025292 Bacteria 1732948
109 Ga0209676_1000003 3300025292 Bacteria 1454178
110 Ga0209676_1000120 3300025292 Bacteria 200565
111 Ga0209676_1001065 3300025292 Bacteria 31352
112 Ga0209564_1025815 3300025295 Bacteria 1963
113 Ga0209564_1030508 3300025295 Bacteria 1669
114 Ga0209050_1000004 3300025298 Bacteria 1600040
115 Ga0209050_1000006 3300025298 Bacteria 1359702
116 Ga0209050_1000037 3300025298 Bacteria 415612
117 Ga0209256_1000147 3300025299 Bacteria 149002
118 Ga0209256_1000401 3300025299 Bacteria 68618
119 Ga0209051_1000001 3300025303 Bacteria 1732974
120 Ga0209051_1000040 3300025303 Bacteria 315055
121 Ga0209051_1000052 3300025303 Bacteria 283346
122 Ga0209257_1000029 3300025304 Bacteria 695617
123 Ga0209257_1006677 3300025304 Bacteria 7308
124 Ga0207656_10000034 3300025321 Bacteria 66750
125 Ga0207696_1000002 3300025711 Bacteria 1098043
126 Ga0207696_1000108 3300025711 Bacteria 157445
127 Ga0207696_1002028 3300025711 Bacteria 10253
128 Ga0207696_1003553 3300025711 Bacteria 7044
129 Ga0207696_1054692 3300025711 Bacteria 1134
130 Ga0207655_1000141 3300025728 Bacteria 138956
131 Ga0207655_1000520 3300025728 Bacteria 49037
132 Ga0207655_1002113 3300025728 Bacteria 16620
133 Ga0207655_1024127 3300025728 Bacteria 2990
134 Ga0207655_1097271 3300025728 Bacteria 1022
135 Ga0207713_1000122 3300025735 Bacteria 122196
136 Ga0207713_1001298 3300025735 Bacteria 20557
137 Ga0207713_1007845 3300025735 Bacteria 6224
138 Ga0207713_1008251 3300025735 Bacteria 6024
139 Ga0207681_10000215 3300025923 Bacteria 45747
140 Ga0207650_10000066 3300025925 Bacteria 140329
141 Ga0207650_10000272 3300025925 Bacteria 54462
142 Ga0207650_10003085 3300025925 Bacteria 11473
143 Ga0207706_10007035 3300025933 Bacteria 10402
144 Ga0207709_10000004 3300025935 Bacteria 825156
145 Ga0207709_10004673 3300025935 Bacteria 7877
146 Ga0207711_10221461 3300025941 Bacteria 1731
147 Ga0209281_1002332 3300027111 Bacteria 7885
148 Ga0209281_1002401 3300027111 Bacteria 7608
149 Ga0209371_1025973 3300027312 Bacteria 1339
150 Ga0207428_10023325 3300027907 Bacteria 5205
151 Ga0307511_10017686 3300030521 Bacteria 6833
152 Ga0316178_1157838 3300030735 Bacteria 5384
153 Ga0316181_1238654 3300030744 Bacteria 4692
154 Ga0307408_100000292 3300031548 Bacteria 48808
155 Ga0307408_100001576 3300031548 Bacteria 16846
156 Ga0307408_100002489 3300031548 Bacteria 12897
157 Ga0307408_100031974 3300031548 Bacteria 3667
158 Ga0307405_10000137 3300031731 Bacteria 28468
159 Ga0307405_10008309 3300031731 Bacteria 5251
160 Ga0307413_10120551 3300031824 Bacteria 1776
161 Ga0307406_10064937 3300031901 Bacteria 2370
162 Ga0307412_10002134 3300031911 Bacteria 10967
163 Ga0307412_10121990 3300031911 Bacteria 1878
164 Ga0307409_100017968 3300031995 Bacteria 4734
165 Ga0307414_10292588 3300032004 Bacteria 1374
166 Ga0307411_10020132 3300032005 Bacteria 3872
167 Ga0307411_10024161 3300032005 Bacteria 3617
168 Ga0373927_0000706 3300035695 Bacteria 25593
169 Ga0373925_0000597 3300037068 Bacteria 34700
170 Ga0395905_0064982 3300037471 Bacteria 3415
171 Ga0439438_000979 3300041405 Bacteria 12767
172 Ga0439438_001358 3300041405 Bacteria 10809
173 Ga0439447_000025 3300041407 Bacteria 50859
174 Ga0439466_0003466 3300041411 Bacteria 6113
175 Ga0439466_0005163 3300041411 Bacteria 5002
176 Ga0439466_0011161 3300041411 Bacteria 3326
177 Ga0439465_0002423 3300041413 Bacteria 6110
178 Ga0439431_0000048 3300041997 Bacteria 17878
179 Ga0439432_000667 3300042006 Bacteria 12828
180 Ga0439432_001831 3300042006 Bacteria 7983
181 Ga0439432_003642 3300042006 Bacteria 5694
182 Ga0439432_011894 3300042006 Bacteria 2990
183 Ga0439451_000431 3300042009 Bacteria 8193
184 Ga0439451_002651 3300042009 Bacteria 3634
185 Ga0439452_000024 3300042010 Bacteria 230396
186 Ga0439452_001785 3300042010 Bacteria 8384
187 Ga0439452_004120 3300042010 Bacteria 4939
188 Ga0439452_008576 3300042010 Bacteria 3066
189 Ga0439452_032584 3300042010 Bacteria 1271
190 Ga0439456_022675 3300042013 Bacteria 1330
191 Ga0439463_002790 3300042016 Bacteria 4430
192 Ga0439463_008411 3300042016 Bacteria 2544
193 Ga0450911_000030 3300042115 Bacteria 75536
194 Ga0450911_005553 3300042115 Bacteria 1943
195 Ga0450919_000226 3300042121 Bacteria 6294
196 Ga0450922_001115 3300042124 Bacteria 2665
197 Ga0450890_000296 3300042127 Bacteria 7251
198 Ga0450897_003222 3300042128 Bacteria 1294
199 Ga0450898_001443 3300042134 Bacteria 3135
200 Ga0450902_016428 3300042137 Bacteria 1206
201 Ga0450903_002701 3300042138 Bacteria 3127
202 Ga0450903_027509 3300042138 Bacteria 865
203 Ga0450904_001386 3300042139 Bacteria 3462
204 Ga0450905_006486 3300042142 Bacteria 1584
205 Ga0450906_000016 3300042145 Bacteria 32476
206 Ga0450906_004234 3300042145 Bacteria 3019
207 Ga0450907_000039 3300042146 Bacteria 57175
208 Ga0450907_007425 3300042146 Bacteria 1829
209 Ga0450910_000003 3300042147 Bacteria 81243
210 Ga0439446_0000458 3300042156 Bacteria 8062
211 Ga0450908_000492 3300042184 Bacteria 7594
212 Ga0450909_006164 3300042185 Bacteria 1729
213 Ga0439434_0023716 3300042435 Bacteria 1848
214 Ga0439460_0005851 3300042461 Bacteria 3032
215 Ga0450901_000416 3300042533 Bacteria 5137
216 Ga0495617_006028 3300046452 Bacteria 4274
217 Ga0495617_013438 3300046452 Bacteria 2787
218 Ga0495617_029959 3300046452 Bacteria 1829
219 Ga0495627_000538 3300046453 Bacteria 31227
220 Ga0495627_032067 3300046453 Bacteria 1655
221 Ga0495591_000139 3300046458 Bacteria 78636
222 Ga0495591_000277 3300046458 Bacteria 47800
223 Ga0495591_005842 3300046458 Bacteria 5593
224 Ga0495629_0006452 3300046459 Bacteria 8693
225 Ga0495638_0079148 3300046460 Bacteria 1999
226 Ga0495638_0152233 3300046460 Bacteria 1341
227 Ga0495653_0017374 3300046463 Bacteria 5851
228 Ga0495653_0027898 3300046463 Bacteria 4518
229 Ga0495653_0328099 3300046463 Bacteria 990
230 Ga0495650_0028800 3300046471 Bacteria 2541
231 Ga0495650_0033219 3300046471 Bacteria 2298
232 Ga0495650_0042051 3300046471 Bacteria 1949
233 Ga0495582_0008582 3300046473 Bacteria 5634
234 Ga0495605_0007746 3300046474 Bacteria 6086
235 Ga0495605_0015413 3300046474 Bacteria 4161
236 Ga0495605_0030007 3300046474 Bacteria 2792
237 Ga0495605_0057570 3300046474 Bacteria 1870
238 Ga0495639_0000066 3300046475 Bacteria 48162
239 Ga0495584_0017052 3300046491 Bacteria 3702
240 Ga0495584_0022096 3300046491 Bacteria 3228
241 Ga0495584_0040998 3300046491 Bacteria 2337
242 Ga0495585_0020167 3300046492 Bacteria 3835
243 Ga0495585_0032199 3300046492 Bacteria 2970
244 Ga0495585_0056094 3300046492 Bacteria 2176
245 Ga0495594_0015269 3300046499 Bacteria 4032
246 Ga0495607_0000540 3300046501 Bacteria 37020
247 Ga0495607_0003561 3300046501 Bacteria 11849
248 Ga0495607_0011933 3300046501 Bacteria 5756
249 Ga0495607_0021884 3300046501 Bacteria 4021
250 Ga0495607_0047329 3300046501 Bacteria 2520
251 Ga0495606_0003459 3300046507 Bacteria 16749
252 Ga0495606_0015212 3300046507 Bacteria 5943
253 Ga0495616_0000101 3300046513 Bacteria 73493
254 Ga0495616_0000663 3300046513 Bacteria 25582
255 Ga0495616_0014457 3300046513 Bacteria 4417
256 Ga0495620_0003915 3300046515 Bacteria 8484
257 Ga0495628_0031807 3300046516 Bacteria 4265
258 Ga0495630_0000759 3300046517 Bacteria 22642
259 Ga0495630_0024105 3300046517 Bacteria 4500
260 Ga0495631_0000013 3300046518 Bacteria 109794
261 Ga0495632_0015974 3300046519 Bacteria 4189
262 Ga0495637_0005411 3300046520 Bacteria 6512
263 Ga0495637_0006865 3300046520 Bacteria 5689
264 Ga0495637_0024369 3300046520 Bacteria 2738
265 Ga0495637_0030844 3300046520 Bacteria 2374
266 Ga0495643_0029777 3300046522 Bacteria 3052
267 Ga0495648_0000042 3300046524 Bacteria 179918
268 Ga0495648_0000495 3300046524 Bacteria 42433
269 Ga0495648_0001223 3300046524 Bacteria 25711
270 Ga0495648_0018323 3300046524 Bacteria 4962
271 Ga0495648_0032558 3300046524 Bacteria 3418
272 Ga0495666_0004144 3300046526 Bacteria 7310
273 Ga0495654_0000145 3300046530 Bacteria 73703
274 Ga0495654_0038484 3300046530 Bacteria 2391
275 Ga0495654_0090307 3300046530 Bacteria 1422
276 Ga0495665_0080126 3300046531 Bacteria 1718
277 Ga0495586_0008705 3300046535 Bacteria 5404
278 Ga0495587_0021674 3300046536 Bacteria 3964
279 Ga0495609_0075595 3300046538 Bacteria 1476
280 Ga0495597_0000117 3300046542 Bacteria 71911
281 Ga0495597_0026779 3300046542 Bacteria 2648
282 Ga0495633_0000564 3300046558 Bacteria 36203
283 Ga0495633_0007118 3300046558 Bacteria 6500
284 Ga0495633_0012386 3300046558 Bacteria 4538
285 Ga0495633_0013280 3300046558 Bacteria 4345
286 Ga0495633_0030197 3300046558 Bacteria 2634
287 Ga0495633_0140973 3300046558 Bacteria 1114
288 Ga0495656_0009096 3300046615 Bacteria 3565
289 Ga0495634_0082099 3300046642 Bacteria 2107
290 Ga0495611_0014576 3300046648 Bacteria 3361
291 Ga0495611_0059560 3300046648 Bacteria 1733
292 Ga0495611_0093424 3300046648 Bacteria 1391
293 Ga0495625_0005136 3300046660 Bacteria 12086
294 Ga0495625_0006501 3300046660 Bacteria 10383
295 Ga0495635_0037712 3300046663 Bacteria 3345
296 Ga0495661_0000037 3300046665 Bacteria 164234
297 Ga0495661_0128507 3300046665 Bacteria 1391
298 Ga0495623_0092543 3300046679 Bacteria 1853
299 Ga0495646_0006219 3300046680 Bacteria 7572
300 Ga0495669_0216731 3300046684 Bacteria 917
301 Ga0495613_0004820 3300046689 Bacteria 10119
302 Ga0495624_0005155 3300046690 Bacteria 9438
303 Ga0495624_0034468 3300046690 Bacteria 3274
304 Ga0495670_0000722 3300046691 Bacteria 15757
305 Ga0495670_0065915 3300046691 Bacteria 1826
306 Ga0495671_0008889 3300046692 Bacteria 5640
307 Ga0495671_0013022 3300046692 Bacteria 4523
308 Ga0495649_0004478 3300046694 Bacteria 9122
309 Ga0495649_0044188 3300046694 Bacteria 2432
310 Ga0495589_0068339 3300046794 Bacteria 1738
311 Ga0495660_0001322 3300046810 Bacteria 17096
312 Ga0495660_0001349 3300046810 Bacteria 16870
313 Ga0495660_0003240 3300046810 Bacteria 10118
314 Ga0495660_0008826 3300046810 Bacteria 5887
315 Ga0495660_0137242 3300046810 Bacteria 1221
316 Ga0495581_0016575 3300047315 Bacteria 4282
317 Ga0495604_0013709 3300047317 Bacteria 6462
318 Ga0495604_0024198 3300047317 Bacteria 4846
319 Ga0495672_0006019 3300047320 Bacteria 9490
320 Ga0495672_0013454 3300047320 Bacteria 5645
321 Ga0495672_0137258 3300047320 Bacteria 1281
322 Ga0495676_0002798 3300047321 Bacteria 15711
323 Ga0495680_0002988 3300047322 Bacteria 16883
324 Ga0495680_0079238 3300047322 Bacteria 2484
325 Ga0495680_0205504 3300047322 Bacteria 1411
326 Ga0495683_0000022 3300047323 Bacteria 163268
327 Ga0495683_0000268 3300047323 Bacteria 46160
328 Ga0495683_0019719 3300047323 Bacteria 3480
329 Ga0495683_0033186 3300047323 Bacteria 2628
330 Ga0495687_000784 3300047443 Bacteria 34187
331 Ga0495675_0009980 3300047444 Bacteria 5922
332 Ga0495675_0033332 3300047444 Bacteria 3288
333 Ga0495679_005202 3300047446 Bacteria 5814
334 Ga0495673_0001186 3300047469 Bacteria 21914
335 Ga0495673_0003466 3300047469 Bacteria 10382
336 Ga0495673_0004351 3300047469 Bacteria 8893
337 Ga0495673_0039669 3300047469 Bacteria 2135
338 Ga0495681_0004277 3300047470 Bacteria 9787
339 Ga0495681_0020517 3300047470 Bacteria 3584
340 Ga0495681_0029657 3300047470 Bacteria 2797
341 Ga0495681_0031486 3300047470 Bacteria 2683
342 Ga0495686_0000378 3300047472 Bacteria 71459
343 Ga0495686_0018761 3300047472 Bacteria 4634
344 Ga0495686_0019055 3300047472 Bacteria 4589
345 Ga0495686_0165698 3300047472 Bacteria 1288
346 Ga0495593_0038671 3300047673 Bacteria 2576
347 Ga0495602_0024473 3300048088 Bacteria 5857
348 Ga0495626_0000671 3300048091 Bacteria 32949
349 Ga0496106_0188137 3300048909 Bacteria 1640
350 Ga0496116_0000038 3300048919 Bacteria 370217
351 Ga0496116_0000312 3300048919 Bacteria 80868
352 Ga0496116_0000646 3300048919 Bacteria 45529
353 Ga0496116_0001263 3300048919 Bacteria 29190
354 Ga0496116_0002313 3300048919 Bacteria 20197
355 Ga0496117_0000597 3300048920 Bacteria 59321
356 Ga0496117_0000807 3300048920 Bacteria 48627
357 Ga0496117_0004196 3300048920 Bacteria 16096
358 Ga0496117_0004650 3300048920 Bacteria 14934
359 Ga0496117_0009361 3300048920 Bacteria 9123
360 Ga0496117_0019370 3300048920 Bacteria 5592
361 Ga0496117_0024859 3300048920 Bacteria 4721
362 Ga0496117_0041281 3300048920 Bacteria 3383
363 Ga0496118_0001066 3300048921 Bacteria 42810
364 Ga0496118_0018588 3300048921 Bacteria 6260
365 Ga0496118_0020919 3300048921 Bacteria 5783
366 Ga0496118_0038892 3300048921 Bacteria 3805
367 Ga0496118_0049112 3300048921 Bacteria 3251
368 Ga0496118_0053697 3300048921 Bacteria 3059
369 Ga0496119_0003729 3300048922 Bacteria 15607
370 Ga0496119_0032704 3300048922 Bacteria 3462
371 Ga0496120_0002470 3300048923 Bacteria 18618
372 Ga0496120_0034116 3300048923 Bacteria 3052
373 Ga0496120_0043123 3300048923 Bacteria 2630
374 Ga0496120_0048376 3300048923 Bacteria 2447
375 Ga0496121_0000001 3300048924 Bacteria 1830318
376 Ga0496121_0000377 3300048924 Bacteria 91399
377 Ga0496121_0001424 3300048924 Bacteria 40476
378 Ga0496122_0018269 3300048925 Bacteria 6491
379 Ga0496122_0022873 3300048925 Bacteria 5535
380 Ga0496122_0026984 3300048925 Bacteria 4928
381 Ga0496122_0061343 3300048925 Bacteria 2760
382 Ga0496122_0074444 3300048925 Bacteria 2402
383 Ga0496123_0000881 3300048926 Bacteria 47635
384 Ga0496123_0001515 3300048926 Bacteria 32169
385 Ga0496123_0013256 3300048926 Bacteria 6943
386 Ga0496123_0014379 3300048926 Bacteria 6565
387 Ga0496123_0021970 3300048926 Bacteria 4935
388 Ga0496123_0028038 3300048926 Bacteria 4178
389 Ga0496123_0029152 3300048926 Bacteria 4072
390 Ga0496124_0000191 3300048927 Bacteria 121192
391 Ga0496124_0000236 3300048927 Bacteria 107751
392 Ga0496124_0000747 3300048927 Bacteria 53318
393 Ga0496124_0013980 3300048927 Bacteria 7791
394 Ga0496124_0098752 3300048927 Bacteria 2368
395 Ga0496124_0102401 3300048927 Bacteria 2317
396 Ga0496124_0117464 3300048927 Bacteria 2130
397 Ga0496124_0151592 3300048927 Bacteria 1817
398 Ga0496124_0171632 3300048927 Bacteria 1678
399 Ga0496125_0000001 3300048928 Bacteria 1766138
400 Ga0496125_0000465 3300048928 Bacteria 72631
401 Ga0496125_0008593 3300048928 Bacteria 10662
402 Ga0496125_0030170 3300048928 Bacteria 4854
403 Ga0496125_0046946 3300048928 Bacteria 3617
404 Ga0496125_0052652 3300048928 Bacteria 3346
405 Ga0496126_0001120 3300048929 Bacteria 44884
406 Ga0496126_0004738 3300048929 Bacteria 16040
407 Ga0496126_0070186 3300048929 Bacteria 3122
408 Ga0496126_0082256 3300048929 Bacteria 2845
409 Ga0496126_0217372 3300048929 Bacteria 1607
410 Ga0495678_002732 3300049459 Bacteria 11598
411 Ga0495682_0000085 3300049460 Bacteria 81879
412 Ga0495682_0035071 3300049460 Bacteria 1848
413 Ga0501227_005863 3300049665 Bacteria 2635
414 Ga0501252_006357 3300049682 Bacteria 1312
415 Ga0501226_000725 3300049853 Bacteria 4475
416 nmdc:mga07m45_224639_c1 3300050496 Bacteria 1093
417 nmdc:mga0sz30_36971_c1 3300050516 Bacteria 2042
418 Ga0500608_145989 3300053122 Bacteria 1043
419 Ga0500559_0105046 3300053136 Bacteria 1304
420 Ga0500561_0000073 3300053137 Bacteria 19888
421 Ga0500616_0027986 3300053153 Bacteria 3110
422 Ga0500622_0004078 3300053156 Bacteria 9366
423 Ga0500624_000232 3300053157 Bacteria 20230
424 Ga0500636_0001432 3300053177 Bacteria 12994
425 2501075993 2501025501 Bacteria 7768574
426 2501409694 2501025504 Bacteria 8008976
427 2509145513 2508501127 Bacteria 7037543
428 2510842728 2510461069 Bacteria 5505000
429 2511099218 2510917014 Bacteria 8296963
430 2511108678 2510917015 Bacteria 7950052
431 2511257475 2511231004 Bacteria 6669789
432 2511290260 2511231010 Bacteria 6373152
433 2511325519 2511231016 Bacteria 6704427
434 2511341542 2511231018 Bacteria 6436256
435 2511362495 2511231022 Bacteria 6719296
436 2511366763 2511231023 Bacteria 6808468
437 2511824490 2511231156 Bacteria 6845832
438 2515110347 2515075009 Bacteria 7288508
439 2516898285 2516653046 Bacteria 6989037
440 2555669805 2554235341 Bacteria 6867980
441 2559297391 2558860242 Bacteria 5568029
442 2597859104 2597489887 Bacteria 6666321
443 2597865221 2597489888 Bacteria 6179543
444 2597871077 2597489889 Bacteria 6297495
445 2599353184 2599185160 Bacteria 6844013
446 2599378292 2599185164 Bacteria 6841688
447 2599384331 2599185165 Bacteria 6843250
448 2599460018 2599185181 Bacteria 6844519
449 2599487465 2599185185 Bacteria 6652270
450 2599489039 2599185186 Bacteria 6831633
451 2599502094 2599185188 Bacteria 6164180
452 2599508633 2599185189 Bacteria 5862825
453 2599614725 2599185212 Bacteria 6765997
454 2599722144 2599185236 Bacteria 6875203
455 2599768801 2599185248 Bacteria 6696816
456 2599806212 2599185257 Bacteria 6492581
457 2599877977 2599185288 Bacteria 6666191
458 2599884555 2599185289 Bacteria 6778765
459 2599896266 2599185291 Bacteria 6775623
460 2599932848 2599185300 Bacteria 6062622
461 2599952215 2599185303 Bacteria 6512725
462 2599958152 2599185305 Bacteria 6748700
463 2599964011 2599185306 Bacteria 6637356
464 2599976734 2599185308 Bacteria 6621546
465 2599996675 2599185311 Bacteria 6354990
466 2600003799 2599185313 Bacteria 6658188
467 2600010903 2599185314 Bacteria 6621749
468 2600015875 2599185315 Bacteria 6771107
469 2600021881 2599185316 Bacteria 6320029
470 2600031896 2599185317 Bacteria 6435722
471 2600037346 2599185318 Bacteria 6961590
472 2600041508 2599185319 Bacteria 6637840
473 2600051081 2599185321 Bacteria 6764560
474 2600059463 2599185322 Bacteria 6763055
475 2600063716 2599185323 Bacteria 6688755
476 2600069151 2599185324 Bacteria 6590677
477 2600075155 2599185325 Bacteria 6324919
478 2600212625 2599185356 Bacteria 6843884
479 2600361688 2600254930 Bacteria 6431253
480 2601689524 2600255296 Bacteria 5784754
481 2601772793 2600255313 Bacteria 6842543
482 2601799498 2600255318 Bacteria 6383414
483 2606078268 2603880185 Bacteria 6379190
484 2606130376 2603880199 Bacteria 6377649
485 2621302317 2619619299 Bacteria 6649820
486 2624480466 2623620443 Bacteria 6427864
487 2624491572 2623620446 Bacteria 6500345
488 2643869331 2643221571 Bacteria 6228673
489 2644065272 2643221610 Bacteria 7480339
490 2644281077 2643221650 Bacteria 7029547
491 2644418122 2643221675 Bacteria 7473456
492 2644451378 2643221680 Bacteria 7473610
493 2644622054 2643221713 Bacteria 6554480
494 2644691642 2643221726 Bacteria 7455827
495 2671088959 2667528170 Bacteria 6786960
496 2671126965 2667528176 Bacteria 6724917
497 2671772724 2671180172 Bacteria 6495783
498 2677896610 2675903420 Bacteria 6247433
499 2678263508 2675903515 Bacteria 6580491
500 2715751585 2713897148 Bacteria 5883533
501 2715759380 2713897149 Bacteria 6506249
502 2723249975 2721755607 Bacteria 5841722
503 2738674417 2738541265 Bacteria 6594665
504 2738752810 2738541282 Bacteria 6593925
505 2738810039 2738541294 Bacteria 6925949
506 2738861851 2738541303 Bacteria 6591772
507 2738897399 2738541309 Bacteria 6926455
508 2739258042 2738543015 Bacteria 6750701
509 2739311671 2738543025 Bacteria 6600348
510 2739351633 2738543031 Bacteria 5769731
511 2745009839 2744054620 Bacteria 6551379
512 2758638406 2758568016 Bacteria 5645291
513 2774134202 2773857673 Bacteria 6513460
514 2776267137 2775506902 Bacteria 6208009
515 2776280277 2775506904 Bacteria 5954060
516 2784264017 2784132063 Bacteria 6262788
517 2794597891 2791355520 Bacteria 5948615
518 2808976992 2808606385 Bacteria 6711065
519 2808992147 2808606388 Bacteria 6706662
520 2817488258 2816332298 Bacteria 6852809
521 2819721826 2818991467 Bacteria 5893227
522 2825652300 2825651385 Bacteria 6715909
523 2834032851 2834028612 Bacteria 6354979
524 2838741822 2838736955 Bacteria 5760694
525 2841735524 2841734538 Bacteria 6784580
526 2841845762 2841840854 Bacteria 5761912
527 2842145466 2842140634 Bacteria 5759631
528 2842827553 2842826826 Bacteria 5974129
529 2842834781 2842832357 Bacteria 5959113
530 2842841337 2842837860 Bacteria 6066181
531 2842843491 2842843487 Bacteria 6004777
532 2842854989 2842854478 Bacteria 6143501
533 2844670851 2844665904 Bacteria 6817974
534 2852613674 2852612431 Bacteria 6885235
535 2852657903 2852657418 Bacteria 6472974
536 2852668590 2852667396 Bacteria 6885555
537 2860344656 2860339153 Bacteria 6846989
538 2871476236 2871474448 Bacteria 6806570
539 2878032400 2878029506 Bacteria 6418441
540 2878793945 2878788777 Bacteria 6567085
541 2880233918 2880230671 Bacteria 6140320
542 2889311308 2889306138 Bacteria 6358934
543 2904489857 2904483920 Bacteria 7545285
544 2904523225 2904518522 Bacteria 6068986
545 2913039127 2913036834 Bacteria 6704877
546 2916028349 2916021584 Bacteria 6854472
547 2916028661 2916028427 Bacteria 6748433
548 2916056051 2916055098 Bacteria 6758838
549 2917073623 2917070673 Bacteria 6868303
550 2919065242 2919063839 Bacteria 6302690
551 2919387107 2919385768 Bacteria 5897293
552 2919489053 2919487758 Bacteria 5929766
553 2919532925 2919527303 Bacteria 7718827
554 2919703937 2919697872 Bacteria 6553725
555 2921264285 2921263974 Bacteria 6864552
556 2923588141 2923586266 Bacteria 6565975
557 2924179474 2924172951 Bacteria 6749356
558 2929140294 2929138655 Bacteria 5810547
559 2929147746 2929144301 Bacteria 6622272
560 2931374861 2931369376 Bacteria 6847892
561 2931402177 2931396565 Bacteria 7251677
562 2935357365 2935353572 Unclassified 6955622
563 2937047647 2937042894 Bacteria 6741576
564 2937075850 2937071275 Bacteria 6984483
565 2937126587 2937126314 Bacteria 6771275
566 2937842338 2937836603 Bacteria 6811263
567 2946010528 2946006987 Bacteria 6705746
568 2946028507 2946027586 Bacteria 6049274
569 2947239056 2947233263 Bacteria 6439278
570 2957478260 2957478035 Bacteria 6756658
571 2958075479 2958071322 Bacteria 6815895
572 2964639887 2964636051 Bacteria 7091832
573 2964706870 2964705432 Bacteria 7114648
574 2967780356 2967775926 Bacteria 6738189
575 2969307062 2969304461 Bacteria 6601805
576 2974290820 2974289157 Bacteria 6080362
577 2979090535 2979089926 Bacteria 5670289
578 2979096061 2979095461 Bacteria 5669583
579 2998142994 2998139840 Bacteria 6073514
580 3005419385 3005416602 Bacteria 7064308
581 3007856998 3007855910 Bacteria 5637581
582 3007862030 3007861166 Bacteria 6045338
583 3007868452 3007866637 Bacteria 5899198
584 637320144 637000220 Bacteria 7074893
585 650843824 650716007 Bacteria 5573770
586 8001846433 8001845381 Bacteria 5804942
587 8004639375 8004633249 Bacteria 6723080
588 8005460986 8005460587 Bacteria 7157962
589 8019781973 8019775933 Bacteria 6858656
590 8029997793 8029995093 Bacteria 5990776
591 8054287929 8054285046 Bacteria 6919322
592 8054291396 8054285046 Bacteria 6919322
593 8054350656 8054347763 Bacteria 5901107
594 8055773601 8055770955 Bacteria 6827675
595 8056128344 8056125926 Bacteria 6228218
596 8056134197 8056131705 Bacteria 6107031
597 8056146996 8056143049 Bacteria 6307666
598 8056150310 8056148874 Bacteria 6479865
599 8056168198 8056166840 Bacteria 5820959
600 8056574107 8056569372 Bacteria 5997322
601 Ga0065704_10160409
602 SwRhRL2b_contig_1366508
603 JGI25162J39368_1000004
604 JGI25164J39214_1000026
605 JGI25165J46597_1000011
606 JGI25153J46596_10036842
607 Ga0055539_1000036
608 Ga0055533_1000046
609 Ga0055533_1000353
610 Ga0055532_1000032
611 Ga0055525_1000217
612 Ga0055525_1002000
613 Ga0055535_1005166
614 Ga0055524_1004630
615 Ga0055524_1008145
616 Ga0055536_1000013
617 Ga0055536_1000032
618 Ga0055536_1000277
619 Ga0055528_1000018
620 Ga0055530_10000004
621 Ga0055530_10000029
622 Ga0055530_10000062
623 Ga0055530_10000648
624 Ga0055540_1000008
625 Ga0055540_1000017
626 Ga0055540_1000166
627 Ga0055531_10000242
628 Ga0055541_1000024
629 Ga0065714_10002302
630 Ga0065714_10008929
631 Ga0065714_10072254
632 Ga0065714_10082726
633 Ga0065704_10038423
634 Ga0065704_10070262
635 Ga0065704_10111062
636 Ga0070670_100000034
637 Ga0070670_100000381
638 Ga0070670_100002591
639 Ga0070668_100125963
640 Ga0070669_100000259
641 Ga0070667_100534870
642 Ga0070662_100002140
643 Ga0068853_100074172
644 Ga0068851_10007430
645 Ga0075364_10097464
646 Ga0075364_10230563
647 Ga0075432_10000821
648 Ga0075432_10005619
649 Ga0075369_10094846
650 Ga0105251_10000207
651 Ga0105251_10008072
652 Ga0105251_10011506
653 Ga0105244_10018340
654 Ga0105244_10034292
655 Ga0105244_10053034
656 Ga0105250_10000207
657 Ga0105250_10000353
658 Ga0105250_10001427
659 Ga0105250_10017372
660 Ga0105243_10000170
661 Ga0105243_10002467
662 Ga0105243_10080694
663 Ga0105248_10252084
664 Ga0105237_10208062
665 Ga0105249_10569842
666 Ga0157345_1000001
667 Ga0157373_10002166
668 Ga0157373_10015520
669 Ga0157373_10088366
670 Ga0157371_10002985
671 Ga0157371_10011312
672 Ga0157370_10056689
673 Ga0157369_10011709
674 Ga0157369_10206262
675 Ga0163162_10441039
676 Ga0157372_10000821
677 Ga0182008_10000429
678 Ga0182008_10004315
679 Ga0182008_10005140
680 Ga0182008_10007005
681 Ga0182006_1000677
682 Ga0182006_1001013
683 Ga0182006_1006763
684 Ga0182007_10000766
685 Ga0182007_10001255
686 Ga0182005_1002698
687 Ga0182005_1005588
688 Ga0163161_10011334
689 Ga0163161_10022604
690 Ga0163161_10030055
691 Ga0163161_10031082
692 Ga0209435_101329
693 Ga0209760_100105
694 Ga0209784_100017
695 Ga0209566_100014
696 Ga0209674_100028
697 Ga0209147_100038
698 Ga0209563_100032
699 Ga0207427_100003
700 Ga0209437_100002
701 Ga0209258_100197
702 Ga0209646_1000171
703 Ga0209677_100018
704 Ga0209759_1021150
705 Ga0209233_1000004
706 Ga0209673_1000055
707 Ga0209675_1002987
708 Ga0209676_1000002
709 Ga0209676_1000003
710 Ga0209676_1000120
711 Ga0209676_1001065
712 Ga0209564_1025815
713 Ga0209564_1030508
714 Ga0209050_1000004
715 Ga0209050_1000006
716 Ga0209050_1000037
717 Ga0209256_1000147
718 Ga0209256_1000401
719 Ga0209051_1000001
720 Ga0209051_1000040
721 Ga0209051_1000052
722 Ga0209257_1000029
723 Ga0209257_1006677
724 Ga0207656_10000034
725 Ga0207696_1000002
726 Ga0207696_1000108
727 Ga0207696_1002028
728 Ga0207696_1003553
729 Ga0207696_1054692
730 Ga0207655_1000141
731 Ga0207655_1000520
732 Ga0207655_1002113
733 Ga0207655_1024127
734 Ga0207655_1097271
735 Ga0207713_1000122
736 Ga0207713_1001298
737 Ga0207713_1007845
738 Ga0207713_1008251
739 Ga0207681_10000215
740 Ga0207650_10000066
741 Ga0207650_10000272
742 Ga0207650_10003085
743 Ga0207706_10007035
744 Ga0207709_10000004
745 Ga0207709_10004673
746 Ga0207711_10221461
747 Ga0209281_1002332
748 Ga0209281_1002401
749 Ga0209371_1025973
750 Ga0207428_10023325
751 Ga0307511_10017686
752 Ga0316178_1157838
753 Ga0316181_1238654
754 Ga0307408_100000292
755 Ga0307408_100001576
756 Ga0307408_100002489
757 Ga0307408_100031974
758 Ga0307405_10000137
759 Ga0307405_10008309
760 Ga0307413_10120551
761 Ga0307406_10064937
762 Ga0307412_10002134
763 Ga0307412_10121990
764 Ga0307409_100017968
765 Ga0307414_10292588
766 Ga0307411_10020132
767 Ga0307411_10024161
768 Ga0373927_0000706
769 Ga0373925_0000597
770 Ga0395905_0064982
771 Ga0439438_000979
772 Ga0439438_001358
773 Ga0439447_000025
774 Ga0439466_0003466
775 Ga0439466_0005163
776 Ga0439466_0011161
777 Ga0439465_0002423
778 Ga0439431_0000048
779 Ga0439432_000667
780 Ga0439432_001831
781 Ga0439432_003642
782 Ga0439432_011894
783 Ga0439451_000431
784 Ga0439451_002651
785 Ga0439452_000024
786 Ga0439452_001785
787 Ga0439452_004120
788 Ga0439452_008576
789 Ga0439452_032584
790 Ga0439456_022675
791 Ga0439463_002790
792 Ga0439463_008411
793 Ga0450911_000030
794 Ga0450911_005553
795 Ga0450919_000226
796 Ga0450922_001115
797 Ga0450890_000296
798 Ga0450897_003222
799 Ga0450898_001443
800 Ga0450902_016428
801 Ga0450903_002701
802 Ga0450903_027509
803 Ga0450904_001386
804 Ga0450905_006486
805 Ga0450906_000016
806 Ga0450906_004234
807 Ga0450907_000039
808 Ga0450907_007425
809 Ga0450910_000003
810 Ga0439446_0000458
811 Ga0450908_000492
812 Ga0450909_006164
813 Ga0439434_0023716
814 Ga0439460_0005851
815 Ga0450901_000416
816 Ga0495617_006028
817 Ga0495617_013438
818 Ga0495617_029959
819 Ga0495627_000538
820 Ga0495627_032067
821 Ga0495591_000139
822 Ga0495591_000277
823 Ga0495591_005842
824 Ga0495629_0006452
825 Ga0495638_0079148
826 Ga0495638_0152233
827 Ga0495653_0017374
828 Ga0495653_0027898
829 Ga0495653_0328099
830 Ga0495650_0028800
831 Ga0495650_0033219
832 Ga0495650_0042051
833 Ga0495582_0008582
834 Ga0495605_0007746
835 Ga0495605_0015413
836 Ga0495605_0030007
837 Ga0495605_0057570
838 Ga0495639_0000066
839 Ga0495584_0017052
840 Ga0495584_0022096
841 Ga0495584_0040998
842 Ga0495585_0020167
843 Ga0495585_0032199
844 Ga0495585_0056094
845 Ga0495594_0015269
846 Ga0495607_0000540
847 Ga0495607_0003561
848 Ga0495607_0011933
849 Ga0495607_0021884
850 Ga0495607_0047329
851 Ga0495606_0003459
852 Ga0495606_0015212
853 Ga0495616_0000101
854 Ga0495616_0000663
855 Ga0495616_0014457
856 Ga0495620_0003915
857 Ga0495628_0031807
858 Ga0495630_0000759
859 Ga0495630_0024105
860 Ga0495631_0000013
861 Ga0495632_0015974
862 Ga0495637_0005411
863 Ga0495637_0006865
864 Ga0495637_0024369
865 Ga0495637_0030844
866 Ga0495643_0029777
867 Ga0495648_0000042
868 Ga0495648_0000495
869 Ga0495648_0001223
870 Ga0495648_0018323
871 Ga0495648_0032558
872 Ga0495666_0004144
873 Ga0495654_0000145
874 Ga0495654_0038484
875 Ga0495654_0090307
876 Ga0495665_0080126
877 Ga0495586_0008705
878 Ga0495587_0021674
879 Ga0495609_0075595
880 Ga0495597_0000117
881 Ga0495597_0026779
882 Ga0495633_0000564
883 Ga0495633_0007118
884 Ga0495633_0012386
885 Ga0495633_0013280
886 Ga0495633_0030197
887 Ga0495633_0140973
888 Ga0495656_0009096
889 Ga0495634_0082099
890 Ga0495611_0014576
891 Ga0495611_0059560
892 Ga0495611_0093424
893 Ga0495625_0005136
894 Ga0495625_0006501
895 Ga0495635_0037712
896 Ga0495661_0000037
897 Ga0495661_0128507
898 Ga0495623_0092543
899 Ga0495646_0006219
900 Ga0495669_0216731
901 Ga0495613_0004820
902 Ga0495624_0005155
903 Ga0495624_0034468
904 Ga0495670_0000722
905 Ga0495670_0065915
906 Ga0495671_0008889
907 Ga0495671_0013022
908 Ga0495649_0004478
909 Ga0495649_0044188
910 Ga0495589_0068339
911 Ga0495660_0001322
912 Ga0495660_0001349
913 Ga0495660_0003240
914 Ga0495660_0008826
915 Ga0495660_0137242
916 Ga0495581_0016575
917 Ga0495604_0013709
918 Ga0495604_0024198
919 Ga0495672_0006019
920 Ga0495672_0013454
921 Ga0495672_0137258
922 Ga0495676_0002798
923 Ga0495680_0002988
924 Ga0495680_0079238
925 Ga0495680_0205504
926 Ga0495683_0000022
927 Ga0495683_0000268
928 Ga0495683_0019719
929 Ga0495683_0033186
930 Ga0495687_000784
931 Ga0495675_0009980
932 Ga0495675_0033332
933 Ga0495679_005202
934 Ga0495673_0001186
935 Ga0495673_0003466
936 Ga0495673_0004351
937 Ga0495673_0039669
938 Ga0495681_0004277
939 Ga0495681_0020517
940 Ga0495681_0029657
941 Ga0495681_0031486
942 Ga0495686_0000378
943 Ga0495686_0018761
944 Ga0495686_0019055
945 Ga0495686_0165698
946 Ga0495593_0038671
947 Ga0495602_0024473
948 Ga0495626_0000671
949 Ga0496106_0188137
950 Ga0496116_0000038
951 Ga0496116_0000312
952 Ga0496116_0000646
953 Ga0496116_0001263
954 Ga0496116_0002313
955 Ga0496117_0000597
956 Ga0496117_0000807
957 Ga0496117_0004196
958 Ga0496117_0004650
959 Ga0496117_0009361
960 Ga0496117_0019370
961 Ga0496117_0024859
962 Ga0496117_0041281
963 Ga0496118_0001066
964 Ga0496118_0018588
965 Ga0496118_0020919
966 Ga0496118_0038892
967 Ga0496118_0049112
968 Ga0496118_0053697
969 Ga0496119_0003729
970 Ga0496119_0032704
971 Ga0496120_0002470
972 Ga0496120_0034116
973 Ga0496120_0043123
974 Ga0496120_0048376
975 Ga0496121_0000001
976 Ga0496121_0000377
977 Ga0496121_0001424
978 Ga0496122_0018269
979 Ga0496122_0022873
980 Ga0496122_0026984
981 Ga0496122_0061343
982 Ga0496122_0074444
983 Ga0496123_0000881
984 Ga0496123_0001515
985 Ga0496123_0013256
986 Ga0496123_0014379
987 Ga0496123_0021970
988 Ga0496123_0028038
989 Ga0496123_0029152
990 Ga0496124_0000191
991 Ga0496124_0000236
992 Ga0496124_0000747
993 Ga0496124_0013980
994 Ga0496124_0098752
995 Ga0496124_0102401
996 Ga0496124_0117464
997 Ga0496124_0151592
998 Ga0496124_0171632
999 Ga0496125_0000001
1000 Ga0496125_0000465
1001 Ga0496125_0008593
1002 Ga0496125_0030170
1003 Ga0496125_0046946
1004 Ga0496125_0052652
1005 Ga0496126_0001120
1006 Ga0496126_0004738
1007 Ga0496126_0070186
1008 Ga0496126_0082256
1009 Ga0496126_0217372
1010 Ga0495678_002732
1011 Ga0495682_0000085
1012 Ga0495682_0035071
1013 Ga0501227_005863
1014 Ga0501252_006357
1015 Ga0501226_000725
1016 nmdc:mga07m45_224639_c1
1017 nmdc:mga0sz30_36971_c1
1018 Ga0500608_145989
1019 Ga0500559_0105046
1020 Ga0500561_0000073
1021 Ga0500616_0027986
1022 Ga0500622_0004078
1023 Ga0500624_000232
1024 Ga0500636_0001432
1025 2501075993
1026 2501409694
1027 2509145513
1028 2510842728
1029 2511099218
1030 2511108678
1031 2511257475
1032 2511290260
1033 2511325519
1034 2511341542
1035 2511362495
1036 2511366763
1037 2511824490
1038 2515110347
1039 2516898285
1040 2555669805
1041 2559297391
1042 2597859104
1043 2597865221
1044 2597871077
1045 2599353184
1046 2599378292
1047 2599384331
1048 2599460018
1049 2599487465
1050 2599489039
1051 2599502094
1052 2599508633
1053 2599614725
1054 2599722144
1055 2599768801
1056 2599806212
1057 2599877977
1058 2599884555
1059 2599896266
1060 2599932848
1061 2599952215
1062 2599958152
1063 2599964011
1064 2599976734
1065 2599996675
1066 2600003799
1067 2600010903
1068 2600015875
1069 2600021881
1070 2600031896
1071 2600037346
1072 2600041508
1073 2600051081
1074 2600059463
1075 2600063716
1076 2600069151
1077 2600075155
1078 2600212625
1079 2600361688
1080 2601689524
1081 2601772793
1082 2601799498
1083 2606078268
1084 2606130376
1085 2621302317
1086 2624480466
1087 2624491572
1088 2643869331
1089 2644065272
1090 2644281077
1091 2644418122
1092 2644451378
1093 2644622054
1094 2644691642
1095 2671088959
1096 2671126965
1097 2671772724
1098 2677896610
1099 2678263508
1100 2715751585
1101 2715759380
1102 2723249975
1103 2738674417
1104 2738752810
1105 2738810039
1106 2738861851
1107 2738897399
1108 2739258042
1109 2739311671
1110 2739351633
1111 2745009839
1112 2758638406
1113 2774134202
1114 2776267137
1115 2776280277
1116 2784264017
1117 2794597891
1118 2808976992
1119 2808992147
1120 2817488258
1121 2819721826
1122 2825652300
1123 2834032851
1124 2838741822
1125 2841735524
1126 2841845762
1127 2842145466
1128 2842827553
1129 2842834781
1130 2842841337
1131 2842843491
1132 2842854989
1133 2844670851
1134 2852613674
1135 2852657903
1136 2852668590
1137 2860344656
1138 2871476236
1139 2878032400
1140 2878793945
1141 2880233918
1142 2889311308
1143 2904489857
1144 2904523225
1145 2913039127
1146 2916028349
1147 2916028661
1148 2916056051
1149 2917073623
1150 2919065242
1151 2919387107
1152 2919489053
1153 2919532925
1154 2919703937
1155 2921264285
1156 2923588141
1157 2924179474
1158 2929140294
1159 2929147746
1160 2931374861
1161 2931402177
1162 2935357365
1163 2937047647
1164 2937075850
1165 2937126587
1166 2937842338
1167 2946010528
1168 2946028507
1169 2947239056
1170 2957478260
1171 2958075479
1172 2964639887
1173 2964706870
1174 2967780356
1175 2969307062
1176 2974290820
1177 2979090535
1178 2979096061
1179 2998142994
1180 3005419385
1181 3007856998
1182 3007862030
1183 3007868452
1184 637320144
1185 650843824
1186 8001846433
1187 8004639375
1188 8005460986
1189 8019781973
1190 8029997793
1191 8054287929
1192 8054291396
1193 8054350656
1194 8055773601
1195 8056128344
1196 8056134197
1197 8056146996
1198 8056150310
1199 8056168198
1200 8056574107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

234

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

245

0.93

PF08659

KR

KR domain

41

212

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

43

196

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmv-assembly4.cif.gz_I short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.8431 5 236
4bmv-assembly2.cif.gz_D short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.8412 3 237
4bmv-assembly2.cif.gz_D short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.8224 3 237
4bmv-assembly4.cif.gz_I short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.8145 5 236
6ze0-assembly2.cif.gz_C-2 orthorhombic crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni 0.8084 5 238
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9488 5 54 3.40.50.720
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8883 5 61 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8626 5 65 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.861 71 166 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8443 5 67 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0T9PN84-F1-model_v4 Short chain dehydrogenase 0.9187 130 240
AF-I3V3I7-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9134 110 239
AF-A0A358GZA9-F1-model_v4 deleted 0.9009 75 238
AF-A0A7W6JR17-F1-model_v4 SDR family oxidoreductase 0.8977 73 239 GO:0016491
AF-A0A3M4CMJ9-F1-model_v4 deleted 0.8934 70 240

Map