F467952

General Info

Members Datasets Scaffolds Average Seq Length
600 254 1200 248

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100001432|Ga0070662_1000014326
Length 277
Sequence MKARARFPFQRLLWAFVALLPLVLTTGCATVGGGAPTRQSAGQKLDPWENWNRKVFSFNEGLDEHLLKPVATAYRKVTPSFLRTAISNFFNNAEDAWSAVNHFLQGKGESGMQMLVRFNTNTFFGLGGVLDIATEAGIERQPEDFGQTLGKWGFGAGAYIVWPVLGPSSVRDSLALPLDRTMTSPAPLFEPESVQWEMLGLQLVNTRAGLLDASRVIDDIALDKYTFLRDGYLARRRSLVYDGNPPDTSPRDDAEDLAPAEKSEAAPPAGAASAPAQ

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
190 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
243 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
244 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
245 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
250 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
253 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
254 2585428062 Methylibium sp. CF059 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.33
Nodule 0
Rhizoplane 2.83
Rhizosphere 80.33
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100001432 3300005457 Bacteria 14712
2 JGI24033J26618_1014872 3300002155 Bacteria 955
3 JGI25152J39213_1000662 3300002773 Bacteria 17998
4 JGI25153J46596_10003371 3300003215 Bacteria 8968
5 JGI25153J46596_10007545 3300003215 Bacteria 5328
6 rootH1_10004482 3300003323 Bacteria 2128
7 Ga0055526_1001626 3300003771 Bacteria 15770
8 Ga0070658_10016712 3300005327 Bacteria 5873
9 Ga0070676_10017134 3300005328 Bacteria 4008
10 Ga0070676_10021221 3300005328 Bacteria 3635
11 Ga0070676_10034601 3300005328 Bacteria 2901
12 Ga0070690_100017758 3300005330 Bacteria 4286
13 Ga0070690_100028629 3300005330 Bacteria 3451
14 Ga0070670_100013611 3300005331 Bacteria 6971
15 Ga0070670_100021917 3300005331 Bacteria 5496
16 Ga0070670_100026210 3300005331 Bacteria 5018
17 Ga0070670_100034305 3300005331 Bacteria 4367
18 Ga0070670_100080193 3300005331 Bacteria 2805
19 Ga0070670_100099934 3300005331 Bacteria 2497
20 Ga0070677_10005615 3300005333 Bacteria 4139
21 Ga0070677_10015649 3300005333 Bacteria 2688
22 Ga0070677_10052567 3300005333 Bacteria 1653
23 Ga0070677_10054709 3300005333 Bacteria 1626
24 Ga0070677_10063098 3300005333 Bacteria 1535
25 Ga0068869_100003488 3300005334 Bacteria 9627
26 Ga0068869_100031544 3300005334 Bacteria 3728
27 Ga0068869_100168989 3300005334 Bacteria 1707
28 Ga0070666_10004086 3300005335 Bacteria 8865
29 Ga0070666_10114353 3300005335 Bacteria 1868
30 Ga0070666_10217538 3300005335 Bacteria 1347
31 Ga0070666_10229530 3300005335 Bacteria 1311
32 Ga0068868_100001343 3300005338 Bacteria 16950
33 Ga0068868_100003534 3300005338 Bacteria 10890
34 Ga0068868_100046664 3300005338 Bacteria 3391
35 Ga0068868_100060065 3300005338 Bacteria 3008
36 Ga0068868_100069894 3300005338 Bacteria 2799
37 Ga0068868_100329171 3300005338 Bacteria 1303
38 Ga0070660_100083259 3300005339 Bacteria 2513
39 Ga0070689_100156502 3300005340 Bacteria 1840
40 Ga0070661_100108494 3300005344 Bacteria 2071
41 Ga0070661_100181398 3300005344 Bacteria 1602
42 Ga0070661_100225204 3300005344 Bacteria 1439
43 Ga0070668_100043016 3300005347 Bacteria 3463
44 Ga0070668_100277076 3300005347 Bacteria 1400
45 Ga0070669_100044294 3300005353 Bacteria 3242
46 Ga0070669_100050718 3300005353 Bacteria 3031
47 Ga0070669_100155058 3300005353 Bacteria 1775
48 Ga0070669_100173734 3300005353 Bacteria 1681
49 Ga0070675_100003418 3300005354 Bacteria 12023
50 Ga0070675_100010402 3300005354 Bacteria 7268
51 Ga0070675_100133968 3300005354 Bacteria 2113
52 Ga0070675_100137894 3300005354 Bacteria 2083
53 Ga0070675_100343512 3300005354 Bacteria 1322
54 Ga0070671_100008407 3300005355 Bacteria 8273
55 Ga0070671_100020559 3300005355 Bacteria 5385
56 Ga0070671_100135962 3300005355 Bacteria 2072
57 Ga0070671_100169440 3300005355 Bacteria 1847
58 Ga0070671_100232935 3300005355 Bacteria 1563
59 Ga0070674_100121621 3300005356 Bacteria 1933
60 Ga0070673_100002371 3300005364 Bacteria 11464
61 Ga0070673_100120925 3300005364 Bacteria 2184
62 Ga0070673_100295974 3300005364 Bacteria 1423
63 Ga0070673_100321953 3300005364 Bacteria 1366
64 Ga0070688_100019843 3300005365 Bacteria 3899
65 Ga0070659_100011449 3300005366 Bacteria 6562
66 Ga0070659_100122710 3300005366 Bacteria 2106
67 Ga0070667_100012357 3300005367 Bacteria 7062
68 Ga0070667_100030336 3300005367 Bacteria 4510
69 Ga0070667_100138756 3300005367 Bacteria 2127
70 Ga0070700_100067380 3300005441 Bacteria 2274
71 Ga0070708_100338018 3300005445 Bacteria 1419
72 Ga0070663_100107129 3300005455 Bacteria 2095
73 Ga0070663_100109227 3300005455 Bacteria 2076
74 Ga0070663_100284977 3300005455 Bacteria 1318
75 Ga0070678_100006062 3300005456 Bacteria 7052
76 Ga0070678_100033281 3300005456 Bacteria 3577
77 Ga0070678_100081202 3300005456 Bacteria 2457
78 Ga0070678_100163811 3300005456 Bacteria 1804
79 Ga0070678_100282192 3300005456 Bacteria 1405
80 Ga0070662_100005695 3300005457 Bacteria 7972
81 Ga0070662_100028238 3300005457 Bacteria 3902
82 Ga0070662_100031932 3300005457 Bacteria 3699
83 Ga0070681_10017630 3300005458 Bacteria 7135
84 Ga0068867_100005426 3300005459 Bacteria 9022
85 Ga0068867_100011992 3300005459 Bacteria 6123
86 Ga0068867_100014496 3300005459 Bacteria 5586
87 Ga0068867_100017829 3300005459 Bacteria 5042
88 Ga0068867_100030867 3300005459 Bacteria 3867
89 Ga0068867_100064789 3300005459 Bacteria 2717
90 Ga0068867_100071487 3300005459 Bacteria 2595
91 Ga0070707_100026153 3300005468 Bacteria 5539
92 Ga0070679_100000726 3300005530 Bacteria 28453
93 Ga0070684_100005261 3300005535 Bacteria 9903
94 Ga0070684_100451596 3300005535 Bacteria 1188
95 Ga0068853_100006811 3300005539 Bacteria 9111
96 Ga0068853_100435425 3300005539 Bacteria 1232
97 Ga0070672_100025769 3300005543 Bacteria 4368
98 Ga0070672_100026382 3300005543 Bacteria 4322
99 Ga0070672_100047279 3300005543 Bacteria 3338
100 Ga0070672_100086298 3300005543 Bacteria 2524
101 Ga0070686_100082995 3300005544 Bacteria 2126
102 Ga0070686_100209678 3300005544 Bacteria 1402
103 Ga0070686_100364279 3300005544 Bacteria 1090
104 Ga0070693_100041764 3300005547 Bacteria 2582
105 Ga0070693_100044620 3300005547 Bacteria 2508
106 Ga0070665_100007443 3300005548 Bacteria 11136
107 Ga0070665_100104794 3300005548 Bacteria 2830
108 Ga0070665_100115538 3300005548 Bacteria 2687
109 Ga0068855_100018761 3300005563 Bacteria 8316
110 Ga0070664_100015313 3300005564 Bacteria 6270
111 Ga0070664_100224211 3300005564 Bacteria 1682
112 Ga0070664_100304190 3300005564 Bacteria 1441
113 Ga0070664_100343636 3300005564 Bacteria 1356
114 Ga0070664_100472159 3300005564 Bacteria 1154
115 Ga0068857_100010507 3300005577 Bacteria 8046
116 Ga0068854_100013710 3300005578 Bacteria 5326
117 Ga0068854_100085075 3300005578 Bacteria 2341
118 Ga0068854_100093842 3300005578 Bacteria 2237
119 Ga0068856_100013192 3300005614 Bacteria 8003
120 Ga0068856_100074496 3300005614 Bacteria 3361
121 Ga0070702_100169659 3300005615 Bacteria 1418
122 Ga0068852_100009092 3300005616 Bacteria 7356
123 Ga0068852_100013380 3300005616 Bacteria 6280
124 Ga0068852_100066202 3300005616 Bacteria 3155
125 Ga0068852_100085162 3300005616 Bacteria 2815
126 Ga0068852_100114694 3300005616 Bacteria 2455
127 Ga0068852_100128266 3300005616 Bacteria 2332
128 Ga0068852_100185077 3300005616 Bacteria 1961
129 Ga0068852_100187166 3300005616 Bacteria 1951
130 Ga0068859_100001451 3300005617 Bacteria 24059
131 Ga0068859_100101507 3300005617 Bacteria 2934
132 Ga0068859_100357592 3300005617 Bacteria 1555
133 Ga0068864_100002901 3300005618 Bacteria 14175
134 Ga0068864_100009398 3300005618 Bacteria 8066
135 Ga0068864_100104355 3300005618 Bacteria 2518
136 Ga0068864_100201517 3300005618 Bacteria 1828
137 Ga0068864_100233074 3300005618 Bacteria 1703
138 Ga0068866_10019689 3300005718 Bacteria 3078
139 Ga0068866_10087404 3300005718 Bacteria 1689
140 Ga0068866_10130962 3300005718 Bacteria 1427
141 Ga0068861_100005459 3300005719 Bacteria 8611
142 Ga0068861_100013781 3300005719 Bacteria 5662
143 Ga0068861_100145774 3300005719 Bacteria 1937
144 Ga0068861_100329349 3300005719 Bacteria 1332
145 Ga0068851_10008150 3300005834 Bacteria 4838
146 Ga0068851_10207598 3300005834 Bacteria 1096
147 Ga0068863_100010181 3300005841 Bacteria 9144
148 Ga0068863_100018287 3300005841 Bacteria 6711
149 Ga0068863_100040067 3300005841 Bacteria 4455
150 Ga0068863_100154915 3300005841 Bacteria 2193
151 Ga0068863_100831740 3300005841 Bacteria 922
152 Ga0068858_100010630 3300005842 Bacteria 8712
153 Ga0068858_100285693 3300005842 Bacteria 1571
154 Ga0068858_100368842 3300005842 Bacteria 1377
155 Ga0068860_100039824 3300005843 Bacteria 4494
156 Ga0068860_100172465 3300005843 Bacteria 2090
157 Ga0068860_100182469 3300005843 Bacteria 2029
158 Ga0068862_100042040 3300005844 Bacteria 3891
159 Ga0068862_100086453 3300005844 Bacteria 2726
160 Ga0075368_10000682 3300006042 Bacteria 10310
161 Ga0075368_10018606 3300006042 Bacteria 2611
162 Ga0075363_100024753 3300006048 Bacteria 3054
163 Ga0075363_100061252 3300006048 Bacteria 2028
164 Ga0075363_100224254 3300006048 Bacteria 1078
165 Ga0075364_10124329 3300006051 Bacteria 1728
166 Ga0070715_10179035 3300006163 Bacteria 1062
167 Ga0075362_10016796 3300006177 Bacteria 3004
168 Ga0075362_10042877 3300006177 Bacteria 2002
169 Ga0075367_10032551 3300006178 Bacteria 3001
170 Ga0075367_10048227 3300006178 Bacteria 2508
171 Ga0075367_10049792 3300006178 Bacteria 2471
172 Ga0075369_10018641 3300006186 Bacteria 2827
173 Ga0075369_10020713 3300006186 Bacteria 2695
174 Ga0075369_10028340 3300006186 Bacteria 2347
175 Ga0075366_10001768 3300006195 Bacteria 10899
176 Ga0075366_10005954 3300006195 Bacteria 6637
177 Ga0075366_10021753 3300006195 Bacteria 3729
178 Ga0075366_10040736 3300006195 Bacteria 2748
179 Ga0075366_10095314 3300006195 Bacteria 1784
180 Ga0075366_10137621 3300006195 Unclassified 1475
181 Ga0075366_10221944 3300006195 Bacteria 1151
182 Ga0097621_100009144 3300006237 Bacteria 7182
183 Ga0097621_100009422 3300006237 Bacteria 7086
184 Ga0097621_100033628 3300006237 Bacteria 4084
185 Ga0097621_100044849 3300006237 Bacteria 3569
186 Ga0097621_100151519 3300006237 Bacteria 1989
187 Ga0075370_10001151 3300006353 Bacteria 11109
188 Ga0075370_10012585 3300006353 Bacteria 4477
189 Ga0075370_10024268 3300006353 Bacteria 3348
190 Ga0068871_100006200 3300006358 Bacteria 8431
191 Ga0068871_100008132 3300006358 Bacteria 7530
192 Ga0068871_100016972 3300006358 Bacteria 5497
193 Ga0068871_100076558 3300006358 Bacteria 2763
194 Ga0068871_100082655 3300006358 Bacteria 2663
195 Ga0068871_100318388 3300006358 Bacteria 1369
196 Ga0068865_100041024 3300006881 Bacteria 3148
197 Ga0068865_100091208 3300006881 Bacteria 2211
198 Ga0097620_100001451 3300006931 Bacteria 24059
199 Ga0097620_100101507 3300006931 Bacteria 2934
200 Ga0097620_100357572 3300006931 Bacteria 1555
201 Ga0075435_100170830 3300007076 Bacteria 1834
202 Ga0111539_10644569 3300009094 Bacteria 1233
203 Ga0105245_10061239 3300009098 Bacteria 3392
204 Ga0105245_10112084 3300009098 Bacteria 2538
205 Ga0114129_10080001 3300009147 Bacteria 4544
206 Ga0105243_10042764 3300009148 Bacteria 3548
207 Ga0105243_10149234 3300009148 Bacteria 2004
208 Ga0105241_10050051 3300009174 Bacteria 3184
209 Ga0105242_10129773 3300009176 Bacteria 2174
210 Ga0105248_10008335 3300009177 Bacteria 11388
211 Ga0105248_10011079 3300009177 Bacteria 9946
212 Ga0105248_10018942 3300009177 Bacteria 7611
213 Ga0105248_10232105 3300009177 Bacteria 2077
214 Ga0105237_10004861 3300009545 Bacteria 15417
215 Ga0105237_10035404 3300009545 Bacteria 5052
216 Ga0105238_10016299 3300009551 Bacteria 7521
217 Ga0105238_10152230 3300009551 Bacteria 2288
218 Ga0105249_10074684 3300009553 Bacteria 3139
219 Ga0105239_10030119 3300010375 Bacteria 5967
220 Ga0105246_10061627 3300011119 Bacteria 2611
221 Ga0157370_10162346 3300013104 Bacteria 2079
222 Ga0157370_10530964 3300013104 Bacteria 1079
223 Ga0157369_10058720 3300013105 Bacteria 4149
224 Ga0157374_10031054 3300013296 Bacteria 4851
225 Ga0157374_10040878 3300013296 Bacteria 4271
226 Ga0157374_10052887 3300013296 Bacteria 3784
227 Ga0157374_10064219 3300013296 Bacteria 3444
228 Ga0157374_10260256 3300013296 Bacteria 1709
229 Ga0157378_10192154 3300013297 Bacteria 1926
230 Ga0157378_10716694 3300013297 Bacteria 1021
231 Ga0163162_10047853 3300013306 Bacteria 4284
232 Ga0163162_10178661 3300013306 Bacteria 2248
233 Ga0163162_10206812 3300013306 Bacteria 2092
234 Ga0163162_10271665 3300013306 Bacteria 1827
235 Ga0157372_10013740 3300013307 Bacteria 8651
236 Ga0157372_10163891 3300013307 Bacteria 2570
237 Ga0157372_10368357 3300013307 Bacteria 1674
238 Ga0157375_10005174 3300013308 Bacteria 11316
239 Ga0157375_10014262 3300013308 Bacteria 7084
240 Ga0157375_10027908 3300013308 Bacteria 5281
241 Ga0157375_10043978 3300013308 Bacteria 4334
242 Ga0157375_10203394 3300013308 Bacteria 2136
243 Ga0157375_10239083 3300013308 Bacteria 1976
244 Ga0157375_10417487 3300013308 Bacteria 1508
245 Ga0163163_10003570 3300014325 Bacteria 13205
246 Ga0163163_10115810 3300014325 Bacteria 2711
247 Ga0163163_10170197 3300014325 Bacteria 2225
248 Ga0163163_10313596 3300014325 Bacteria 1622
249 Ga0157380_10088041 3300014326 Bacteria 2554
250 Ga0157380_10159855 3300014326 Bacteria 1957
251 Ga0157380_10215411 3300014326 Bacteria 1715
252 Ga0157380_10363464 3300014326 Bacteria 1359
253 Ga0157377_10001565 3300014745 Bacteria 9949
254 Ga0157377_10169007 3300014745 Bacteria 1366
255 Ga0157379_10010130 3300014968 Bacteria 8218
256 Ga0157379_10020334 3300014968 Bacteria 5869
257 Ga0157379_10043362 3300014968 Bacteria 4017
258 Ga0157379_10214716 3300014968 Bacteria 1742
259 Ga0157379_10229954 3300014968 Bacteria 1681
260 Ga0157379_10350325 3300014968 Bacteria 1352
261 Ga0157379_10424267 3300014968 Bacteria 1225
262 Ga0157376_10003307 3300014969 Bacteria 11099
263 Ga0157376_10077851 3300014969 Bacteria 2837
264 Ga0157376_10154832 3300014969 Bacteria 2071
265 Ga0157376_10239807 3300014969 Bacteria 1689
266 Ga0157376_10248362 3300014969 Bacteria 1661
267 Ga0163161_10006298 3300017792 Bacteria 8215
268 Ga0163161_10009331 3300017792 Bacteria 6789
269 Ga0163161_10430928 3300017792 Bacteria 1063
270 Ga0207425_1000802 3300025245 Bacteria 15938
271 Ga0209129_1000012 3300025258 Bacteria 541516
272 Ga0209564_1000022 3300025295 Bacteria 555109
273 Ga0209758_1000124 3300025297 Bacteria 189933
274 Ga0209758_1000234 3300025297 Bacteria 116217
275 Ga0207697_10003064 3300025315 Bacteria 8383
276 Ga0207697_10015695 3300025315 Bacteria 3126
277 Ga0207656_10067121 3300025321 Bacteria 1587
278 Ga0207682_10002801 3300025893 Bacteria 7710
279 Ga0207682_10005911 3300025893 Bacteria 4951
280 Ga0207682_10011716 3300025893 Bacteria 3427
281 Ga0207682_10033543 3300025893 Bacteria 2067
282 Ga0207682_10058226 3300025893 Bacteria 1612
283 Ga0207682_10092786 3300025893 Bacteria 1311
284 Ga0207642_10010828 3300025899 Bacteria 3231
285 Ga0207688_10058002 3300025901 Bacteria 2178
286 Ga0207688_10058459 3300025901 Bacteria 2169
287 Ga0207688_10227898 3300025901 Bacteria 1124
288 Ga0207680_10010662 3300025903 Bacteria 4608
289 Ga0207680_10058549 3300025903 Bacteria 2336
290 Ga0207645_10023445 3300025907 Bacteria 4012
291 Ga0207645_10024932 3300025907 Bacteria 3874
292 Ga0207645_10027684 3300025907 Bacteria 3659
293 Ga0207645_10049830 3300025907 Bacteria 2674
294 Ga0207645_10082477 3300025907 Bacteria 2061
295 Ga0207645_10204488 3300025907 Bacteria 1299
296 Ga0207645_10206752 3300025907 Bacteria 1292
297 Ga0207643_10084950 3300025908 Bacteria 1838
298 Ga0207643_10197607 3300025908 Bacteria 1223
299 Ga0207705_10033024 3300025909 Bacteria 3698
300 Ga0207684_10003264 3300025910 Bacteria 15912
301 Ga0207654_10052847 3300025911 Bacteria 2343
302 Ga0207707_10092626 3300025912 Bacteria 2641
303 Ga0207671_10023595 3300025914 Bacteria 4638
304 Ga0207671_10048096 3300025914 Bacteria 3156
305 Ga0207660_10056055 3300025917 Bacteria 2819
306 Ga0207662_10006607 3300025918 Bacteria 6264
307 Ga0207649_10041035 3300025920 Bacteria 2816
308 Ga0207649_10063732 3300025920 Bacteria 2328
309 Ga0207652_10009072 3300025921 Bacteria 8011
310 Ga0207681_10003514 3300025923 Bacteria 9755
311 Ga0207681_10025216 3300025923 Bacteria 3822
312 Ga0207681_10037524 3300025923 Bacteria 3203
313 Ga0207681_10470868 3300025923 Bacteria 1025
314 Ga0207650_10001276 3300025925 Bacteria 18258
315 Ga0207650_10007499 3300025925 Bacteria 7439
316 Ga0207650_10023626 3300025925 Bacteria 4362
317 Ga0207650_10127027 3300025925 Bacteria 1991
318 Ga0207650_10205477 3300025925 Bacteria 1579
319 Ga0207659_10002886 3300025926 Bacteria 10227
320 Ga0207659_10011834 3300025926 Bacteria 5526
321 Ga0207659_10014054 3300025926 Bacteria 5153
322 Ga0207659_10057723 3300025926 Bacteria 2785
323 Ga0207687_10065044 3300025927 Bacteria 2589
324 Ga0207687_10100888 3300025927 Bacteria 2124
325 Ga0207687_10329200 3300025927 Bacteria 1239
326 Ga0207644_10000523 3300025931 Bacteria 24867
327 Ga0207644_10001757 3300025931 Bacteria 14039
328 Ga0207644_10024131 3300025931 Bacteria 4172
329 Ga0207644_10026585 3300025931 Bacteria 3989
330 Ga0207644_10057199 3300025931 Bacteria 2815
331 Ga0207690_10101872 3300025932 Bacteria 2052
332 Ga0207706_10001906 3300025933 Bacteria 20489
333 Ga0207706_10006211 3300025933 Bacteria 11101
334 Ga0207706_10019872 3300025933 Bacteria 6038
335 Ga0207706_10024686 3300025933 Bacteria 5387
336 Ga0207706_10043492 3300025933 Bacteria 3980
337 Ga0207706_10125634 3300025933 Bacteria 2256
338 Ga0207686_10174035 3300025934 Bacteria 1521
339 Ga0207709_10048637 3300025935 Bacteria 2585
340 Ga0207670_10183929 3300025936 Bacteria 1576
341 Ga0207669_10016372 3300025937 Bacteria 3765
342 Ga0207669_10342931 3300025937 Bacteria 1151
343 Ga0207704_10032069 3300025938 Bacteria 2968
344 Ga0207704_10070145 3300025938 Bacteria 2218
345 Ga0207691_10003381 3300025940 Bacteria 15525
346 Ga0207691_10044552 3300025940 Bacteria 4083
347 Ga0207691_10061268 3300025940 Bacteria 3418
348 Ga0207691_10101973 3300025940 Bacteria 2560
349 Ga0207691_10109769 3300025940 Bacteria 2454
350 Ga0207691_10131704 3300025940 Bacteria 2208
351 Ga0207691_10149842 3300025940 Bacteria 2051
352 Ga0207711_10004582 3300025941 Bacteria 11755
353 Ga0207711_10008794 3300025941 Bacteria 8444
354 Ga0207711_10028615 3300025941 Bacteria 4692
355 Ga0207711_10048247 3300025941 Bacteria 3643
356 Ga0207711_10149051 3300025941 Bacteria 2110
357 Ga0207689_10003664 3300025942 Bacteria 14006
358 Ga0207689_10035048 3300025942 Bacteria 4169
359 Ga0207689_10063010 3300025942 Bacteria 3049
360 Ga0207661_10037727 3300025944 Bacteria 3782
361 Ga0207661_10203771 3300025944 Bacteria 1740
362 Ga0207679_10008387 3300025945 Bacteria 6580
363 Ga0207679_10030713 3300025945 Bacteria 3754
364 Ga0207679_10093087 3300025945 Bacteria 2336
365 Ga0207679_10234094 3300025945 Bacteria 1553
366 Ga0207679_10266734 3300025945 Bacteria 1463
367 Ga0207679_10337306 3300025945 Bacteria 1310
368 Ga0207651_10001062 3300025960 Bacteria 12183
369 Ga0207651_10014368 3300025960 Bacteria 4568
370 Ga0207651_10375358 3300025960 Bacteria 1204
371 Ga0207651_10410093 3300025960 Bacteria 1154
372 Ga0207651_10479793 3300025960 Bacteria 1071
373 Ga0207712_10048342 3300025961 Bacteria 2959
374 Ga0207712_10097655 3300025961 Bacteria 2177
375 Ga0207668_10020637 3300025972 Bacteria 4190
376 Ga0207668_10033710 3300025972 Bacteria 3394
377 Ga0207668_10178318 3300025972 Bacteria 1673
378 Ga0207640_10049149 3300025981 Bacteria 2729
379 Ga0207640_10073760 3300025981 Bacteria 2307
380 Ga0207640_10087561 3300025981 Bacteria 2147
381 Ga0207640_10202395 3300025981 Bacteria 1506
382 Ga0207658_10016179 3300025986 Bacteria 5125
383 Ga0207658_10140191 3300025986 Bacteria 1955
384 Ga0207658_10202601 3300025986 Bacteria 1658
385 Ga0207658_10210366 3300025986 Bacteria 1629
386 Ga0207658_10403049 3300025986 Bacteria 1203
387 Ga0207658_10552786 3300025986 Bacteria 1030
388 Ga0207677_10002493 3300026023 Bacteria 9661
389 Ga0207677_10028700 3300026023 Bacteria 3524
390 Ga0207677_10134704 3300026023 Bacteria 1881
391 Ga0207677_10151054 3300026023 Bacteria 1792
392 Ga0207703_10005450 3300026035 Bacteria 10235
393 Ga0207703_10036096 3300026035 Bacteria 3932
394 Ga0207639_10117864 3300026041 Bacteria 2176
395 Ga0207639_10489276 3300026041 Bacteria 1122
396 Ga0207678_10040687 3300026067 Bacteria 4030
397 Ga0207678_10082065 3300026067 Bacteria 2759
398 Ga0207678_10112336 3300026067 Bacteria 2324
399 Ga0207678_10154674 3300026067 Bacteria 1958
400 Ga0207708_10012477 3300026075 Bacteria 6333
401 Ga0207708_10233638 3300026075 Bacteria 1477
402 Ga0207708_10460076 3300026075 Bacteria 1061
403 Ga0207702_10099445 3300026078 Bacteria 2564
404 Ga0207641_10002150 3300026088 Bacteria 18573
405 Ga0207641_10009103 3300026088 Bacteria 8202
406 Ga0207641_10019205 3300026088 Bacteria 5608
407 Ga0207641_10021621 3300026088 Bacteria 5285
408 Ga0207641_10059586 3300026088 Bacteria 3251
409 Ga0207641_10115113 3300026088 Bacteria 2390
410 Ga0207648_10004239 3300026089 Bacteria 14817
411 Ga0207648_10010311 3300026089 Bacteria 8871
412 Ga0207648_10021145 3300026089 Bacteria 5850
413 Ga0207648_10039013 3300026089 Bacteria 4178
414 Ga0207648_10094008 3300026089 Bacteria 2621
415 Ga0207648_10143164 3300026089 Bacteria 2108
416 Ga0207648_10311599 3300026089 Bacteria 1413
417 Ga0207648_10358799 3300026089 Bacteria 1315
418 Ga0207676_10004991 3300026095 Bacteria 9400
419 Ga0207676_10011582 3300026095 Bacteria 6306
420 Ga0207676_10033040 3300026095 Bacteria 3906
421 Ga0207676_10045595 3300026095 Bacteria 3388
422 Ga0207676_10079068 3300026095 Bacteria 2666
423 Ga0207676_10254464 3300026095 Bacteria 1582
424 Ga0207676_10551427 3300026095 Bacteria 1101
425 Ga0207674_10159975 3300026116 Bacteria 2206
426 Ga0207674_10184093 3300026116 Bacteria 2039
427 Ga0207675_100008151 3300026118 Bacteria 9875
428 Ga0207675_100023191 3300026118 Bacteria 5771
429 Ga0207675_100161335 3300026118 Bacteria 2138
430 Ga0207675_100187106 3300026118 Bacteria 1985
431 Ga0207683_10025450 3300026121 Bacteria 5106
432 Ga0207683_10080603 3300026121 Bacteria 2888
433 Ga0207683_10083536 3300026121 Bacteria 2838
434 Ga0207683_10156000 3300026121 Bacteria 2062
435 Ga0207683_10163204 3300026121 Bacteria 2015
436 Ga0207683_10195091 3300026121 Bacteria 1839
437 Ga0207698_10016587 3300026142 Bacteria 4970
438 Ga0207698_10044118 3300026142 Bacteria 3347
439 Ga0207698_10136893 3300026142 Bacteria 2103
440 Ga0207698_10157641 3300026142 Bacteria 1980
441 Ga0207698_10245947 3300026142 Bacteria 1633
442 Ga0209813_10001726 3300027866 Bacteria 4922
443 Ga0209813_10006806 3300027866 Bacteria 2832
444 Ga0209813_10069947 3300027866 Bacteria 1139
445 Ga0209974_10001641 3300027876 Bacteria 8098
446 Ga0268266_10060195 3300028379 Bacteria 3273
447 Ga0268266_10072607 3300028379 Bacteria 2985
448 Ga0268266_10166821 3300028379 Bacteria 1996
449 Ga0268266_10190097 3300028379 Bacteria 1874
450 Ga0268265_10106367 3300028380 Bacteria 2279
451 Ga0268265_10162748 3300028380 Bacteria 1898
452 Ga0268264_10003375 3300028381 Bacteria 13788
453 Ga0268264_10020755 3300028381 Bacteria 5368
454 Ga0268264_10206482 3300028381 Bacteria 1800
455 Ga0307517_10077045 3300028786 Bacteria 2903
456 Ga0307517_10088076 3300028786 Bacteria 2571
457 Ga0307515_10000138 3300028794 Bacteria 173220
458 Ga0307515_10001206 3300028794 Bacteria 59045
459 Ga0307515_10011495 3300028794 Bacteria 16801
460 Ga0307515_10087663 3300028794 Bacteria 3946
461 Ga0307512_10059574 3300030522 Bacteria 2961
462 Ga0307512_10109888 3300030522 Bacteria 1822
463 Ga0265328_10013306 3300031239 Bacteria 3261
464 Ga0307513_10017125 3300031456 Bacteria 8704
465 Ga0307513_10098065 3300031456 Bacteria 2963
466 Ga0307513_10106681 3300031456 Bacteria 2806
467 Ga0307513_10277999 3300031456 Bacteria 1453
468 Ga0307513_10341078 3300031456 Bacteria 1249
469 Ga0307509_10000249 3300031507 Bacteria 87094
470 Ga0307509_10003703 3300031507 Bacteria 22876
471 Ga0307509_10197563 3300031507 Bacteria 1853
472 Ga0307508_10000216 3300031616 Bacteria 69990
473 Ga0307508_10006698 3300031616 Bacteria 10804
474 Ga0307514_10015854 3300031649 Bacteria 6210
475 Ga0307516_10006485 3300031730 Bacteria 13704
476 Ga0307516_10174805 3300031730 Bacteria 1885
477 Ga0307405_10118973 3300031731 Bacteria 1804
478 Ga0307413_10057428 3300031824 Bacteria 2380
479 Ga0307413_10115720 3300031824 Unclassified 1805
480 Ga0307410_10138158 3300031852 Bacteria 1799
481 Ga0307406_10023123 3300031901 Bacteria 3696
482 Ga0307407_10210016 3300031903 Bacteria 1310
483 Ga0307412_10027498 3300031911 Bacteria 3547
484 Ga0307412_10034896 3300031911 Bacteria 3209
485 Ga0307409_100131501 3300031995 Bacteria 2140
486 Ga0307409_100304806 3300031995 Bacteria 1484
487 Ga0307416_100014114 3300032002 Bacteria 5457
488 Ga0307416_100061065 3300032002 Bacteria 3074
489 Ga0307411_10012282 3300032005 Bacteria 4665
490 Ga0307411_10016314 3300032005 Bacteria 4202
491 Ga0307507_10058387 3300033179 Bacteria 3623
492 Ga0307510_10009738 3300033180 Bacteria 11436
493 Ga0373949_0046589 3300035090 Bacteria 1081
494 Ga0373956_0094396 3300035119 Bacteria 1382
495 Ga0373957_0093147 3300035120 Bacteria 1200
496 Ga0373955_0065797 3300035172 Bacteria 2013
497 Ga0373931_0002695 3300035691 Bacteria 7904
498 Ga0373935_0129552 3300035692 Bacteria 1694
499 Ga0373947_0074319 3300035725 Bacteria 2091
500 Ga0373937_0044214 3300036401 Bacteria 4067
501 Ga0373925_0050008 3300037068 Bacteria 3117
502 Ga0395905_0000140 3300037471 Bacteria 120221
503 Ga0395905_0010653 3300037471 Bacteria 8919
504 Ga0395905_0285650 3300037471 Bacteria 1537
505 Ga0436363_0457939 3300039450 Bacteria 2488
506 Ga0451793_0320329 3300041452 Bacteria 949
507 Ga0451793_0659484 3300041452 Bacteria 2027
508 Ga0451798_0362761 3300041458 Bacteria 2178
509 Ga0451804_0090619 3300041463 Bacteria 1251
510 Ga0451807_0096601 3300041486 Bacteria 1451
511 Ga0451841_0104201 3300041498 Bacteria 1678
512 Ga0451853_1937147 3300041512 Bacteria 1393
513 Ga0466969_0000020 3300044656 Bacteria 101861
514 Ga0466972_0000594 3300044658 Bacteria 17607
515 Ga0466972_0034624 3300044658 Bacteria 2473
516 Ga0466965_0040007 3300044683 Bacteria 2306
517 Ga0466965_0040218 3300044683 Bacteria 2301
518 Ga0466965_0070563 3300044683 Bacteria 1756
519 Ga0466966_0030555 3300044684 Bacteria 3496
520 Ga0466961_0019127 3300044693 Bacteria 4407
521 Ga0466961_0187416 3300044693 Bacteria 1283
522 Ga0453684_0020128 3300044712 Bacteria 10096
523 Ga0453684_0086122 3300044712 Bacteria 3900
524 Ga0466971_0064726 3300044719 Bacteria 1655
525 Ga0466970_0046815 3300044765 Bacteria 2304
526 Ga0466957_0047364 3300044842 Bacteria 2612
527 Ga0466960_0184303 3300044901 Bacteria 1133
528 Ga0451576_0212037 3300045051 Bacteria 2022
529 Ga0466967_0291581 3300045976 Bacteria 1568
530 Ga0495592_0001883 3300046454 Bacteria 14765
531 Ga0495629_0148636 3300046459 Bacteria 1629
532 Ga0495582_0252674 3300046473 Bacteria 1011
533 Ga0495628_0242193 3300046516 Bacteria 1349
534 Ga0495632_0010839 3300046519 Bacteria 5362
535 Ga0495632_0035845 3300046519 Bacteria 2527
536 Ga0495598_0048524 3300046537 Bacteria 1270
537 Ga0495645_0062606 3300046543 Bacteria 2695
538 Ga0495668_0153315 3300046616 Bacteria 1262
539 Ga0495625_0004997 3300046660 Bacteria 12312
540 Ga0495647_0003210 3300046681 Bacteria 5230
541 Ga0495658_0052347 3300046683 Bacteria 2315
542 Ga0495658_0224679 3300046683 Bacteria 1176
543 Ga0495684_0111770 3300047471 Bacteria 2061
544 Ga0495686_0182833 3300047472 Bacteria 1214
545 Ga0496100_0004969 3300048903 Bacteria 7109
546 Ga0496102_0002898 3300048905 Bacteria 14539
547 Ga0496102_0066858 3300048905 Bacteria 3295
548 Ga0496104_0146090 3300048907 Bacteria 2271
549 Ga0496105_0126952 3300048908 Bacteria 2103
550 Ga0496106_0025160 3300048909 Bacteria 4428
551 Ga0496107_0003649 3300048910 Bacteria 10348
552 Ga0496108_0014761 3300048911 Bacteria 6376
553 Ga0496109_0185242 3300048912 Bacteria 1956
554 Ga0496110_0034479 3300048913 Bacteria 4384
555 Ga0496111_0246096 3300048914 Bacteria 1327
556 Ga0496112_0241198 3300048915 Bacteria 1760
557 nmdc:mga03683_159822_c1 3300050489 Bacteria 1020
558 nmdc:mga03n38_164991_c1 3300050490 Bacteria 1124
559 nmdc:mga03n38_208194_c1 3300050490 Bacteria 1015
560 nmdc:mga03n38_24590_c1 3300050490 Bacteria 2464
561 nmdc:mga0k408_105924_c1 3300050493 Bacteria 1661
562 nmdc:mga0k408_1135_c1 3300050493 Bacteria 14614
563 nmdc:mga0k408_1245_c1 3300050493 Bacteria 13917
564 nmdc:mga0k408_32874_c1 3300050493 Bacteria 2964
565 nmdc:mga0k408_4061_c1 3300050493 Bacteria 7765
566 nmdc:mga0k408_49318_c1 3300050493 Bacteria 2437
567 nmdc:mga0k408_669_c1 3300050493 Bacteria 18779
568 nmdc:mga0k408_7292_c1 3300050493 Bacteria 5907
569 nmdc:mga06z11_215045_c1 3300050494 Bacteria 1121
570 nmdc:mga06z11_2171_c1 3300050494 Bacteria 7447
571 nmdc:mga06z11_8664_c1 3300050494 Bacteria 4255
572 nmdc:mga04h51_15581_c1 3300050495 Bacteria 2192
573 nmdc:mga04h51_1899_c1 3300050495 Bacteria 4876
574 nmdc:mga07m45_10728_c1 3300050496 Bacteria 4794
575 nmdc:mga07m45_1153_c1 3300050496 Bacteria 11861
576 nmdc:mga07m45_3113_c1 3300050496 Bacteria 7940
577 nmdc:mga07m45_52553_c1 3300050496 Bacteria 2300
578 nmdc:mga07m45_6321_c1 3300050496 Bacteria 5984
579 nmdc:mga0sz30_30396_c1 3300050516 Bacteria 2231
580 nmdc:mga0sz30_8564_c1 3300050516 Bacteria 3865
581 Ga0495601_0032063 3300053077 Bacteria 3269
582 Ga0500578_0000673 3300053086 Bacteria 40901
583 Ga0500651_0276409 3300053093 Bacteria 970
584 Ga0500650_0046776 3300053098 Bacteria 2005
585 Ga0500562_024019 3300053108 Bacteria 1593
586 Ga0500593_000680 3300053117 Bacteria 12914
587 Ga0500607_078551 3300053121 Bacteria 1687
588 Ga0500628_019472 3300053129 Bacteria 1351
589 Ga0500652_056670 3300053131 Bacteria 1607
590 Ga0500568_0028336 3300053139 Bacteria 2335
591 Ga0500619_000006 3300053154 Bacteria 77270
592 Ga0500619_009997 3300053154 Bacteria 2379
593 Ga0500622_0000872 3300053156 Bacteria 25676
594 Ga0500570_053603 3300053724 Bacteria 2008
595 Ga0500587_000047 3300053739 Bacteria 9955
596 Ga0466962_0006584 3300061719 Bacteria 5573
597 Ga0466962_0037915 3300061719 Bacteria 2309
598 2587725241 2585428057 Bacteria 6737412
599 2587731403 2585428058 Bacteria 6853932
600 2587759504 2585428062 Bacteria 6842168
601 Ga0070662_100001432
602 JGI24033J26618_1014872
603 JGI25152J39213_1000662
604 JGI25153J46596_10003371
605 JGI25153J46596_10007545
606 rootH1_10004482
607 Ga0055526_1001626
608 Ga0070658_10016712
609 Ga0070676_10017134
610 Ga0070676_10021221
611 Ga0070676_10034601
612 Ga0070690_100017758
613 Ga0070690_100028629
614 Ga0070670_100013611
615 Ga0070670_100021917
616 Ga0070670_100026210
617 Ga0070670_100034305
618 Ga0070670_100080193
619 Ga0070670_100099934
620 Ga0070677_10005615
621 Ga0070677_10015649
622 Ga0070677_10052567
623 Ga0070677_10054709
624 Ga0070677_10063098
625 Ga0068869_100003488
626 Ga0068869_100031544
627 Ga0068869_100168989
628 Ga0070666_10004086
629 Ga0070666_10114353
630 Ga0070666_10217538
631 Ga0070666_10229530
632 Ga0068868_100001343
633 Ga0068868_100003534
634 Ga0068868_100046664
635 Ga0068868_100060065
636 Ga0068868_100069894
637 Ga0068868_100329171
638 Ga0070660_100083259
639 Ga0070689_100156502
640 Ga0070661_100108494
641 Ga0070661_100181398
642 Ga0070661_100225204
643 Ga0070668_100043016
644 Ga0070668_100277076
645 Ga0070669_100044294
646 Ga0070669_100050718
647 Ga0070669_100155058
648 Ga0070669_100173734
649 Ga0070675_100003418
650 Ga0070675_100010402
651 Ga0070675_100133968
652 Ga0070675_100137894
653 Ga0070675_100343512
654 Ga0070671_100008407
655 Ga0070671_100020559
656 Ga0070671_100135962
657 Ga0070671_100169440
658 Ga0070671_100232935
659 Ga0070674_100121621
660 Ga0070673_100002371
661 Ga0070673_100120925
662 Ga0070673_100295974
663 Ga0070673_100321953
664 Ga0070688_100019843
665 Ga0070659_100011449
666 Ga0070659_100122710
667 Ga0070667_100012357
668 Ga0070667_100030336
669 Ga0070667_100138756
670 Ga0070700_100067380
671 Ga0070708_100338018
672 Ga0070663_100107129
673 Ga0070663_100109227
674 Ga0070663_100284977
675 Ga0070678_100006062
676 Ga0070678_100033281
677 Ga0070678_100081202
678 Ga0070678_100163811
679 Ga0070678_100282192
680 Ga0070662_100005695
681 Ga0070662_100028238
682 Ga0070662_100031932
683 Ga0070681_10017630
684 Ga0068867_100005426
685 Ga0068867_100011992
686 Ga0068867_100014496
687 Ga0068867_100017829
688 Ga0068867_100030867
689 Ga0068867_100064789
690 Ga0068867_100071487
691 Ga0070707_100026153
692 Ga0070679_100000726
693 Ga0070684_100005261
694 Ga0070684_100451596
695 Ga0068853_100006811
696 Ga0068853_100435425
697 Ga0070672_100025769
698 Ga0070672_100026382
699 Ga0070672_100047279
700 Ga0070672_100086298
701 Ga0070686_100082995
702 Ga0070686_100209678
703 Ga0070686_100364279
704 Ga0070693_100041764
705 Ga0070693_100044620
706 Ga0070665_100007443
707 Ga0070665_100104794
708 Ga0070665_100115538
709 Ga0068855_100018761
710 Ga0070664_100015313
711 Ga0070664_100224211
712 Ga0070664_100304190
713 Ga0070664_100343636
714 Ga0070664_100472159
715 Ga0068857_100010507
716 Ga0068854_100013710
717 Ga0068854_100085075
718 Ga0068854_100093842
719 Ga0068856_100013192
720 Ga0068856_100074496
721 Ga0070702_100169659
722 Ga0068852_100009092
723 Ga0068852_100013380
724 Ga0068852_100066202
725 Ga0068852_100085162
726 Ga0068852_100114694
727 Ga0068852_100128266
728 Ga0068852_100185077
729 Ga0068852_100187166
730 Ga0068859_100001451
731 Ga0068859_100101507
732 Ga0068859_100357592
733 Ga0068864_100002901
734 Ga0068864_100009398
735 Ga0068864_100104355
736 Ga0068864_100201517
737 Ga0068864_100233074
738 Ga0068866_10019689
739 Ga0068866_10087404
740 Ga0068866_10130962
741 Ga0068861_100005459
742 Ga0068861_100013781
743 Ga0068861_100145774
744 Ga0068861_100329349
745 Ga0068851_10008150
746 Ga0068851_10207598
747 Ga0068863_100010181
748 Ga0068863_100018287
749 Ga0068863_100040067
750 Ga0068863_100154915
751 Ga0068863_100831740
752 Ga0068858_100010630
753 Ga0068858_100285693
754 Ga0068858_100368842
755 Ga0068860_100039824
756 Ga0068860_100172465
757 Ga0068860_100182469
758 Ga0068862_100042040
759 Ga0068862_100086453
760 Ga0075368_10000682
761 Ga0075368_10018606
762 Ga0075363_100024753
763 Ga0075363_100061252
764 Ga0075363_100224254
765 Ga0075364_10124329
766 Ga0070715_10179035
767 Ga0075362_10016796
768 Ga0075362_10042877
769 Ga0075367_10032551
770 Ga0075367_10048227
771 Ga0075367_10049792
772 Ga0075369_10018641
773 Ga0075369_10020713
774 Ga0075369_10028340
775 Ga0075366_10001768
776 Ga0075366_10005954
777 Ga0075366_10021753
778 Ga0075366_10040736
779 Ga0075366_10095314
780 Ga0075366_10137621
781 Ga0075366_10221944
782 Ga0097621_100009144
783 Ga0097621_100009422
784 Ga0097621_100033628
785 Ga0097621_100044849
786 Ga0097621_100151519
787 Ga0075370_10001151
788 Ga0075370_10012585
789 Ga0075370_10024268
790 Ga0068871_100006200
791 Ga0068871_100008132
792 Ga0068871_100016972
793 Ga0068871_100076558
794 Ga0068871_100082655
795 Ga0068871_100318388
796 Ga0068865_100041024
797 Ga0068865_100091208
798 Ga0097620_100001451
799 Ga0097620_100101507
800 Ga0097620_100357572
801 Ga0075435_100170830
802 Ga0111539_10644569
803 Ga0105245_10061239
804 Ga0105245_10112084
805 Ga0114129_10080001
806 Ga0105243_10042764
807 Ga0105243_10149234
808 Ga0105241_10050051
809 Ga0105242_10129773
810 Ga0105248_10008335
811 Ga0105248_10011079
812 Ga0105248_10018942
813 Ga0105248_10232105
814 Ga0105237_10004861
815 Ga0105237_10035404
816 Ga0105238_10016299
817 Ga0105238_10152230
818 Ga0105249_10074684
819 Ga0105239_10030119
820 Ga0105246_10061627
821 Ga0157370_10162346
822 Ga0157370_10530964
823 Ga0157369_10058720
824 Ga0157374_10031054
825 Ga0157374_10040878
826 Ga0157374_10052887
827 Ga0157374_10064219
828 Ga0157374_10260256
829 Ga0157378_10192154
830 Ga0157378_10716694
831 Ga0163162_10047853
832 Ga0163162_10178661
833 Ga0163162_10206812
834 Ga0163162_10271665
835 Ga0157372_10013740
836 Ga0157372_10163891
837 Ga0157372_10368357
838 Ga0157375_10005174
839 Ga0157375_10014262
840 Ga0157375_10027908
841 Ga0157375_10043978
842 Ga0157375_10203394
843 Ga0157375_10239083
844 Ga0157375_10417487
845 Ga0163163_10003570
846 Ga0163163_10115810
847 Ga0163163_10170197
848 Ga0163163_10313596
849 Ga0157380_10088041
850 Ga0157380_10159855
851 Ga0157380_10215411
852 Ga0157380_10363464
853 Ga0157377_10001565
854 Ga0157377_10169007
855 Ga0157379_10010130
856 Ga0157379_10020334
857 Ga0157379_10043362
858 Ga0157379_10214716
859 Ga0157379_10229954
860 Ga0157379_10350325
861 Ga0157379_10424267
862 Ga0157376_10003307
863 Ga0157376_10077851
864 Ga0157376_10154832
865 Ga0157376_10239807
866 Ga0157376_10248362
867 Ga0163161_10006298
868 Ga0163161_10009331
869 Ga0163161_10430928
870 Ga0207425_1000802
871 Ga0209129_1000012
872 Ga0209564_1000022
873 Ga0209758_1000124
874 Ga0209758_1000234
875 Ga0207697_10003064
876 Ga0207697_10015695
877 Ga0207656_10067121
878 Ga0207682_10002801
879 Ga0207682_10005911
880 Ga0207682_10011716
881 Ga0207682_10033543
882 Ga0207682_10058226
883 Ga0207682_10092786
884 Ga0207642_10010828
885 Ga0207688_10058002
886 Ga0207688_10058459
887 Ga0207688_10227898
888 Ga0207680_10010662
889 Ga0207680_10058549
890 Ga0207645_10023445
891 Ga0207645_10024932
892 Ga0207645_10027684
893 Ga0207645_10049830
894 Ga0207645_10082477
895 Ga0207645_10204488
896 Ga0207645_10206752
897 Ga0207643_10084950
898 Ga0207643_10197607
899 Ga0207705_10033024
900 Ga0207684_10003264
901 Ga0207654_10052847
902 Ga0207707_10092626
903 Ga0207671_10023595
904 Ga0207671_10048096
905 Ga0207660_10056055
906 Ga0207662_10006607
907 Ga0207649_10041035
908 Ga0207649_10063732
909 Ga0207652_10009072
910 Ga0207681_10003514
911 Ga0207681_10025216
912 Ga0207681_10037524
913 Ga0207681_10470868
914 Ga0207650_10001276
915 Ga0207650_10007499
916 Ga0207650_10023626
917 Ga0207650_10127027
918 Ga0207650_10205477
919 Ga0207659_10002886
920 Ga0207659_10011834
921 Ga0207659_10014054
922 Ga0207659_10057723
923 Ga0207687_10065044
924 Ga0207687_10100888
925 Ga0207687_10329200
926 Ga0207644_10000523
927 Ga0207644_10001757
928 Ga0207644_10024131
929 Ga0207644_10026585
930 Ga0207644_10057199
931 Ga0207690_10101872
932 Ga0207706_10001906
933 Ga0207706_10006211
934 Ga0207706_10019872
935 Ga0207706_10024686
936 Ga0207706_10043492
937 Ga0207706_10125634
938 Ga0207686_10174035
939 Ga0207709_10048637
940 Ga0207670_10183929
941 Ga0207669_10016372
942 Ga0207669_10342931
943 Ga0207704_10032069
944 Ga0207704_10070145
945 Ga0207691_10003381
946 Ga0207691_10044552
947 Ga0207691_10061268
948 Ga0207691_10101973
949 Ga0207691_10109769
950 Ga0207691_10131704
951 Ga0207691_10149842
952 Ga0207711_10004582
953 Ga0207711_10008794
954 Ga0207711_10028615
955 Ga0207711_10048247
956 Ga0207711_10149051
957 Ga0207689_10003664
958 Ga0207689_10035048
959 Ga0207689_10063010
960 Ga0207661_10037727
961 Ga0207661_10203771
962 Ga0207679_10008387
963 Ga0207679_10030713
964 Ga0207679_10093087
965 Ga0207679_10234094
966 Ga0207679_10266734
967 Ga0207679_10337306
968 Ga0207651_10001062
969 Ga0207651_10014368
970 Ga0207651_10375358
971 Ga0207651_10410093
972 Ga0207651_10479793
973 Ga0207712_10048342
974 Ga0207712_10097655
975 Ga0207668_10020637
976 Ga0207668_10033710
977 Ga0207668_10178318
978 Ga0207640_10049149
979 Ga0207640_10073760
980 Ga0207640_10087561
981 Ga0207640_10202395
982 Ga0207658_10016179
983 Ga0207658_10140191
984 Ga0207658_10202601
985 Ga0207658_10210366
986 Ga0207658_10403049
987 Ga0207658_10552786
988 Ga0207677_10002493
989 Ga0207677_10028700
990 Ga0207677_10134704
991 Ga0207677_10151054
992 Ga0207703_10005450
993 Ga0207703_10036096
994 Ga0207639_10117864
995 Ga0207639_10489276
996 Ga0207678_10040687
997 Ga0207678_10082065
998 Ga0207678_10112336
999 Ga0207678_10154674
1000 Ga0207708_10012477
1001 Ga0207708_10233638
1002 Ga0207708_10460076
1003 Ga0207702_10099445
1004 Ga0207641_10002150
1005 Ga0207641_10009103
1006 Ga0207641_10019205
1007 Ga0207641_10021621
1008 Ga0207641_10059586
1009 Ga0207641_10115113
1010 Ga0207648_10004239
1011 Ga0207648_10010311
1012 Ga0207648_10021145
1013 Ga0207648_10039013
1014 Ga0207648_10094008
1015 Ga0207648_10143164
1016 Ga0207648_10311599
1017 Ga0207648_10358799
1018 Ga0207676_10004991
1019 Ga0207676_10011582
1020 Ga0207676_10033040
1021 Ga0207676_10045595
1022 Ga0207676_10079068
1023 Ga0207676_10254464
1024 Ga0207676_10551427
1025 Ga0207674_10159975
1026 Ga0207674_10184093
1027 Ga0207675_100008151
1028 Ga0207675_100023191
1029 Ga0207675_100161335
1030 Ga0207675_100187106
1031 Ga0207683_10025450
1032 Ga0207683_10080603
1033 Ga0207683_10083536
1034 Ga0207683_10156000
1035 Ga0207683_10163204
1036 Ga0207683_10195091
1037 Ga0207698_10016587
1038 Ga0207698_10044118
1039 Ga0207698_10136893
1040 Ga0207698_10157641
1041 Ga0207698_10245947
1042 Ga0209813_10001726
1043 Ga0209813_10006806
1044 Ga0209813_10069947
1045 Ga0209974_10001641
1046 Ga0268266_10060195
1047 Ga0268266_10072607
1048 Ga0268266_10166821
1049 Ga0268266_10190097
1050 Ga0268265_10106367
1051 Ga0268265_10162748
1052 Ga0268264_10003375
1053 Ga0268264_10020755
1054 Ga0268264_10206482
1055 Ga0307517_10077045
1056 Ga0307517_10088076
1057 Ga0307515_10000138
1058 Ga0307515_10001206
1059 Ga0307515_10011495
1060 Ga0307515_10087663
1061 Ga0307512_10059574
1062 Ga0307512_10109888
1063 Ga0265328_10013306
1064 Ga0307513_10017125
1065 Ga0307513_10098065
1066 Ga0307513_10106681
1067 Ga0307513_10277999
1068 Ga0307513_10341078
1069 Ga0307509_10000249
1070 Ga0307509_10003703
1071 Ga0307509_10197563
1072 Ga0307508_10000216
1073 Ga0307508_10006698
1074 Ga0307514_10015854
1075 Ga0307516_10006485
1076 Ga0307516_10174805
1077 Ga0307405_10118973
1078 Ga0307413_10057428
1079 Ga0307413_10115720
1080 Ga0307410_10138158
1081 Ga0307406_10023123
1082 Ga0307407_10210016
1083 Ga0307412_10027498
1084 Ga0307412_10034896
1085 Ga0307409_100131501
1086 Ga0307409_100304806
1087 Ga0307416_100014114
1088 Ga0307416_100061065
1089 Ga0307411_10012282
1090 Ga0307411_10016314
1091 Ga0307507_10058387
1092 Ga0307510_10009738
1093 Ga0373949_0046589
1094 Ga0373956_0094396
1095 Ga0373957_0093147
1096 Ga0373955_0065797
1097 Ga0373931_0002695
1098 Ga0373935_0129552
1099 Ga0373947_0074319
1100 Ga0373937_0044214
1101 Ga0373925_0050008
1102 Ga0395905_0000140
1103 Ga0395905_0010653
1104 Ga0395905_0285650
1105 Ga0436363_0457939
1106 Ga0451793_0320329
1107 Ga0451793_0659484
1108 Ga0451798_0362761
1109 Ga0451804_0090619
1110 Ga0451807_0096601
1111 Ga0451841_0104201
1112 Ga0451853_1937147
1113 Ga0466969_0000020
1114 Ga0466972_0000594
1115 Ga0466972_0034624
1116 Ga0466965_0040007
1117 Ga0466965_0040218
1118 Ga0466965_0070563
1119 Ga0466966_0030555
1120 Ga0466961_0019127
1121 Ga0466961_0187416
1122 Ga0453684_0020128
1123 Ga0453684_0086122
1124 Ga0466971_0064726
1125 Ga0466970_0046815
1126 Ga0466957_0047364
1127 Ga0466960_0184303
1128 Ga0451576_0212037
1129 Ga0466967_0291581
1130 Ga0495592_0001883
1131 Ga0495629_0148636
1132 Ga0495582_0252674
1133 Ga0495628_0242193
1134 Ga0495632_0010839
1135 Ga0495632_0035845
1136 Ga0495598_0048524
1137 Ga0495645_0062606
1138 Ga0495668_0153315
1139 Ga0495625_0004997
1140 Ga0495647_0003210
1141 Ga0495658_0052347
1142 Ga0495658_0224679
1143 Ga0495684_0111770
1144 Ga0495686_0182833
1145 Ga0496100_0004969
1146 Ga0496102_0002898
1147 Ga0496102_0066858
1148 Ga0496104_0146090
1149 Ga0496105_0126952
1150 Ga0496106_0025160
1151 Ga0496107_0003649
1152 Ga0496108_0014761
1153 Ga0496109_0185242
1154 Ga0496110_0034479
1155 Ga0496111_0246096
1156 Ga0496112_0241198
1157 nmdc:mga03683_159822_c1
1158 nmdc:mga03n38_164991_c1
1159 nmdc:mga03n38_208194_c1
1160 nmdc:mga03n38_24590_c1
1161 nmdc:mga0k408_105924_c1
1162 nmdc:mga0k408_1135_c1
1163 nmdc:mga0k408_1245_c1
1164 nmdc:mga0k408_32874_c1
1165 nmdc:mga0k408_4061_c1
1166 nmdc:mga0k408_49318_c1
1167 nmdc:mga0k408_669_c1
1168 nmdc:mga0k408_7292_c1
1169 nmdc:mga06z11_215045_c1
1170 nmdc:mga06z11_2171_c1
1171 nmdc:mga06z11_8664_c1
1172 nmdc:mga04h51_15581_c1
1173 nmdc:mga04h51_1899_c1
1174 nmdc:mga07m45_10728_c1
1175 nmdc:mga07m45_1153_c1
1176 nmdc:mga07m45_3113_c1
1177 nmdc:mga07m45_52553_c1
1178 nmdc:mga07m45_6321_c1
1179 nmdc:mga0sz30_30396_c1
1180 nmdc:mga0sz30_8564_c1
1181 Ga0495601_0032063
1182 Ga0500578_0000673
1183 Ga0500651_0276409
1184 Ga0500650_0046776
1185 Ga0500562_024019
1186 Ga0500593_000680
1187 Ga0500607_078551
1188 Ga0500628_019472
1189 Ga0500652_056670
1190 Ga0500568_0028336
1191 Ga0500619_000006
1192 Ga0500619_009997
1193 Ga0500622_0000872
1194 Ga0500570_053603
1195 Ga0500587_000047
1196 Ga0466962_0006584
1197 Ga0466962_0037915
1198 2587725241
1199 2587731403
1200 2587759504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04333

MlaA

MlaA lipoprotein

44

239

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i8r-assembly1.cif.gz_D cryo-em structure of ompc3-mlaa complex in msp2n2 nanodiscs 0.764 38 228
5nuo-assembly1.cif.gz_D structural basis for maintenance of bacterial outer membrane lipid asymmetry 0.7607 38 232
5nuq-assembly1.cif.gz_H structural basis for maintenance of bacterial outer membrane lipid asymmetry 0.7598 38 232
5nuq-assembly1.cif.gz_H structural basis for maintenance of bacterial outer membrane lipid asymmetry 0.743 38 232
8i8r-assembly1.cif.gz_D cryo-em structure of ompc3-mlaa complex in msp2n2 nanodiscs 0.7413 38 228
ID Description Score Start End Superfamily
af_Q57935_5_362_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.3672 75 146 1.10.645.10
4zl5F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3549 75 232 1.20.1260.10
2ib0B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.2958 72 204 1.20.1260.10
2ib0B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.292 72 204 1.20.1260.10
4zl5F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.2811 75 232 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A382TC89-F1-model_v4 VacJ lipoprotein 0.8969 34 216 GO:0016020
GO:0120010
AF-A0A382TC89-F1-model_v4 VacJ lipoprotein 0.8831 34 216 GO:0016020
GO:0120010
AF-A0A537E2Y9-F1-model_v4 VacJ family lipoprotein 0.8782 17 207 GO:0016020
GO:0120010
AF-A0A3B8TRL5-F1-model_v4 deleted 0.8782 52 231
AF-A0A3B8TRL5-F1-model_v4 deleted 0.8643 52 231

Map