F467968

General Info

Members Datasets Scaffolds Average Seq Length
600 293 1200 297

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10000515|Ga0105244_1000051518
Length 333
Sequence VTAVRFLTILARRINTAPRALCILWVENRKYKGFTMEAHTPISPQGPVFSTLICGYWRLMEWNMTPQQVLAFMEQHIEMGITTVDHADIYGGYQCEAAFGEALRLNPSLREKMQLVSKCGIATTADPDNKIGHYITDMQYIVDRAEQSLRNLRTDYLDLLLIHRPDPLMDADEVAEAFTRLHKSGKVKHFGVSNFTPAQFSLLQSRLPFSLVTNQLEISPIHQPAILDGTLDLCQQLRIKPMAWSCLGGGRLFSDTEFQPLRDELQTVANEIGADTIEQVVYAWVMRLPSQPLPIIGSGKIGRVQSALKSLSLEMTRQQWFRIRKAALGFDVP

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
41 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
42 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
43 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
44 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
82 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
83 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
87 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
88 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
89 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
90 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
91 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
138 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
139 2506520008 Serratia plymuthica AS12 Isolate Unclassified
140 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
141 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
142 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
143 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
144 2547132181 Kosakonia sacchari SP1 Isolate Stem
145 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
146 2561511199 Enterobacter sp. R4-368 Isolate Nodule
147 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
148 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
149 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
150 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
151 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
152 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
153 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
154 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
155 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
156 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
157 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
158 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
159 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
160 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
161 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
162 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
163 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
164 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
165 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
166 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
167 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
168 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
169 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
170 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
171 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
172 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
173 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
174 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
175 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
176 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
177 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
178 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
179 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
180 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
181 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
182 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
183 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
184 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
185 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
186 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
187 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
188 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
189 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
190 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
191 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
192 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
193 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
194 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
195 2636415599 Klebsiella variicola DX120E Isolate Unclassified
196 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
197 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
198 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
199 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
200 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
201 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
202 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
203 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
204 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
205 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
206 2751185917 Enterobacter sp. HK169 Isolate Unclassified
207 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
208 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
209 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
210 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
211 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
212 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
213 2775507074 Klebsiella sp. D5A Isolate Unclassified
214 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
215 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
216 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
217 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
218 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
219 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
220 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
221 2821118458 Enterobacter asburiae 609 Isolate Unclassified
222 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
223 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
224 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
225 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
226 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
227 2847085930 Erwinia persicina B64 Isolate Bulb
228 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
229 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
230 2865014394 Pantoea sp. R-71966 Isolate Unclassified
231 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
232 2876601092 Pantoea endophytica 596 Isolate Unclassified
233 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
234 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
235 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
236 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
237 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
238 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
239 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
240 2904504865 Serratia marcescens 1822 Isolate Unclassified
241 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
242 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
243 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
244 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
245 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
246 2919150387 Rahnella aceris 1817 Isolate Unclassified
247 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
248 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
249 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
250 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
251 2927143783 Rahnella sp. 2050 Isolate Unclassified
252 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
253 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
254 2932406140 Serratia sp. 2723 Isolate Rhizosphere
255 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
256 2937539931 Pantoea sp. LS15 Isolate Unclassified
257 2937967321 Serratia sp. YC16 Isolate Unclassified
258 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
259 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
260 2939577877 Serratia sp. 509 Isolate Rhizosphere
261 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
262 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
263 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
264 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
265 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
266 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
267 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
268 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
269 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
270 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
271 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
272 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
273 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
274 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
275 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
276 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
277 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
278 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
279 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
280 640753048 Serratia proteamaculans 568 Isolate Endosphere
281 8004592986 Serratia sp. S119 Isolate Unclassified
282 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
283 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
284 8018221730 Enterobacter sp. CM29 Isolate Unclassified
285 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
286 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
287 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
288 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
289 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
290 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
291 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
292 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
293 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.67
Metatranscriptomes 0.33
Isolates 26

Biome Distribution

Category Percentage (%)
Aerial Root 0.67
Bulb 0.17
Endosphere 5.33
Nodule 4
Rhizoplane 10.67
Rhizosphere 49.67
Stem 0.17
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10000515 3300009036 Bacteria 34521
2 SwRhRL2b_contig_1704300 2162886007 Bacteria 8880
3 JGI24739J22299_10002671 3300001989 Bacteria 6870
4 JGI25162J39368_1000112 3300002737 Bacteria 89231
5 JGI25162J39368_1002127 3300002737 Bacteria 8403
6 JGI25163J39215_1000184 3300002771 Bacteria 24136
7 JGI25164J39214_1000094 3300002772 Bacteria 89231
8 JGI25152J39213_1000258 3300002773 Bacteria 35248
9 rootH2_10017443 3300003320 Bacteria 26333
10 rootL2_10002646 3300003322 Bacteria 9548
11 rootH1_10224963 3300003323 Bacteria 1179
12 Ga0055538_1000076 3300003751 Bacteria 89231
13 Ga0055539_1000115 3300003752 Bacteria 89231
14 Ga0055533_1000121 3300003756 Bacteria 89231
15 Ga0055525_1000159 3300003759 Bacteria 89231
16 Ga0055536_1009618 3300003781 Bacteria 3964
17 Ga0055541_1000077 3300003841 Bacteria 89231
18 Ga0058692_1000066 3300003856 Bacteria 89302
19 Ga0058692_1000072 3300003856 Bacteria 77728
20 Ga0058692_1000173 3300003856 Bacteria 39993
21 Ga0058692_1000292 3300003856 Bacteria 25686
22 Ga0058692_1000344 3300003856 Bacteria 22672
23 Ga0058692_1002705 3300003856 Bacteria 5835
24 Ga0058692_1002706 3300003856 Bacteria 5835
25 Ga0058692_1003140 3300003856 Bacteria 5239
26 Ga0058692_1003633 3300003856 Bacteria 4719
27 Ga0058692_1004977 3300003856 Bacteria 3854
28 Ga0058692_1007471 3300003856 Bacteria 2896
29 Ga0065714_10066691 3300005288 Bacteria 6460
30 Ga0065704_10000300 3300005289 Bacteria 36961
31 Ga0065704_10000591 3300005289 Bacteria 20587
32 Ga0065704_10001991 3300005289 Bacteria 12017
33 Ga0065704_10003501 3300005289 Bacteria 6702
34 Ga0065704_10073427 3300005289 Bacteria 7173
35 Ga0070668_100010922 3300005347 Bacteria 6757
36 Ga0070665_100002066 3300005548 Bacteria 22531
37 Ga0070665_100086341 3300005548 Bacteria 3143
38 Ga0068857_100041214 3300005577 Bacteria 4095
39 Ga0075364_10010477 3300006051 Bacteria 5601
40 Ga0075366_10061785 3300006195 Bacteria 2227
41 Ga0079104_1000083 3300006946 Bacteria 137254
42 Ga0079104_1000218 3300006946 Bacteria 80243
43 Ga0079104_1000263 3300006946 Bacteria 69767
44 Ga0079104_1000598 3300006946 Bacteria 35772
45 Ga0079104_1000925 3300006946 Bacteria 23508
46 Ga0079104_1001280 3300006946 Bacteria 17400
47 Ga0079104_1001285 3300006946 Bacteria 17353
48 Ga0079104_1002310 3300006946 Bacteria 10515
49 Ga0079104_1002631 3300006946 Bacteria 9379
50 Ga0079104_1019883 3300006946 Bacteria 1864
51 Ga0079104_1021744 3300006946 Bacteria 1741
52 Ga0105251_10000189 3300009011 Bacteria 62590
53 Ga0105251_10001201 3300009011 Bacteria 22409
54 Ga0105251_10001220 3300009011 Bacteria 22244
55 Ga0105251_10001304 3300009011 Bacteria 21542
56 Ga0105251_10001620 3300009011 Bacteria 19103
57 Ga0105251_10001691 3300009011 Bacteria 18548
58 Ga0105251_10004096 3300009011 Bacteria 10206
59 Ga0105251_10005467 3300009011 Bacteria 8288
60 Ga0105251_10005817 3300009011 Bacteria 7991
61 Ga0105251_10019319 3300009011 Bacteria 3603
62 Ga0105251_10023173 3300009011 Bacteria 3209
63 Ga0105251_10067482 3300009011 Bacteria 1671
64 Ga0105251_10137291 3300009011 Bacteria 1107
65 Ga0105244_10000015 3300009036 Bacteria 256814
66 Ga0105244_10000070 3300009036 Bacteria 119389
67 Ga0105244_10000104 3300009036 Bacteria 86815
68 Ga0105244_10000554 3300009036 Bacteria 33368
69 Ga0105244_10000597 3300009036 Bacteria 32202
70 Ga0105244_10000645 3300009036 Bacteria 30769
71 Ga0105244_10001686 3300009036 Bacteria 17444
72 Ga0105244_10002973 3300009036 Bacteria 12479
73 Ga0105244_10003866 3300009036 Bacteria 10548
74 Ga0105244_10013340 3300009036 Bacteria 4809
75 Ga0105244_10025360 3300009036 Bacteria 3223
76 Ga0105244_10067052 3300009036 Bacteria 1796
77 Ga0105244_10077044 3300009036 Bacteria 1655
78 Ga0105244_10078474 3300009036 Bacteria 1637
79 Ga0105250_10000001 3300009092 Bacteria 617357
80 Ga0105250_10000113 3300009092 Bacteria 72385
81 Ga0105250_10000488 3300009092 Bacteria 27848
82 Ga0105250_10000525 3300009092 Bacteria 26718
83 Ga0105250_10001241 3300009092 Bacteria 14114
84 Ga0105250_10002568 3300009092 Bacteria 9059
85 Ga0105250_10005331 3300009092 Bacteria 5773
86 Ga0105250_10017078 3300009092 Bacteria 2950
87 Ga0105250_10017364 3300009092 Bacteria 2926
88 Ga0105247_10000129 3300009101 Bacteria 73190
89 Ga0105243_10075898 3300009148 Bacteria 2729
90 Ga0105241_10000002 3300009174 Bacteria 869480
91 Ga0105246_10038303 3300011119 Bacteria 3223
92 Ga0157373_10002435 3300013100 Bacteria 14165
93 Ga0157373_10009885 3300013100 Bacteria 7030
94 Ga0157373_10017671 3300013100 Bacteria 5192
95 Ga0157373_10023860 3300013100 Bacteria 4432
96 Ga0157371_10000099 3300013102 Bacteria 133829
97 Ga0157371_10001487 3300013102 Bacteria 24257
98 Ga0157371_10001890 3300013102 Bacteria 20943
99 Ga0157371_10012281 3300013102 Bacteria 6554
100 Ga0157371_10022774 3300013102 Bacteria 4583
101 Ga0157371_10139083 3300013102 Bacteria 1730
102 Ga0157370_10000064 3300013104 Bacteria 114340
103 Ga0157370_10004588 3300013104 Bacteria 15811
104 Ga0157370_10005907 3300013104 Bacteria 13646
105 Ga0157369_10016558 3300013105 Bacteria 8288
106 Ga0163162_10023146 3300013306 Bacteria 6128
107 Ga0163162_10035779 3300013306 Bacteria 4946
108 Ga0163162_10110242 3300013306 Bacteria 2849
109 Ga0157372_10003821 3300013307 Bacteria 16184
110 Ga0157372_10013837 3300013307 Bacteria 8616
111 Ga0157372_10015015 3300013307 Bacteria 8288
112 Ga0157372_10057466 3300013307 Bacteria 4349
113 Ga0182008_10001827 3300014497 Bacteria 13884
114 Ga0182008_10012019 3300014497 Bacteria 4583
115 Ga0182006_1000047 3300015261 Bacteria 187006
116 Ga0182006_1010027 3300015261 Bacteria 4225
117 Ga0182006_1093295 3300015261 Bacteria 1079
118 Ga0182007_10020092 3300015262 Bacteria 2392
119 Ga0183366_1001 3300015679 Bacteria 2743932
120 Ga0183370_1001 3300015680 Bacteria 2743932
121 Ga0183369_1001 3300015685 Bacteria 2743932
122 Ga0183368_1001 3300015687 Bacteria 2743932
123 Ga0163161_10000001 3300017792 Bacteria 2041488
124 Ga0163161_10004537 3300017792 Bacteria 9664
125 Ga0213872_10000401 3300021361 Bacteria 36021
126 Ga0213872_10001562 3300021361 Bacteria 14626
127 Ga0213876_10000055 3300021384 Bacteria 136037
128 Ga0209760_100222 3300025207 Bacteria 24749
129 Ga0209784_100001 3300025224 Bacteria 3600592
130 Ga0209566_100001 3300025225 Bacteria 3600765
131 Ga0209674_100002 3300025226 Bacteria 3600592
132 Ga0209563_100008 3300025230 Bacteria 1554545
133 Ga0207427_100135 3300025231 Bacteria 89851
134 Ga0209437_100007 3300025233 Bacteria 938377
135 Ga0209437_100109 3300025233 Bacteria 217031
136 Ga0209437_100111 3300025233 Bacteria 214944
137 Ga0209677_100004 3300025253 Bacteria 1554545
138 Ga0209129_1000004 3300025258 Bacteria 884499
139 Ga0209233_1004792 3300025261 Bacteria 4556
140 Ga0209676_1000159 3300025292 Bacteria 161731
141 Ga0209050_1015498 3300025298 Bacteria 3194
142 Ga0207696_1000001 3300025711 Bacteria 2579611
143 Ga0207696_1000005 3300025711 Bacteria 642078
144 Ga0207696_1000028 3300025711 Bacteria 400424
145 Ga0207696_1000086 3300025711 Bacteria 194626
146 Ga0207696_1000218 3300025711 Bacteria 83242
147 Ga0207696_1000235 3300025711 Bacteria 77526
148 Ga0207696_1000793 3300025711 Bacteria 20640
149 Ga0207696_1005876 3300025711 Bacteria 5032
150 Ga0207696_1010377 3300025711 Bacteria 3416
151 Ga0207696_1011167 3300025711 Bacteria 3249
152 Ga0207696_1011566 3300025711 Bacteria 3168
153 Ga0207655_1000001 3300025728 Bacteria 1866413
154 Ga0207655_1000009 3300025728 Bacteria 664676
155 Ga0207655_1000037 3300025728 Bacteria 354473
156 Ga0207655_1000061 3300025728 Bacteria 258893
157 Ga0207655_1000069 3300025728 Bacteria 239968
158 Ga0207655_1000168 3300025728 Bacteria 119343
159 Ga0207655_1000587 3300025728 Bacteria 44910
160 Ga0207655_1000862 3300025728 Bacteria 32286
161 Ga0207655_1001548 3300025728 Bacteria 20769
162 Ga0207655_1004565 3300025728 Bacteria 9755
163 Ga0207655_1005512 3300025728 Bacteria 8585
164 Ga0207655_1006196 3300025728 Bacteria 7970
165 Ga0207655_1008463 3300025728 Bacteria 6521
166 Ga0207713_1000001 3300025735 Bacteria 2295391
167 Ga0207713_1000002 3300025735 Bacteria 1061749
168 Ga0207713_1000003 3300025735 Bacteria 860698
169 Ga0207713_1000008 3300025735 Bacteria 553952
170 Ga0207713_1000016 3300025735 Bacteria 421689
171 Ga0207713_1000029 3300025735 Bacteria 285054
172 Ga0207713_1004018 3300025735 Bacteria 9727
173 Ga0207713_1012613 3300025735 Bacteria 4502
174 Ga0207713_1014994 3300025735 Bacteria 3996
175 Ga0207713_1016290 3300025735 Bacteria 3778
176 Ga0207713_1020216 3300025735 Bacteria 3233
177 Ga0207713_1022414 3300025735 Bacteria 2998
178 Ga0207713_1038650 3300025735 Bacteria 2023
179 Ga0207713_1050197 3300025735 Bacteria 1667
180 Ga0207710_10000113 3300025900 Bacteria 102300
181 Ga0207654_10000005 3300025911 Bacteria 869492
182 Ga0207690_10043751 3300025932 Bacteria 2949
183 Ga0207709_10084469 3300025935 Bacteria 2055
184 Ga0207674_10012255 3300026116 Bacteria 9588
185 Ga0209281_1000001 3300027111 Bacteria 1933496
186 Ga0209281_1000003 3300027111 Bacteria 1260089
187 Ga0209281_1000006 3300027111 Bacteria 1170244
188 Ga0209281_1000130 3300027111 Bacteria 191756
189 Ga0209281_1000287 3300027111 Bacteria 93918
190 Ga0209281_1000414 3300027111 Bacteria 64365
191 Ga0209281_1000860 3300027111 Bacteria 26579
192 Ga0209281_1000868 3300027111 Bacteria 26280
193 Ga0209281_1000941 3300027111 Bacteria 23789
194 Ga0209281_1002918 3300027111 Bacteria 6176
195 Ga0209281_1012242 3300027111 Bacteria 1891
196 Ga0209281_1023866 3300027111 Bacteria 1154
197 Ga0209371_1000001 3300027312 Bacteria 2771503
198 Ga0209371_1000002 3300027312 Bacteria 1551985
199 Ga0209371_1000005 3300027312 Bacteria 1061740
200 Ga0209371_1000041 3300027312 Bacteria 340377
201 Ga0209371_1000109 3300027312 Bacteria 141217
202 Ga0209371_1000124 3300027312 Bacteria 131108
203 Ga0209371_1000183 3300027312 Bacteria 91570
204 Ga0209371_1000212 3300027312 Bacteria 80989
205 Ga0209371_1000541 3300027312 Bacteria 35521
206 Ga0209371_1001707 3300027312 Bacteria 13914
207 Ga0209371_1001737 3300027312 Bacteria 13727
208 Ga0209371_1002471 3300027312 Bacteria 10291
209 Ga0209371_1002833 3300027312 Bacteria 9203
210 Ga0209371_1003665 3300027312 Bacteria 7268
211 Ga0209371_1005624 3300027312 Bacteria 4920
212 Ga0209371_1007566 3300027312 Bacteria 3760
213 Ga0268266_10000693 3300028379 Bacteria 45369
214 Ga0265338_10007722 3300028800 Bacteria 13239
215 Ga0268256_1000001 3300030500 Bacteria 2771065
216 Ga0268256_1000002 3300030500 Bacteria 1535763
217 Ga0268256_1000003 3300030500 Bacteria 1289401
218 Ga0268256_1000006 3300030500 Bacteria 1063991
219 Ga0268256_1000155 3300030500 Bacteria 91570
220 Ga0268256_1000186 3300030500 Bacteria 73618
221 Ga0268256_1000443 3300030500 Bacteria 36613
222 Ga0268256_1001515 3300030500 Bacteria 13727
223 Ga0268256_1001590 3300030500 Bacteria 13255
224 Ga0268256_1001735 3300030500 Bacteria 12344
225 Ga0268256_1004530 3300030500 Bacteria 5731
226 Ga0268256_1005254 3300030500 Bacteria 5135
227 Ga0268256_1005703 3300030500 Bacteria 4807
228 Ga0268256_1008545 3300030500 Bacteria 3493
229 Ga0265339_10031993 3300031249 Bacteria 2969
230 Ga0265327_10005028 3300031251 Bacteria 11312
231 Ga0307516_10103521 3300031730 Bacteria 2660
232 Ga0316593_10091069 3300032168 Bacteria 1074
233 Ga0316596_1033378 3300033541 Bacteria 1341
234 Ga0316584_0080457 3300036712 Bacteria 2441
235 Ga0436365_0971002 3300039437 Bacteria 167792
236 Ga0436361_0199489 3300039447 Bacteria 7417
237 Ga0436361_0430564 3300039447 Bacteria 1282
238 Ga0436361_0797625 3300039447 Bacteria 5123
239 Ga0436361_0872811 3300039447 Bacteria 2553
240 Ga0436361_0915910 3300039447 Bacteria 35781
241 Ga0436361_1131046 3300039447 Bacteria 4665
242 Ga0439438_000001 3300041405 Bacteria 1263568
243 Ga0439438_001274 3300041405 Bacteria 11141
244 Ga0439438_007122 3300041405 Bacteria 3856
245 Ga0439447_013627 3300041407 Bacteria 2301
246 Ga0439466_0000047 3300041411 Bacteria 48861
247 Ga0451853_3578141 3300041512 Bacteria 2499
248 Ga0439432_021708 3300042006 Bacteria 2125
249 Ga0439432_046928 3300042006 Bacteria 1356
250 Ga0439452_000001 3300042010 Bacteria 1725439
251 Ga0439452_000002 3300042010 Bacteria 1377577
252 Ga0439452_000028 3300042010 Bacteria 204513
253 Ga0439452_000194 3300042010 Bacteria 44729
254 Ga0439452_000469 3300042010 Bacteria 22652
255 Ga0439452_007413 3300042010 Bacteria 3362
256 Ga0439463_003827 3300042016 Bacteria 3796
257 Ga0450900_001439 3300042136 Bacteria 2317
258 Ga0450902_005656 3300042137 Bacteria 1898
259 Ga0450907_000434 3300042146 Bacteria 12439
260 Ga0439464_0001223 3300042439 Bacteria 5974
261 Ga0466972_0000018 3300044658 Bacteria 199161
262 Ga0466972_0075443 3300044658 Bacteria 1607
263 Ga0466972_0094268 3300044658 Bacteria 1419
264 Ga0466981_0000002 3300044669 Bacteria 313036
265 Ga0466965_0034435 3300044683 Bacteria 2478
266 Ga0466964_0019469 3300044706 Bacteria 2608
267 Ga0466968_0017538 3300044735 Bacteria 2863
268 Ga0466959_0127431 3300045049 Bacteria 1806
269 Ga0495627_000116 3300046453 Bacteria 99916
270 Ga0495627_016799 3300046453 Bacteria 2500
271 Ga0495591_000013 3300046458 Bacteria 268106
272 Ga0495591_000100 3300046458 Bacteria 99473
273 Ga0495591_001400 3300046458 Bacteria 15064
274 Ga0495638_0003609 3300046460 Bacteria 12095
275 Ga0495650_0000005 3300046471 Bacteria 766553
276 Ga0495650_0000090 3300046471 Bacteria 232897
277 Ga0495650_0011888 3300046471 Bacteria 4720
278 Ga0495650_0028978 3300046471 Bacteria 2530
279 Ga0495585_0001648 3300046492 Bacteria 17071
280 Ga0495596_0037899 3300046500 Bacteria 1906
281 Ga0495643_0012117 3300046522 Bacteria 5213
282 Ga0495648_0006206 3300046524 Bacteria 9786
283 Ga0495654_0000041 3300046530 Bacteria 174733
284 Ga0495654_0000149 3300046530 Bacteria 72677
285 Ga0495654_0009436 3300046530 Bacteria 5348
286 Ga0495654_0020513 3300046530 Bacteria 3442
287 Ga0495597_0000396 3300046542 Bacteria 37594
288 Ga0495668_0066872 3300046616 Bacteria 1977
289 Ga0495625_0009960 3300046660 Bacteria 7906
290 Ga0495661_0019876 3300046665 Bacteria 4394
291 Ga0495671_0003861 3300046692 Bacteria 9106
292 Ga0495649_0007119 3300046694 Bacteria 6874
293 Ga0495649_0007209 3300046694 Bacteria 6817
294 Ga0495589_0000004 3300046794 Bacteria 439891
295 Ga0495660_0000028 3300046810 Bacteria 244534
296 Ga0495672_0000034 3300047320 Bacteria 290832
297 Ga0495672_0000043 3300047320 Bacteria 266893
298 Ga0495679_000005 3300047446 Bacteria 455007
299 Ga0495679_000665 3300047446 Bacteria 22647
300 Ga0495679_001408 3300047446 Bacteria 13719
301 Ga0495679_013555 3300047446 Bacteria 3054
302 Ga0495673_0000070 3300047469 Bacteria 217453
303 Ga0496100_0127953 3300048903 Bacteria 1785
304 Ga0496101_0000055 3300048904 Bacteria 136176
305 Ga0496101_0259789 3300048904 Bacteria 1354
306 Ga0496102_0015739 3300048905 Bacteria 6590
307 Ga0496103_0032565 3300048906 Bacteria 3182
308 Ga0496104_0000628 3300048907 Bacteria 30236
309 Ga0496104_0005228 3300048907 Bacteria 11355
310 Ga0496104_0237508 3300048907 Bacteria 1734
311 Ga0496105_0001362 3300048908 Bacteria 17175
312 Ga0496105_0108176 3300048908 Bacteria 2295
313 Ga0496116_0000001 3300048919 Bacteria 1501681
314 Ga0496116_0000122 3300048919 Bacteria 162802
315 Ga0496116_0000277 3300048919 Bacteria 89271
316 Ga0496116_0000359 3300048919 Bacteria 71572
317 Ga0496116_0001757 3300048919 Bacteria 23624
318 Ga0496116_0003767 3300048919 Bacteria 14821
319 Ga0496116_0007850 3300048919 Bacteria 9367
320 Ga0496116_0009679 3300048919 Bacteria 8194
321 Ga0496116_0034134 3300048919 Bacteria 3595
322 Ga0496116_0115550 3300048919 Bacteria 1565
323 Ga0496116_0174172 3300048919 Bacteria 1161
324 Ga0496117_0000004 3300048920 Bacteria 877131
325 Ga0496117_0000020 3300048920 Bacteria 458405
326 Ga0496117_0000165 3300048920 Bacteria 139029
327 Ga0496117_0000399 3300048920 Bacteria 74064
328 Ga0496117_0001710 3300048920 Bacteria 30447
329 Ga0496117_0004944 3300048920 Bacteria 14318
330 Ga0496117_0011353 3300048920 Bacteria 7984
331 Ga0496117_0018808 3300048920 Bacteria 5704
332 Ga0496117_0018976 3300048920 Bacteria 5668
333 Ga0496117_0032401 3300048920 Bacteria 3970
334 Ga0496117_0035410 3300048920 Bacteria 3747
335 Ga0496117_0237608 3300048920 Bacteria 1002
336 Ga0496118_0000007 3300048921 Bacteria 650986
337 Ga0496118_0000015 3300048921 Bacteria 551359
338 Ga0496118_0000085 3300048921 Bacteria 179731
339 Ga0496118_0002336 3300048921 Bacteria 25723
340 Ga0496118_0003542 3300048921 Bacteria 19523
341 Ga0496118_0006080 3300048921 Bacteria 13430
342 Ga0496118_0006573 3300048921 Bacteria 12707
343 Ga0496118_0013734 3300048921 Bacteria 7639
344 Ga0496118_0019554 3300048921 Bacteria 6047
345 Ga0496118_0068404 3300048921 Bacteria 2579
346 Ga0496119_0000001 3300048922 Bacteria 789520
347 Ga0496119_0000015 3300048922 Bacteria 312979
348 Ga0496119_0000095 3300048922 Bacteria 129683
349 Ga0496119_0000155 3300048922 Bacteria 94820
350 Ga0496119_0000911 3300048922 Bacteria 38310
351 Ga0496119_0001393 3300048922 Bacteria 29345
352 Ga0496119_0002851 3300048922 Bacteria 18458
353 Ga0496119_0004132 3300048922 Bacteria 14619
354 Ga0496119_0007691 3300048922 Bacteria 9645
355 Ga0496119_0008098 3300048922 Bacteria 9316
356 Ga0496119_0010457 3300048922 Bacteria 7808
357 Ga0496119_0010512 3300048922 Bacteria 7777
358 Ga0496119_0062623 3300048922 Bacteria 2215
359 Ga0496120_0000076 3300048923 Bacteria 163121
360 Ga0496120_0000464 3300048923 Bacteria 63910
361 Ga0496120_0000654 3300048923 Bacteria 50909
362 Ga0496120_0000807 3300048923 Bacteria 45013
363 Ga0496120_0000967 3300048923 Bacteria 39152
364 Ga0496120_0000983 3300048923 Bacteria 38789
365 Ga0496120_0001139 3300048923 Bacteria 34311
366 Ga0496120_0001257 3300048923 Bacteria 31859
367 Ga0496120_0003198 3300048923 Bacteria 15231
368 Ga0496120_0005498 3300048923 Bacteria 10088
369 Ga0496120_0010290 3300048923 Bacteria 6541
370 Ga0496120_0015318 3300048923 Bacteria 5063
371 Ga0496120_0021844 3300048923 Bacteria 4035
372 Ga0496120_0035476 3300048923 Bacteria 2978
373 Ga0496120_0064666 3300048923 Bacteria 2029
374 Ga0496120_0129308 3300048923 Bacteria 1295
375 Ga0496121_0002598 3300048924 Bacteria 27275
376 Ga0496121_0004182 3300048924 Bacteria 19708
377 Ga0496121_0004208 3300048924 Bacteria 19632
378 Ga0496121_0005003 3300048924 Bacteria 17348
379 Ga0496121_0009588 3300048924 Bacteria 11092
380 Ga0496121_0009816 3300048924 Bacteria 10933
381 Ga0496121_0010831 3300048924 Bacteria 10200
382 Ga0496121_0022871 3300048924 Bacteria 6041
383 Ga0496121_0028259 3300048924 Bacteria 5225
384 Ga0496121_0078671 3300048924 Bacteria 2620
385 Ga0496121_0109641 3300048924 Bacteria 2108
386 Ga0496122_0000005 3300048925 Bacteria 630659
387 Ga0496122_0000058 3300048925 Bacteria 248805
388 Ga0496122_0000655 3300048925 Bacteria 69852
389 Ga0496122_0000738 3300048925 Bacteria 63772
390 Ga0496122_0001357 3300048925 Bacteria 39885
391 Ga0496122_0004462 3300048925 Bacteria 17351
392 Ga0496122_0010808 3300048925 Bacteria 9351
393 Ga0496122_0045560 3300048925 Bacteria 3407
394 Ga0496122_0056930 3300048925 Bacteria 2909
395 Ga0496122_0084200 3300048925 Bacteria 2200
396 Ga0496122_0134444 3300048925 Bacteria 1562
397 Ga0496123_0000008 3300048926 Bacteria 630628
398 Ga0496123_0000044 3300048926 Bacteria 253396
399 Ga0496123_0000189 3300048926 Bacteria 124719
400 Ga0496123_0001127 3300048926 Bacteria 39885
401 Ga0496123_0001541 3300048926 Bacteria 31819
402 Ga0496123_0002997 3300048926 Bacteria 19532
403 Ga0496123_0003651 3300048926 Bacteria 17015
404 Ga0496123_0004639 3300048926 Bacteria 14281
405 Ga0496123_0017417 3300048926 Bacteria 5781
406 Ga0496123_0018132 3300048926 Bacteria 5620
407 Ga0496123_0089203 3300048926 Bacteria 1837
408 Ga0496124_0000105 3300048927 Bacteria 176783
409 Ga0496124_0000107 3300048927 Bacteria 168020
410 Ga0496124_0000196 3300048927 Bacteria 119375
411 Ga0496124_0001404 3300048927 Bacteria 35955
412 Ga0496124_0001838 3300048927 Bacteria 29295
413 Ga0496124_0002633 3300048927 Bacteria 23074
414 Ga0496124_0003636 3300048927 Bacteria 18712
415 Ga0496124_0007446 3300048927 Bacteria 11629
416 Ga0496124_0009359 3300048927 Bacteria 10095
417 Ga0496124_0012610 3300048927 Bacteria 8318
418 Ga0496124_0020670 3300048927 Bacteria 6075
419 Ga0496124_0024444 3300048927 Bacteria 5491
420 Ga0496124_0035711 3300048927 Bacteria 4346
421 Ga0496124_0047631 3300048927 Bacteria 3666
422 Ga0496124_0066772 3300048927 Bacteria 2994
423 Ga0496124_0190459 3300048927 Bacteria 1570
424 Ga0496125_0000009 3300048928 Bacteria 677678
425 Ga0496125_0000103 3300048928 Bacteria 201675
426 Ga0496125_0002818 3300048928 Bacteria 21942
427 Ga0496125_0008263 3300048928 Bacteria 10927
428 Ga0496125_0011004 3300048928 Bacteria 9081
429 Ga0496125_0018673 3300048928 Bacteria 6577
430 Ga0496126_0000399 3300048929 Bacteria 89026
431 Ga0496126_0001084 3300048929 Bacteria 45796
432 Ga0496126_0020685 3300048929 Bacteria 6445
433 Ga0496126_0020799 3300048929 Bacteria 6423
434 Ga0496126_0042277 3300048929 Bacteria 4209
435 Ga0496126_0053010 3300048929 Bacteria 3682
436 Ga0496126_0134848 3300048929 Bacteria 2130
437 Ga0496126_0292466 3300048929 Bacteria 1346
438 Ga0496126_0321949 3300048929 Bacteria 1270
439 Ga0496126_0337712 3300048929 Bacteria 1235
440 nmdc:mga00v17_147597_c1 3300050491 Bacteria 1510
441 nmdc:mga00v17_2094_c1 3300050491 Bacteria 10270
442 nmdc:mga00v17_22177_c1 3300050491 Bacteria 3661
443 nmdc:mga0k408_5408_c1 3300050493 Bacteria 6793
444 Ga0466962_0033097 3300061719 Bacteria 2473
445 2506578219 2506520007 Bacteria 5442880
446 2506583357 2506520008 Bacteria 5443009
447 2508852238 2508501071 Bacteria 5454741
448 2511382829 2511231025 Bacteria 5324661
449 2511390060 2511231027 Bacteria 5013807
450 2511437178 2511231035 Bacteria 5341610
451 2547695200 2547132181 Bacteria 4945084
452 2555257543 2554235234 Bacteria 5762085
453 2562462939 2561511199 Bacteria 5155034
454 2585825469 2585427591 Bacteria 5482980
455 2585832049 2585427592 Bacteria 5370892
456 2599409078 2599185169 Bacteria 5441380
457 2599925490 2599185299 Bacteria 4854625
458 2601522415 2600255254 Bacteria 5281859
459 2601527442 2600255255 Bacteria 5282785
460 2601532403 2600255256 Bacteria 5597742
461 2601537773 2600255257 Bacteria 5597196
462 2601614272 2600255280 Bacteria 5292309
463 2601618994 2600255281 Bacteria 5288753
464 2601642402 2600255287 Bacteria 5210468
465 2601647249 2600255288 Bacteria 5282738
466 2601652419 2600255289 Bacteria 5281907
467 2601657746 2600255290 Bacteria 5282218
468 2601662224 2600255291 Bacteria 5217298
469 2601695181 2600255298 Bacteria 5215185
470 2601699855 2600255299 Bacteria 5218662
471 2601706265 2600255300 Bacteria 5287774
472 2601710571 2600255301 Bacteria 5280532
473 2601715585 2600255302 Bacteria 5288235
474 2601720207 2600255303 Bacteria 5219315
475 2601725990 2600255304 Bacteria 5283973
476 2601730532 2600255305 Bacteria 5282329
477 2601735548 2600255306 Bacteria 5281613
478 2601740806 2600255307 Bacteria 5439064
479 2601750735 2600255309 Bacteria 5431045
480 2601756571 2600255310 Bacteria 5600903
481 2601762948 2600255311 Bacteria 5598766
482 2602017989 2600255392 Bacteria 5437392
483 2603638155 2602042046 Bacteria 5483348
484 2603642651 2602042047 Bacteria 4697674
485 2603659590 2602042052 Bacteria 5215873
486 2603664866 2602042053 Bacteria 5214361
487 2603698308 2602042066 Bacteria 4423871
488 2603703242 2602042067 Bacteria 4863713
489 2603837922 2602042103 Bacteria 5284714
490 2603843000 2602042104 Bacteria 5281639
491 2603848073 2602042105 Bacteria 5282303
492 2603853144 2602042106 Bacteria 5282744
493 2603866558 2602042109 Bacteria 5152801
494 2603871199 2602042110 Bacteria 5283285
495 2603876113 2602042111 Bacteria 5212080
496 2606048391 2603880178 Bacteria 5283018
497 2606069293 2603880184 Bacteria 5217896
498 2606145102 2603880202 Bacteria 5284684
499 2606175793 2603880211 Bacteria 5284226
500 2608669303 2608642108 Bacteria 4104624
501 2609913447 2609459761 Bacteria 5513740
502 2637224980 2636415599 Bacteria 5718434
503 2650898824 2648501693 Bacteria 5069560
504 2656278733 2654587920 Bacteria 5475511
505 2671103174 2667528172 Bacteria 5170840
506 2671109848 2667528173 Bacteria 5375747
507 2671587606 2671180115 Bacteria 5353919
508 2676406220 2675903046 Bacteria 5451247
509 2681997674 2681812866 Bacteria 4552357
510 2682006799 2681812869 Bacteria 5014465
511 2686353208 2684622997 Bacteria 4624240
512 2689444770 2687453601 Bacteria 5546041
513 2753855752 2751185917 Bacteria 4551186
514 2765588749 2765235842 Bacteria 4799256
515 2770196879 2767802442 Bacteria 5747986
516 2772438824 2772190666 Bacteria 5117644
517 2775538753 2775506706 Bacteria 4873073
518 2776270518 2775506902 Bacteria 6208009
519 2776281561 2775506904 Bacteria 5954060
520 2777024474 2775507074 Bacteria 5532402
521 2791922447 2791354903 Bacteria 4937680
522 2792314791 2791355010 Bacteria 4864581
523 2793405726 2791355275 Bacteria 4429597
524 2807179478 2806310673 Bacteria 4801221
525 2809123741 2808606414 Bacteria 4917181
526 2813729132 2811995292 Bacteria 5303342
527 2814696698 2814123068 Bacteria 5687681
528 2821119559 2821118458 Bacteria 4714306
529 2823374539 2823373977 Bacteria 4779415
530 2840768883 2840764183 Bacteria 6358399
531 2842872049 2842871566 Bacteria 4827117
532 2844427305 2844425489 Bacteria 4854065
533 2844533000 2844528606 Bacteria 4733806
534 2847087785 2847085930 Bacteria 5070450
535 2847800013 2847797336 Bacteria 5176640
536 2852107732 2852103415 Bacteria 5193810
537 2865015131 2865014394 Bacteria 4764573
538 2869554174 2869551831 Bacteria 5474685
539 2876604370 2876601092 Bacteria 5114497
540 2881610052 2881609920 Bacteria 4405319
541 2884088990 2884086401 Bacteria 5005459
542 2888368847 2888366609 Bacteria 5155009
543 2888378449 2888373701 Bacteria 5098052
544 2891671011 2891670763 Bacteria 4967099
545 2894655825 2894652903 Bacteria 4587256
546 2904478151 2904474040 Bacteria 5504324
547 2904504963 2904504865 Bacteria 5152820
548 2904514133 2904513164 Bacteria 5476410
549 2904581996 2904578770 Bacteria 5302906
550 2908670008 2908669403 Bacteria 5740494
551 2919108739 2919108558 Bacteria 5897419
552 2919123226 2919119836 Bacteria 5208557
553 2919155331 2919150387 Bacteria 5500879
554 2919493529 2919493220 Bacteria 4598500
555 2919545068 2919543075 Bacteria 4728703
556 2923528813 2923525760 Bacteria 4472324
557 2923634626 2923634449 Bacteria 4753480
558 2927148009 2927143783 Bacteria 5504251
559 2927834324 2927833300 Bacteria 4923934
560 2928523989 2928521798 Bacteria 4960112
561 2932408169 2932406140 Bacteria 5134491
562 2935626871 2935625433 Bacteria 5042964
563 2937540336 2937539931 Bacteria 4639830
564 2937967439 2937967321 Bacteria 5094075
565 2939568965 2939568625 Bacteria 4542555
566 2939573746 2939573065 Bacteria 4926053
567 2939578626 2939577877 Bacteria 5132791
568 2939603441 2939602548 Bacteria 4950493
569 2939607659 2939607340 Bacteria 4719256
570 2939619386 2939617950 Bacteria 4820956
571 2939643987 2939642701 Bacteria 4475280
572 2945877497 2945874760 Bacteria 5527237
573 2945953125 2945951305 Bacteria 4918162
574 2954012933 2954011201 Bacteria 4762601
575 2969081970 2969079654 Bacteria 5439582
576 2971823310 2971820967 Bacteria 5823634
577 2974312329 2974310843 Bacteria 4947816
578 2974438264 2974435778 Bacteria 4876478
579 2978975649 2978975091 Bacteria 4704313
580 2984496493 2984494565 Bacteria 5000175
581 2984564404 2984559226 Bacteria 5683096
582 2984597136 2984595703 Bacteria 5682994
583 2990261914 2990261002 Bacteria 4919493
584 3000378761 3000376612 Bacteria 4705565
585 3002144866 3002141150 Bacteria 5254435
586 3006826872 3006826541 Bacteria 4678913
587 640937747 640753048 Bacteria 5495657
588 8004595733 8004592986 Bacteria 5122074
589 8015399050 8015394850 Bacteria 5064660
590 8016736054 8016733728 Bacteria 5274317
591 8018223094 8018221730 Bacteria 4616064
592 8018408358 8018405270 Bacteria 4978981
593 8019502799 8019499862 Bacteria 5169538
594 8019506270 8019504834 Bacteria 4819156
595 8054845693 8054844752 Bacteria 4450330
596 8054853060 8054849141 Bacteria 5232694
597 8055090981 8055087960 Bacteria 4784273
598 8055094527 8055092621 Bacteria 4873875
599 8055099935 8055097453 Bacteria 4865496
600 8057309407 8057304971 Bacteria 4649742
601 Ga0105244_10000515
602 SwRhRL2b_contig_1704300
603 JGI24739J22299_10002671
604 JGI25162J39368_1000112
605 JGI25162J39368_1002127
606 JGI25163J39215_1000184
607 JGI25164J39214_1000094
608 JGI25152J39213_1000258
609 rootH2_10017443
610 rootL2_10002646
611 rootH1_10224963
612 Ga0055538_1000076
613 Ga0055539_1000115
614 Ga0055533_1000121
615 Ga0055525_1000159
616 Ga0055536_1009618
617 Ga0055541_1000077
618 Ga0058692_1000066
619 Ga0058692_1000072
620 Ga0058692_1000173
621 Ga0058692_1000292
622 Ga0058692_1000344
623 Ga0058692_1002705
624 Ga0058692_1002706
625 Ga0058692_1003140
626 Ga0058692_1003633
627 Ga0058692_1004977
628 Ga0058692_1007471
629 Ga0065714_10066691
630 Ga0065704_10000300
631 Ga0065704_10000591
632 Ga0065704_10001991
633 Ga0065704_10003501
634 Ga0065704_10073427
635 Ga0070668_100010922
636 Ga0070665_100002066
637 Ga0070665_100086341
638 Ga0068857_100041214
639 Ga0075364_10010477
640 Ga0075366_10061785
641 Ga0079104_1000083
642 Ga0079104_1000218
643 Ga0079104_1000263
644 Ga0079104_1000598
645 Ga0079104_1000925
646 Ga0079104_1001280
647 Ga0079104_1001285
648 Ga0079104_1002310
649 Ga0079104_1002631
650 Ga0079104_1019883
651 Ga0079104_1021744
652 Ga0105251_10000189
653 Ga0105251_10001201
654 Ga0105251_10001220
655 Ga0105251_10001304
656 Ga0105251_10001620
657 Ga0105251_10001691
658 Ga0105251_10004096
659 Ga0105251_10005467
660 Ga0105251_10005817
661 Ga0105251_10019319
662 Ga0105251_10023173
663 Ga0105251_10067482
664 Ga0105251_10137291
665 Ga0105244_10000015
666 Ga0105244_10000070
667 Ga0105244_10000104
668 Ga0105244_10000554
669 Ga0105244_10000597
670 Ga0105244_10000645
671 Ga0105244_10001686
672 Ga0105244_10002973
673 Ga0105244_10003866
674 Ga0105244_10013340
675 Ga0105244_10025360
676 Ga0105244_10067052
677 Ga0105244_10077044
678 Ga0105244_10078474
679 Ga0105250_10000001
680 Ga0105250_10000113
681 Ga0105250_10000488
682 Ga0105250_10000525
683 Ga0105250_10001241
684 Ga0105250_10002568
685 Ga0105250_10005331
686 Ga0105250_10017078
687 Ga0105250_10017364
688 Ga0105247_10000129
689 Ga0105243_10075898
690 Ga0105241_10000002
691 Ga0105246_10038303
692 Ga0157373_10002435
693 Ga0157373_10009885
694 Ga0157373_10017671
695 Ga0157373_10023860
696 Ga0157371_10000099
697 Ga0157371_10001487
698 Ga0157371_10001890
699 Ga0157371_10012281
700 Ga0157371_10022774
701 Ga0157371_10139083
702 Ga0157370_10000064
703 Ga0157370_10004588
704 Ga0157370_10005907
705 Ga0157369_10016558
706 Ga0163162_10023146
707 Ga0163162_10035779
708 Ga0163162_10110242
709 Ga0157372_10003821
710 Ga0157372_10013837
711 Ga0157372_10015015
712 Ga0157372_10057466
713 Ga0182008_10001827
714 Ga0182008_10012019
715 Ga0182006_1000047
716 Ga0182006_1010027
717 Ga0182006_1093295
718 Ga0182007_10020092
719 Ga0183366_1001
720 Ga0183370_1001
721 Ga0183369_1001
722 Ga0183368_1001
723 Ga0163161_10000001
724 Ga0163161_10004537
725 Ga0213872_10000401
726 Ga0213872_10001562
727 Ga0213876_10000055
728 Ga0209760_100222
729 Ga0209784_100001
730 Ga0209566_100001
731 Ga0209674_100002
732 Ga0209563_100008
733 Ga0207427_100135
734 Ga0209437_100007
735 Ga0209437_100109
736 Ga0209437_100111
737 Ga0209677_100004
738 Ga0209129_1000004
739 Ga0209233_1004792
740 Ga0209676_1000159
741 Ga0209050_1015498
742 Ga0207696_1000001
743 Ga0207696_1000005
744 Ga0207696_1000028
745 Ga0207696_1000086
746 Ga0207696_1000218
747 Ga0207696_1000235
748 Ga0207696_1000793
749 Ga0207696_1005876
750 Ga0207696_1010377
751 Ga0207696_1011167
752 Ga0207696_1011566
753 Ga0207655_1000001
754 Ga0207655_1000009
755 Ga0207655_1000037
756 Ga0207655_1000061
757 Ga0207655_1000069
758 Ga0207655_1000168
759 Ga0207655_1000587
760 Ga0207655_1000862
761 Ga0207655_1001548
762 Ga0207655_1004565
763 Ga0207655_1005512
764 Ga0207655_1006196
765 Ga0207655_1008463
766 Ga0207713_1000001
767 Ga0207713_1000002
768 Ga0207713_1000003
769 Ga0207713_1000008
770 Ga0207713_1000016
771 Ga0207713_1000029
772 Ga0207713_1004018
773 Ga0207713_1012613
774 Ga0207713_1014994
775 Ga0207713_1016290
776 Ga0207713_1020216
777 Ga0207713_1022414
778 Ga0207713_1038650
779 Ga0207713_1050197
780 Ga0207710_10000113
781 Ga0207654_10000005
782 Ga0207690_10043751
783 Ga0207709_10084469
784 Ga0207674_10012255
785 Ga0209281_1000001
786 Ga0209281_1000003
787 Ga0209281_1000006
788 Ga0209281_1000130
789 Ga0209281_1000287
790 Ga0209281_1000414
791 Ga0209281_1000860
792 Ga0209281_1000868
793 Ga0209281_1000941
794 Ga0209281_1002918
795 Ga0209281_1012242
796 Ga0209281_1023866
797 Ga0209371_1000001
798 Ga0209371_1000002
799 Ga0209371_1000005
800 Ga0209371_1000041
801 Ga0209371_1000109
802 Ga0209371_1000124
803 Ga0209371_1000183
804 Ga0209371_1000212
805 Ga0209371_1000541
806 Ga0209371_1001707
807 Ga0209371_1001737
808 Ga0209371_1002471
809 Ga0209371_1002833
810 Ga0209371_1003665
811 Ga0209371_1005624
812 Ga0209371_1007566
813 Ga0268266_10000693
814 Ga0265338_10007722
815 Ga0268256_1000001
816 Ga0268256_1000002
817 Ga0268256_1000003
818 Ga0268256_1000006
819 Ga0268256_1000155
820 Ga0268256_1000186
821 Ga0268256_1000443
822 Ga0268256_1001515
823 Ga0268256_1001590
824 Ga0268256_1001735
825 Ga0268256_1004530
826 Ga0268256_1005254
827 Ga0268256_1005703
828 Ga0268256_1008545
829 Ga0265339_10031993
830 Ga0265327_10005028
831 Ga0307516_10103521
832 Ga0316593_10091069
833 Ga0316596_1033378
834 Ga0316584_0080457
835 Ga0436365_0971002
836 Ga0436361_0199489
837 Ga0436361_0430564
838 Ga0436361_0797625
839 Ga0436361_0872811
840 Ga0436361_0915910
841 Ga0436361_1131046
842 Ga0439438_000001
843 Ga0439438_001274
844 Ga0439438_007122
845 Ga0439447_013627
846 Ga0439466_0000047
847 Ga0451853_3578141
848 Ga0439432_021708
849 Ga0439432_046928
850 Ga0439452_000001
851 Ga0439452_000002
852 Ga0439452_000028
853 Ga0439452_000194
854 Ga0439452_000469
855 Ga0439452_007413
856 Ga0439463_003827
857 Ga0450900_001439
858 Ga0450902_005656
859 Ga0450907_000434
860 Ga0439464_0001223
861 Ga0466972_0000018
862 Ga0466972_0075443
863 Ga0466972_0094268
864 Ga0466981_0000002
865 Ga0466965_0034435
866 Ga0466964_0019469
867 Ga0466968_0017538
868 Ga0466959_0127431
869 Ga0495627_000116
870 Ga0495627_016799
871 Ga0495591_000013
872 Ga0495591_000100
873 Ga0495591_001400
874 Ga0495638_0003609
875 Ga0495650_0000005
876 Ga0495650_0000090
877 Ga0495650_0011888
878 Ga0495650_0028978
879 Ga0495585_0001648
880 Ga0495596_0037899
881 Ga0495643_0012117
882 Ga0495648_0006206
883 Ga0495654_0000041
884 Ga0495654_0000149
885 Ga0495654_0009436
886 Ga0495654_0020513
887 Ga0495597_0000396
888 Ga0495668_0066872
889 Ga0495625_0009960
890 Ga0495661_0019876
891 Ga0495671_0003861
892 Ga0495649_0007119
893 Ga0495649_0007209
894 Ga0495589_0000004
895 Ga0495660_0000028
896 Ga0495672_0000034
897 Ga0495672_0000043
898 Ga0495679_000005
899 Ga0495679_000665
900 Ga0495679_001408
901 Ga0495679_013555
902 Ga0495673_0000070
903 Ga0496100_0127953
904 Ga0496101_0000055
905 Ga0496101_0259789
906 Ga0496102_0015739
907 Ga0496103_0032565
908 Ga0496104_0000628
909 Ga0496104_0005228
910 Ga0496104_0237508
911 Ga0496105_0001362
912 Ga0496105_0108176
913 Ga0496116_0000001
914 Ga0496116_0000122
915 Ga0496116_0000277
916 Ga0496116_0000359
917 Ga0496116_0001757
918 Ga0496116_0003767
919 Ga0496116_0007850
920 Ga0496116_0009679
921 Ga0496116_0034134
922 Ga0496116_0115550
923 Ga0496116_0174172
924 Ga0496117_0000004
925 Ga0496117_0000020
926 Ga0496117_0000165
927 Ga0496117_0000399
928 Ga0496117_0001710
929 Ga0496117_0004944
930 Ga0496117_0011353
931 Ga0496117_0018808
932 Ga0496117_0018976
933 Ga0496117_0032401
934 Ga0496117_0035410
935 Ga0496117_0237608
936 Ga0496118_0000007
937 Ga0496118_0000015
938 Ga0496118_0000085
939 Ga0496118_0002336
940 Ga0496118_0003542
941 Ga0496118_0006080
942 Ga0496118_0006573
943 Ga0496118_0013734
944 Ga0496118_0019554
945 Ga0496118_0068404
946 Ga0496119_0000001
947 Ga0496119_0000015
948 Ga0496119_0000095
949 Ga0496119_0000155
950 Ga0496119_0000911
951 Ga0496119_0001393
952 Ga0496119_0002851
953 Ga0496119_0004132
954 Ga0496119_0007691
955 Ga0496119_0008098
956 Ga0496119_0010457
957 Ga0496119_0010512
958 Ga0496119_0062623
959 Ga0496120_0000076
960 Ga0496120_0000464
961 Ga0496120_0000654
962 Ga0496120_0000807
963 Ga0496120_0000967
964 Ga0496120_0000983
965 Ga0496120_0001139
966 Ga0496120_0001257
967 Ga0496120_0003198
968 Ga0496120_0005498
969 Ga0496120_0010290
970 Ga0496120_0015318
971 Ga0496120_0021844
972 Ga0496120_0035476
973 Ga0496120_0064666
974 Ga0496120_0129308
975 Ga0496121_0002598
976 Ga0496121_0004182
977 Ga0496121_0004208
978 Ga0496121_0005003
979 Ga0496121_0009588
980 Ga0496121_0009816
981 Ga0496121_0010831
982 Ga0496121_0022871
983 Ga0496121_0028259
984 Ga0496121_0078671
985 Ga0496121_0109641
986 Ga0496122_0000005
987 Ga0496122_0000058
988 Ga0496122_0000655
989 Ga0496122_0000738
990 Ga0496122_0001357
991 Ga0496122_0004462
992 Ga0496122_0010808
993 Ga0496122_0045560
994 Ga0496122_0056930
995 Ga0496122_0084200
996 Ga0496122_0134444
997 Ga0496123_0000008
998 Ga0496123_0000044
999 Ga0496123_0000189
1000 Ga0496123_0001127
1001 Ga0496123_0001541
1002 Ga0496123_0002997
1003 Ga0496123_0003651
1004 Ga0496123_0004639
1005 Ga0496123_0017417
1006 Ga0496123_0018132
1007 Ga0496123_0089203
1008 Ga0496124_0000105
1009 Ga0496124_0000107
1010 Ga0496124_0000196
1011 Ga0496124_0001404
1012 Ga0496124_0001838
1013 Ga0496124_0002633
1014 Ga0496124_0003636
1015 Ga0496124_0007446
1016 Ga0496124_0009359
1017 Ga0496124_0012610
1018 Ga0496124_0020670
1019 Ga0496124_0024444
1020 Ga0496124_0035711
1021 Ga0496124_0047631
1022 Ga0496124_0066772
1023 Ga0496124_0190459
1024 Ga0496125_0000009
1025 Ga0496125_0000103
1026 Ga0496125_0002818
1027 Ga0496125_0008263
1028 Ga0496125_0011004
1029 Ga0496125_0018673
1030 Ga0496126_0000399
1031 Ga0496126_0001084
1032 Ga0496126_0020685
1033 Ga0496126_0020799
1034 Ga0496126_0042277
1035 Ga0496126_0053010
1036 Ga0496126_0134848
1037 Ga0496126_0292466
1038 Ga0496126_0321949
1039 Ga0496126_0337712
1040 nmdc:mga00v17_147597_c1
1041 nmdc:mga00v17_2094_c1
1042 nmdc:mga00v17_22177_c1
1043 nmdc:mga0k408_5408_c1
1044 Ga0466962_0033097
1045 2506578219
1046 2506583357
1047 2508852238
1048 2511382829
1049 2511390060
1050 2511437178
1051 2547695200
1052 2555257543
1053 2562462939
1054 2585825469
1055 2585832049
1056 2599409078
1057 2599925490
1058 2601522415
1059 2601527442
1060 2601532403
1061 2601537773
1062 2601614272
1063 2601618994
1064 2601642402
1065 2601647249
1066 2601652419
1067 2601657746
1068 2601662224
1069 2601695181
1070 2601699855
1071 2601706265
1072 2601710571
1073 2601715585
1074 2601720207
1075 2601725990
1076 2601730532
1077 2601735548
1078 2601740806
1079 2601750735
1080 2601756571
1081 2601762948
1082 2602017989
1083 2603638155
1084 2603642651
1085 2603659590
1086 2603664866
1087 2603698308
1088 2603703242
1089 2603837922
1090 2603843000
1091 2603848073
1092 2603853144
1093 2603866558
1094 2603871199
1095 2603876113
1096 2606048391
1097 2606069293
1098 2606145102
1099 2606175793
1100 2608669303
1101 2609913447
1102 2637224980
1103 2650898824
1104 2656278733
1105 2671103174
1106 2671109848
1107 2671587606
1108 2676406220
1109 2681997674
1110 2682006799
1111 2686353208
1112 2689444770
1113 2753855752
1114 2765588749
1115 2770196879
1116 2772438824
1117 2775538753
1118 2776270518
1119 2776281561
1120 2777024474
1121 2791922447
1122 2792314791
1123 2793405726
1124 2807179478
1125 2809123741
1126 2813729132
1127 2814696698
1128 2821119559
1129 2823374539
1130 2840768883
1131 2842872049
1132 2844427305
1133 2844533000
1134 2847087785
1135 2847800013
1136 2852107732
1137 2865015131
1138 2869554174
1139 2876604370
1140 2881610052
1141 2884088990
1142 2888368847
1143 2888378449
1144 2891671011
1145 2894655825
1146 2904478151
1147 2904504963
1148 2904514133
1149 2904581996
1150 2908670008
1151 2919108739
1152 2919123226
1153 2919155331
1154 2919493529
1155 2919545068
1156 2923528813
1157 2923634626
1158 2927148009
1159 2927834324
1160 2928523989
1161 2932408169
1162 2935626871
1163 2937540336
1164 2937967439
1165 2939568965
1166 2939573746
1167 2939578626
1168 2939603441
1169 2939607659
1170 2939619386
1171 2939643987
1172 2945877497
1173 2945953125
1174 2954012933
1175 2969081970
1176 2971823310
1177 2974312329
1178 2974438264
1179 2978975649
1180 2984496493
1181 2984564404
1182 2984597136
1183 2990261914
1184 3000378761
1185 3002144866
1186 3006826872
1187 640937747
1188 8004595733
1189 8015399050
1190 8016736054
1191 8018223094
1192 8018408358
1193 8019502799
1194 8019506270
1195 8054845693
1196 8054853060
1197 8055090981
1198 8055094527
1199 8055099935
1200 8057309407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

51

327

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r9o-assembly1.cif.gz_C crystal structure of putative aldo/keto reductase from salmonella enterica 0.9824 1 295
4r9o-assembly1.cif.gz_C crystal structure of putative aldo/keto reductase from salmonella enterica 0.9791 1 295
7twz-assembly6.cif.gz_F crystal structure of nadp-linked putative oxidoreductase from klebsiella pneumoniae 0.9771 1 298
1og6-assembly1.cif.gz_C ydhf, an aldo-keto reductase from e.coli complexed with nadph 0.9769 1 298
1og6-assembly1.cif.gz_B ydhf, an aldo-keto reductase from e.coli complexed with nadph 0.9715 1 298
ID Description Score Start End Superfamily
1ur3M00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9705 1 298 3.20.20.100
1ur3M00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9672 1 298 3.20.20.100
af_Q2G0A9_5_302_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9558 14 298 3.20.20.100
af_P47182_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8886 70 291 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8824 3 219 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A377D4M7-F1-model_v4 Putative aldo/keto reductase (EC 1.-.-.-) 0.9875 207 298 GO:0016491
AF-A0A4Z0PNQ3-F1-model_v4 Oxidoreductase 0.9856 126 294 GO:0005829
AF-A0A3C2BMC4-F1-model_v4 deleted 0.9838 1 124
AF-A0A5U3J0F0-F1-model_v4 Oxidoreductase 0.9805 64 298 GO:0005829
GO:0016491
AF-A0A3S4FAG0-F1-model_v4 Oxidoreductase (EC 1.-.-.-) 0.9801 75 285 GO:0005829
GO:0016491

Map