F467982

General Info

Members Datasets Scaffolds Average Seq Length
600 214 1190 226

Family's Representative Sequence

Representative Sequence 3300021441|Ga0213871_10081795|Ga0213871_100817951
Length 223
Sequence MNVLMVLTSHDQLGDTGRKTGFWLEELAAPYYVFRDAGAQITLASPKGGRPPLDPKSNDPSFQTDLTRRFEKDADANARLDSVKQEDYDTVFYPGGHGPMWDLAEDKHSIKLLESFLAAGKTIALVCHAPGVLRHVKTPDGKPLVNGKTVTGFTNGEEAEVELTKVVPFLVEDELMRLGAIFSKVKNWGVHTVTDGQLITGQNPASSGPAAKVLIDTLKKKAK

Samples

Sample ID Description Type Environment
1 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
14 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
26 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
30 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
42 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
43 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
44 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
45 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
58 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
59 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
60 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
61 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
62 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
63 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
64 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
68 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
83 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
175 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
183 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
184 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
185 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
186 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
187 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
188 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
189 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
190 2643221664 Massilia sp. Root418 Isolate Unclassified
191 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
192 2738541297 Duganella sp. GV083 Isolate Unclassified
193 2738541307 Variovorax sp. GV008 Isolate Unclassified
194 2738541357 Duganella sp. GV053 Isolate Unclassified
195 2738543003 Duganella sp. GV066 Isolate Unclassified
196 2738543026 Duganella sp. GV089 Isolate Unclassified
197 2738543029 Duganella sp. GV039 Isolate Unclassified
198 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
199 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
200 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
201 2842711865 Duganella sp. R-73148 Isolate Unclassified
202 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
203 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
204 2857553236 Duganella sp. R-74557 Isolate Unclassified
205 2857558681 Duganella sp. R-74565 Isolate Unclassified
206 2865014394 Pantoea sp. R-71966 Isolate Unclassified
207 2876601092 Pantoea endophytica 596 Isolate Unclassified
208 2904424332 Duganella sp. 1411 Isolate Rhizosphere
209 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
210 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
211 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
212 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
213 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
214 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0
Isolates 5.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0.67
Rhizoplane 1.33
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213871_10081795 3300021441 Bacteria 926
2 JGI25162J39368_1000910 3300002737 Bacteria 19112
3 JGI25164J39214_1000673 3300002772 Bacteria 13723
4 JGI25151J46595_10000357 3300003187 Bacteria 48666
5 JGI25165J46597_1000982 3300003214 Bacteria 19112
6 Ga0055539_1009005 3300003752 Bacteria 1243
7 Ga0058692_1000208 3300003856 Bacteria 35014
8 Ga0065714_10066983 3300005288 Bacteria 6030
9 Ga0070663_100042245 3300005455 Bacteria 3203
10 Ga0081455_10004476 3300005937 Bacteria 15647
11 Ga0070717_10044374 3300006028 Bacteria 3630
12 Ga0075364_10032718 3300006051 Bacteria 3344
13 Ga0075362_10055929 3300006177 Bacteria 1775
14 Ga0079104_1001024 3300006946 Bacteria 21528
15 Ga0105244_10001177 3300009036 Bacteria 21645
16 Ga0105244_10001181 3300009036 Bacteria 21615
17 Ga0105244_10005798 3300009036 Bacteria 8126
18 Ga0105244_10065536 3300009036 Bacteria 1819
19 Ga0105244_10069878 3300009036 Bacteria 1753
20 Ga0105243_10032197 3300009148 Bacteria 4049
21 Ga0105246_10026033 3300011119 Bacteria 3817
22 Ga0105246_10033481 3300011119 Bacteria 3416
23 Ga0105246_10113508 3300011119 Bacteria 1995
24 Ga0157373_10002972 3300013100 Bacteria 12841
25 Ga0157371_10005670 3300013102 Bacteria 10480
26 Ga0157370_10006965 3300013104 Bacteria 12348
27 Ga0157370_10102573 3300013104 Bacteria 2678
28 Ga0157370_10586365 3300013104 Bacteria 1021
29 Ga0157369_10128276 3300013105 Bacteria 2688
30 Ga0163162_10121507 3300013306 Bacteria 2716
31 Ga0163162_11021440 3300013306 Bacteria 935
32 Ga0157372_10046242 3300013307 Bacteria 4831
33 Ga0157372_10141711 3300013307 Bacteria 2770
34 Ga0182008_10010735 3300014497 Bacteria 4894
35 Ga0182006_1037263 3300015261 Bacteria 1928
36 Ga0182006_1073339 3300015261 Bacteria 1263
37 Ga0182007_10000404 3300015262 Bacteria 26657
38 Ga0163161_10004221 3300017792 Bacteria 10032
39 Ga0163161_10180389 3300017792 Bacteria 1618
40 Ga0213871_10110368 3300021441 Bacteria 813
41 Ga0207427_100143 3300025231 Bacteria 82800
42 Ga0209437_100255 3300025233 Bacteria 82963
43 Ga0209677_100786 3300025253 Bacteria 15957
44 Ga0209233_1000172 3300025261 Bacteria 146504
45 Ga0209025_1000003 3300025294 Bacteria 1366495
46 Ga0207696_1000042 3300025711 Bacteria 307256
47 Ga0207696_1010401 3300025711 Bacteria 3411
48 Ga0207655_1001865 3300025728 Bacteria 18163
49 Ga0207655_1005408 3300025728 Bacteria 8690
50 Ga0207655_1010470 3300025728 Bacteria 5619
51 Ga0207655_1049673 3300025728 Bacteria 1710
52 Ga0207649_10251677 3300025920 Bacteria 1273
53 Ga0207709_10019327 3300025935 Bacteria 3828
54 Ga0207678_10438855 3300026067 Bacteria 1134
55 Ga0209371_1000134 3300027312 Bacteria 121747
56 Ga0209371_1001258 3300027312 Bacteria 18008
57 Ga0209371_1013374 3300027312 Bacteria 2309
58 Ga0268266_10000356 3300028379 Bacteria 70908
59 Ga0265338_10002816 3300028800 Bacteria 25386
60 Ga0268256_1000790 3300030500 Bacteria 22804
61 Ga0268256_1015855 3300030500 Bacteria 2182
62 Ga0316176_1135288 3300030732 Bacteria 1570
63 Ga0314311_1021826 3300030733 Bacteria 3757
64 Ga0316183_1023281 3300030742 Bacteria 3470
65 Ga0316181_1287062 3300030744 Bacteria 2408
66 Ga0307405_10029935 3300031731 Bacteria 3187
67 Ga0307405_10213491 3300031731 Bacteria 1410
68 Ga0307518_10078044 3300031838 Bacteria 2392
69 Ga0307406_10002013 3300031901 Bacteria 11095
70 Ga0307407_10275758 3300031903 Bacteria 1162
71 Ga0307412_10204595 3300031911 Bacteria 1501
72 Ga0307409_100194322 3300031995 Bacteria 1809
73 Ga0307414_10516444 3300032004 Bacteria 1059
74 Ga0307411_10166935 3300032005 Bacteria 1655
75 Ga0316574_0024662 3300035398 Bacteria 3603
76 Ga0395905_0057923 3300037471 Bacteria 3624
77 Ga0436364_1370784 3300037853 Bacteria 2668
78 Ga0436360_0084702 3300039438 Bacteria 1509
79 Ga0436361_0646404 3300039447 Bacteria 2082
80 Ga0436361_0666781 3300039447 Bacteria 1587
81 Ga0439438_000035 3300041405 Bacteria 67105
82 Ga0439438_000082 3300041405 Bacteria 44059
83 Ga0439438_003497 3300041405 Bacteria 6342
84 Ga0439447_001625 3300041407 Bacteria 8245
85 Ga0439432_000585 3300042006 Bacteria 13726
86 Ga0439452_005262 3300042010 Bacteria 4195
87 Ga0450907_001474 3300042146 Bacteria 5070
88 Ga0439464_0014971 3300042439 Bacteria 2090
89 Ga0453684_0030363 3300044712 Bacteria 7636
90 Ga0466958_0238699 3300045836 Bacteria 1161
91 Ga0495617_000020 3300046452 Bacteria 230257
92 Ga0495617_000028 3300046452 Bacteria 156686
93 Ga0495617_029577 3300046452 Bacteria 1842
94 Ga0495617_051688 3300046452 Bacteria 1366
95 Ga0495627_000007 3300046453 Bacteria 575915
96 Ga0495627_003944 3300046453 Bacteria 6345
97 Ga0495627_004183 3300046453 Bacteria 6117
98 Ga0495627_027052 3300046453 Bacteria 1844
99 Ga0495627_096263 3300046453 Bacteria 848
100 Ga0495627_105823 3300046453 Bacteria 800
101 Ga0495592_0024462 3300046454 Bacteria 4590
102 Ga0495603_0025463 3300046455 Bacteria 3578
103 Ga0495590_0000001 3300046457 Bacteria 762984
104 Ga0495590_0000013 3300046457 Bacteria 271977
105 Ga0495590_0114518 3300046457 Bacteria 964
106 Ga0495591_000013 3300046458 Bacteria 268106
107 Ga0495591_000109 3300046458 Bacteria 94877
108 Ga0495591_000679 3300046458 Bacteria 24877
109 Ga0495591_002214 3300046458 Bacteria 11088
110 Ga0495591_005630 3300046458 Bacteria 5746
111 Ga0495591_019299 3300046458 Bacteria 2286
112 Ga0495591_023665 3300046458 Bacteria 1963
113 Ga0495591_039494 3300046458 Bacteria 1352
114 Ga0495629_0007591 3300046459 Bacteria 7990
115 Ga0495629_0098855 3300046459 Bacteria 2036
116 Ga0495638_0000184 3300046460 Bacteria 95341
117 Ga0495641_0121045 3300046461 Bacteria 1168
118 Ga0495651_0001767 3300046462 Bacteria 16687
119 Ga0495653_0000082 3300046463 Bacteria 80285
120 Ga0495653_0007736 3300046463 Bacteria 8794
121 Ga0495653_0014301 3300046463 Bacteria 6471
122 Ga0495653_0017087 3300046463 Bacteria 5902
123 Ga0495653_0040476 3300046463 Bacteria 3641
124 Ga0495650_0000001 3300046471 Bacteria 1085492
125 Ga0495650_0000033 3300046471 Bacteria 412188
126 Ga0495650_0000108 3300046471 Bacteria 200369
127 Ga0495650_0000462 3300046471 Bacteria 63149
128 Ga0495650_0000643 3300046471 Bacteria 46325
129 Ga0495650_0002761 3300046471 Bacteria 13545
130 Ga0495650_0022896 3300046471 Bacteria 2986
131 Ga0495580_0003497 3300046472 Bacteria 13364
132 Ga0495580_0117528 3300046472 Bacteria 1846
133 Ga0495605_0000008 3300046474 Bacteria 334602
134 Ga0495605_0000056 3300046474 Bacteria 155610
135 Ga0495605_0006763 3300046474 Bacteria 6553
136 Ga0495605_0025453 3300046474 Bacteria 3084
137 Ga0495605_0026465 3300046474 Bacteria 3015
138 Ga0495605_0041710 3300046474 Bacteria 2285
139 Ga0495605_0137784 3300046474 Bacteria 1096
140 Ga0495605_0213141 3300046474 Bacteria 837
141 Ga0495664_0031270 3300046477 Bacteria 3120
142 Ga0495584_0000074 3300046491 Bacteria 71485
143 Ga0495584_0000158 3300046491 Bacteria 47396
144 Ga0495584_0012453 3300046491 Bacteria 4341
145 Ga0495584_0021973 3300046491 Bacteria 3239
146 Ga0495584_0028083 3300046491 Bacteria 2849
147 Ga0495584_0043918 3300046491 Bacteria 2256
148 Ga0495584_0058764 3300046491 Bacteria 1934
149 Ga0495584_0125781 3300046491 Bacteria 1299
150 Ga0495585_0000048 3300046492 Bacteria 120031
151 Ga0495585_0000424 3300046492 Bacteria 40738
152 Ga0495585_0000726 3300046492 Bacteria 29412
153 Ga0495585_0005179 3300046492 Bacteria 8275
154 Ga0495585_0014320 3300046492 Bacteria 4622
155 Ga0495585_0040925 3300046492 Bacteria 2600
156 Ga0495585_0108897 3300046492 Bacteria 1475
157 Ga0495585_0136357 3300046492 Bacteria 1288
158 Ga0495585_0186631 3300046492 Bacteria 1063
159 Ga0495594_0000625 3300046499 Bacteria 18226
160 Ga0495594_0013754 3300046499 Bacteria 4229
161 Ga0495594_0028369 3300046499 Bacteria 3020
162 Ga0495596_0003828 3300046500 Bacteria 7487
163 Ga0495596_0006325 3300046500 Bacteria 5468
164 Ga0495596_0007719 3300046500 Bacteria 4834
165 Ga0495596_0019847 3300046500 Bacteria 2756
166 Ga0495596_0025226 3300046500 Bacteria 2404
167 Ga0495596_0050990 3300046500 Bacteria 1621
168 Ga0495596_0194825 3300046500 Bacteria 787
169 Ga0495607_0000324 3300046501 Bacteria 49450
170 Ga0495607_0000479 3300046501 Bacteria 40004
171 Ga0495607_0001178 3300046501 Bacteria 23602
172 Ga0495607_0001248 3300046501 Bacteria 22826
173 Ga0495607_0002143 3300046501 Bacteria 16463
174 Ga0495607_0002148 3300046501 Bacteria 16437
175 Ga0495607_0004315 3300046501 Bacteria 10490
176 Ga0495607_0028018 3300046501 Bacteria 3479
177 Ga0495607_0080935 3300046501 Bacteria 1784
178 Ga0495607_0268541 3300046501 Bacteria 814
179 Ga0495583_0000039 3300046506 Bacteria 241501
180 Ga0495583_0000119 3300046506 Bacteria 133447
181 Ga0495583_0001888 3300046506 Bacteria 19427
182 Ga0495583_0008530 3300046506 Bacteria 6253
183 Ga0495583_0013518 3300046506 Bacteria 4549
184 Ga0495583_0054230 3300046506 Bacteria 1816
185 Ga0495583_0121013 3300046506 Bacteria 1102
186 Ga0495606_0000007 3300046507 Bacteria 323713
187 Ga0495606_0000070 3300046507 Bacteria 177343
188 Ga0495606_0000161 3300046507 Bacteria 117607
189 Ga0495606_0000408 3300046507 Bacteria 72620
190 Ga0495606_0000440 3300046507 Bacteria 68395
191 Ga0495606_0001523 3300046507 Bacteria 30685
192 Ga0495606_0004327 3300046507 Bacteria 14287
193 Ga0495606_0012272 3300046507 Bacteria 6892
194 Ga0495606_0013928 3300046507 Bacteria 6311
195 Ga0495606_0078854 3300046507 Bacteria 2053
196 Ga0495606_0190110 3300046507 Bacteria 1177
197 Ga0495608_0018485 3300046511 Bacteria 4807
198 Ga0495610_0000014 3300046512 Bacteria 444708
199 Ga0495610_0000313 3300046512 Bacteria 51404
200 Ga0495610_0005896 3300046512 Bacteria 8585
201 Ga0495610_0007336 3300046512 Bacteria 7368
202 Ga0495610_0015587 3300046512 Bacteria 4408
203 Ga0495610_0018777 3300046512 Bacteria 3889
204 Ga0495616_0000273 3300046513 Bacteria 41880
205 Ga0495616_0000705 3300046513 Bacteria 24761
206 Ga0495616_0003218 3300046513 Bacteria 10525
207 Ga0495616_0005194 3300046513 Bacteria 8056
208 Ga0495616_0032621 3300046513 Bacteria 2718
209 Ga0495616_0111219 3300046513 Bacteria 1272
210 Ga0495616_0206469 3300046513 Bacteria 861
211 Ga0495618_0003519 3300046514 Bacteria 9728
212 Ga0495620_0000046 3300046515 Bacteria 108205
213 Ga0495620_0000068 3300046515 Bacteria 86731
214 Ga0495628_0036114 3300046516 Bacteria 3968
215 Ga0495630_0002157 3300046517 Bacteria 13699
216 Ga0495631_0002669 3300046518 Bacteria 9929
217 Ga0495631_0003716 3300046518 Bacteria 8322
218 Ga0495631_0004385 3300046518 Bacteria 7517
219 Ga0495631_0006672 3300046518 Bacteria 5935
220 Ga0495631_0015151 3300046518 Bacteria 3703
221 Ga0495631_0015402 3300046518 Bacteria 3665
222 Ga0495631_0076168 3300046518 Bacteria 1448
223 Ga0495631_0137187 3300046518 Bacteria 1050
224 Ga0495631_0215214 3300046518 Bacteria 820
225 Ga0495632_0000503 3300046519 Bacteria 36843
226 Ga0495632_0000555 3300046519 Bacteria 34929
227 Ga0495632_0001943 3300046519 Bacteria 16506
228 Ga0495632_0034670 3300046519 Bacteria 2580
229 Ga0495637_0000008 3300046520 Bacteria 404658
230 Ga0495637_0000443 3300046520 Bacteria 30281
231 Ga0495637_0000528 3300046520 Bacteria 27567
232 Ga0495637_0005975 3300046520 Bacteria 6156
233 Ga0495637_0114357 3300046520 Bacteria 1043
234 Ga0495643_0000361 3300046522 Bacteria 61853
235 Ga0495643_0000459 3300046522 Bacteria 51854
236 Ga0495643_0000505 3300046522 Bacteria 48848
237 Ga0495643_0021148 3300046522 Bacteria 3738
238 Ga0495643_0024129 3300046522 Bacteria 3452
239 Ga0495643_0033376 3300046522 Bacteria 2848
240 Ga0495643_0038355 3300046522 Bacteria 2624
241 Ga0495643_0043129 3300046522 Bacteria 2456
242 Ga0495643_0153271 3300046522 Bacteria 1139
243 Ga0495644_0010652 3300046523 Bacteria 3541
244 Ga0495644_0013925 3300046523 Bacteria 3083
245 Ga0495644_0021679 3300046523 Bacteria 2449
246 Ga0495644_0108511 3300046523 Bacteria 1052
247 Ga0495648_0000001 3300046524 Bacteria 696872
248 Ga0495648_0001043 3300046524 Bacteria 28117
249 Ga0495648_0001083 3300046524 Bacteria 27678
250 Ga0495648_0011562 3300046524 Bacteria 6639
251 Ga0495648_0012949 3300046524 Bacteria 6194
252 Ga0495648_0018753 3300046524 Bacteria 4884
253 Ga0495648_0019418 3300046524 Bacteria 4778
254 Ga0495648_0021220 3300046524 Bacteria 4505
255 Ga0495648_0055877 3300046524 Bacteria 2378
256 Ga0495663_0001261 3300046525 Bacteria 8044
257 Ga0495666_0000847 3300046526 Bacteria 14183
258 Ga0495666_0001810 3300046526 Bacteria 10562
259 Ga0495666_0123782 3300046526 Bacteria 1210
260 Ga0495642_0000191 3300046528 Bacteria 36297
261 Ga0495642_0001888 3300046528 Bacteria 8929
262 Ga0495642_0004660 3300046528 Bacteria 5312
263 Ga0495642_0007488 3300046528 Bacteria 4182
264 Ga0495642_0011959 3300046528 Bacteria 3342
265 Ga0495642_0031155 3300046528 Bacteria 2137
266 Ga0495642_0066632 3300046528 Bacteria 1501
267 Ga0495642_0113602 3300046528 Bacteria 1159
268 Ga0495642_0200825 3300046528 Bacteria 869
269 Ga0495652_0003824 3300046529 Bacteria 14696
270 Ga0495652_0352060 3300046529 Bacteria 1055
271 Ga0495654_0000002 3300046530 Bacteria 1021205
272 Ga0495654_0000020 3300046530 Bacteria 284814
273 Ga0495654_0000038 3300046530 Bacteria 185693
274 Ga0495654_0000041 3300046530 Bacteria 174733
275 Ga0495654_0000807 3300046530 Bacteria 24034
276 Ga0495654_0001662 3300046530 Bacteria 15055
277 Ga0495654_0003890 3300046530 Bacteria 9027
278 Ga0495654_0012222 3300046530 Bacteria 4618
279 Ga0495654_0012437 3300046530 Bacteria 4570
280 Ga0495654_0047148 3300046530 Bacteria 2119
281 Ga0495665_0007388 3300046531 Bacteria 5941
282 Ga0495665_0017320 3300046531 Bacteria 3875
283 Ga0495640_0000889 3300046533 Bacteria 22941
284 Ga0495640_0149961 3300046533 Bacteria 1499
285 Ga0495640_0476140 3300046533 Bacteria 761
286 Ga0495586_0015854 3300046535 Bacteria 4008
287 Ga0495587_0007121 3300046536 Bacteria 7256
288 Ga0495587_0080390 3300046536 Bacteria 1889
289 Ga0495609_0000031 3300046538 Bacteria 213813
290 Ga0495609_0000095 3300046538 Bacteria 104807
291 Ga0495609_0001197 3300046538 Bacteria 17857
292 Ga0495609_0004440 3300046538 Bacteria 7669
293 Ga0495609_0007887 3300046538 Bacteria 5263
294 Ga0495609_0030218 3300046538 Bacteria 2466
295 Ga0495609_0032900 3300046538 Bacteria 2354
296 Ga0495609_0035465 3300046538 Bacteria 2258
297 Ga0495609_0036430 3300046538 Bacteria 2221
298 Ga0495609_0064384 3300046538 Bacteria 1617
299 Ga0495597_0004891 3300046542 Bacteria 7210
300 Ga0495597_0012324 3300046542 Bacteria 4125
301 Ga0495622_0000276 3300046557 Bacteria 39002
302 Ga0495622_0020782 3300046557 Bacteria 3056
303 Ga0495633_0000011 3300046558 Bacteria 268237
304 Ga0495633_0000132 3300046558 Bacteria 100231
305 Ga0495633_0000171 3300046558 Bacteria 86031
306 Ga0495633_0000792 3300046558 Bacteria 28178
307 Ga0495633_0002160 3300046558 Bacteria 14100
308 Ga0495633_0007057 3300046558 Bacteria 6540
309 Ga0495633_0064061 3300046558 Bacteria 1719
310 Ga0495656_0022925 3300046615 Bacteria 2451
311 Ga0495656_0122377 3300046615 Bacteria 1230
312 Ga0495656_0216678 3300046615 Bacteria 956
313 Ga0495656_0294489 3300046615 Bacteria 830
314 Ga0495668_0000146 3300046616 Bacteria 106276
315 Ga0495668_0000487 3300046616 Bacteria 49686
316 Ga0495668_0000579 3300046616 Bacteria 44604
317 Ga0495668_0011759 3300046616 Bacteria 5222
318 Ga0495668_0027156 3300046616 Bacteria 3244
319 Ga0495668_0054328 3300046616 Bacteria 2214
320 Ga0495668_0288307 3300046616 Bacteria 899
321 Ga0495634_0001994 3300046642 Bacteria 17391
322 Ga0495634_0023001 3300046642 Bacteria 4387
323 Ga0495611_0000214 3300046648 Bacteria 40851
324 Ga0495611_0002426 3300046648 Bacteria 8535
325 Ga0495611_0003086 3300046648 Bacteria 7397
326 Ga0495611_0005403 3300046648 Bacteria 5467
327 Ga0495611_0247343 3300046648 Bacteria 827
328 Ga0495625_0000483 3300046660 Bacteria 59571
329 Ga0495625_0020252 3300046660 Bacteria 5139
330 Ga0495625_0034279 3300046660 Bacteria 3747
331 Ga0495625_0063553 3300046660 Bacteria 2606
332 Ga0495625_0066735 3300046660 Bacteria 2534
333 Ga0495625_0206263 3300046660 Bacteria 1294
334 Ga0495625_0301861 3300046660 Bacteria 1024
335 Ga0495635_0022236 3300046663 Bacteria 4416
336 Ga0495635_0104832 3300046663 Bacteria 1932
337 Ga0495661_0000012 3300046665 Bacteria 276804
338 Ga0495661_0000493 3300046665 Bacteria 41154
339 Ga0495661_0000591 3300046665 Bacteria 37505
340 Ga0495661_0001091 3300046665 Bacteria 23846
341 Ga0495661_0002208 3300046665 Bacteria 15179
342 Ga0495661_0002775 3300046665 Bacteria 13270
343 Ga0495661_0002864 3300046665 Bacteria 13046
344 Ga0495661_0009220 3300046665 Bacteria 6782
345 Ga0495661_0011222 3300046665 Bacteria 6080
346 Ga0495661_0030741 3300046665 Bacteria 3417
347 Ga0495661_0049395 3300046665 Bacteria 2551
348 Ga0495661_0057056 3300046665 Bacteria 2333
349 Ga0495661_0064923 3300046665 Bacteria 2152
350 Ga0495661_0122667 3300046665 Bacteria 1433
351 Ga0495588_0005068 3300046674 Bacteria 5851
352 Ga0495588_0012626 3300046674 Bacteria 3998
353 Ga0495588_0077750 3300046674 Bacteria 1731
354 Ga0495588_0100825 3300046674 Bacteria 1517
355 Ga0495599_0016376 3300046678 Bacteria 4602
356 Ga0495623_0003308 3300046679 Bacteria 10650
357 Ga0495623_0005569 3300046679 Bacteria 8222
358 Ga0495623_0014267 3300046679 Bacteria 5147
359 Ga0495623_0203120 3300046679 Bacteria 1138
360 Ga0495646_0001168 3300046680 Bacteria 15336
361 Ga0495669_0005169 3300046684 Bacteria 5427
362 Ga0495669_0008660 3300046684 Bacteria 4281
363 Ga0495613_0029128 3300046689 Bacteria 4105
364 Ga0495613_0092323 3300046689 Bacteria 2192
365 Ga0495624_0002313 3300046690 Bacteria 14509
366 Ga0495624_0247337 3300046690 Bacteria 1079
367 Ga0495670_0004445 3300046691 Bacteria 6879
368 Ga0495670_0007409 3300046691 Bacteria 5389
369 Ga0495670_0017252 3300046691 Bacteria 3552
370 Ga0495670_0057396 3300046691 Bacteria 1954
371 Ga0495670_0162235 3300046691 Bacteria 1175
372 Ga0495670_0172886 3300046691 Bacteria 1138
373 Ga0495670_0226107 3300046691 Bacteria 994
374 Ga0495671_0000005 3300046692 Bacteria 509397
375 Ga0495671_0007573 3300046692 Bacteria 6176
376 Ga0495671_0009682 3300046692 Bacteria 5374
377 Ga0495671_0014256 3300046692 Bacteria 4283
378 Ga0495671_0033699 3300046692 Bacteria 2607
379 Ga0495671_0046775 3300046692 Bacteria 2163
380 Ga0495671_0054682 3300046692 Bacteria 1978
381 Ga0495671_0067057 3300046692 Bacteria 1765
382 Ga0495649_0000535 3300046694 Bacteria 32186
383 Ga0495649_0096039 3300046694 Bacteria 1577
384 Ga0495649_0237063 3300046694 Bacteria 940
385 Ga0495589_0000007 3300046794 Bacteria 276444
386 Ga0495589_0000054 3300046794 Bacteria 111355
387 Ga0495589_0000293 3300046794 Bacteria 40161
388 Ga0495589_0000550 3300046794 Bacteria 25890
389 Ga0495589_0001653 3300046794 Bacteria 12766
390 Ga0495589_0016350 3300046794 Bacteria 3814
391 Ga0495589_0017358 3300046794 Bacteria 3694
392 Ga0495589_0019173 3300046794 Bacteria 3509
393 Ga0495589_0043559 3300046794 Bacteria 2233
394 Ga0495589_0045759 3300046794 Bacteria 2173
395 Ga0495589_0120362 3300046794 Bacteria 1264
396 Ga0495589_0136818 3300046794 Bacteria 1174
397 Ga0495600_0000280 3300046809 Bacteria 27638
398 Ga0495600_0068268 3300046809 Bacteria 2323
399 Ga0495660_0000011 3300046810 Bacteria 361397
400 Ga0495660_0000055 3300046810 Bacteria 134615
401 Ga0495660_0000172 3300046810 Bacteria 69913
402 Ga0495660_0000779 3300046810 Bacteria 23870
403 Ga0495660_0002144 3300046810 Bacteria 12721
404 Ga0495660_0003099 3300046810 Bacteria 10364
405 Ga0495660_0024399 3300046810 Bacteria 3445
406 Ga0495660_0026237 3300046810 Bacteria 3304
407 Ga0495660_0061324 3300046810 Bacteria 2018
408 Ga0495660_0099465 3300046810 Bacteria 1499
409 Ga0495604_0008804 3300047317 Bacteria 7976
410 Ga0495604_0014677 3300047317 Bacteria 6244
411 Ga0495604_0050382 3300047317 Bacteria 3233
412 Ga0495636_0219534 3300047318 Bacteria 872
413 Ga0495674_0003883 3300047319 Bacteria 14514
414 Ga0495672_0000004 3300047320 Bacteria 631810
415 Ga0495672_0000013 3300047320 Bacteria 511827
416 Ga0495672_0000032 3300047320 Bacteria 295356
417 Ga0495672_0000033 3300047320 Bacteria 291992
418 Ga0495672_0000096 3300047320 Bacteria 143686
419 Ga0495672_0000386 3300047320 Bacteria 54325
420 Ga0495672_0000580 3300047320 Bacteria 41398
421 Ga0495672_0016673 3300047320 Bacteria 4936
422 Ga0495672_0130749 3300047320 Bacteria 1321
423 Ga0495672_0218796 3300047320 Bacteria 941
424 Ga0495676_0000273 3300047321 Bacteria 41772
425 Ga0495676_0077590 3300047321 Bacteria 2533
426 Ga0495680_0003145 3300047322 Bacteria 16453
427 Ga0495680_0003552 3300047322 Bacteria 15283
428 Ga0495683_0000114 3300047323 Bacteria 82525
429 Ga0495683_0000301 3300047323 Bacteria 41920
430 Ga0495683_0000345 3300047323 Bacteria 38519
431 Ga0495683_0000819 3300047323 Bacteria 22130
432 Ga0495683_0019864 3300047323 Bacteria 3465
433 Ga0495683_0042630 3300047323 Bacteria 2287
434 Ga0495683_0043935 3300047323 Bacteria 2248
435 Ga0495683_0074368 3300047323 Bacteria 1665
436 Ga0495683_0101924 3300047323 Bacteria 1379
437 Ga0495687_000003 3300047443 Bacteria 859509
438 Ga0495687_000474 3300047443 Bacteria 48718
439 Ga0495687_000704 3300047443 Bacteria 37263
440 Ga0495687_000843 3300047443 Bacteria 32659
441 Ga0495687_003092 3300047443 Bacteria 12465
442 Ga0495675_0000447 3300047444 Bacteria 27413
443 Ga0495675_0005942 3300047444 Bacteria 7460
444 Ga0495675_0242883 3300047444 Bacteria 1083
445 Ga0495677_0000005 3300047445 Bacteria 243336
446 Ga0495677_0000270 3300047445 Bacteria 22801
447 Ga0495677_0001551 3300047445 Bacteria 9265
448 Ga0495677_0002228 3300047445 Bacteria 7669
449 Ga0495677_0003101 3300047445 Bacteria 6473
450 Ga0495677_0010955 3300047445 Bacteria 3321
451 Ga0495677_0047928 3300047445 Bacteria 1569
452 Ga0495677_0085060 3300047445 Bacteria 1188
453 Ga0495677_0128430 3300047445 Bacteria 969
454 Ga0495679_000043 3300047446 Bacteria 142160
455 Ga0495679_000304 3300047446 Bacteria 39542
456 Ga0495679_002632 3300047446 Bacteria 9014
457 Ga0495679_005248 3300047446 Bacteria 5779
458 Ga0495685_045432 3300047447 Bacteria 1496
459 Ga0495673_0000009 3300047469 Bacteria 731993
460 Ga0495673_0000023 3300047469 Bacteria 539904
461 Ga0495673_0000028 3300047469 Bacteria 473418
462 Ga0495673_0016244 3300047469 Bacteria 3811
463 Ga0495673_0018474 3300047469 Bacteria 3513
464 Ga0495681_0002816 3300047470 Bacteria 12304
465 Ga0495681_0004589 3300047470 Bacteria 9404
466 Ga0495681_0012673 3300047470 Bacteria 4941
467 Ga0495681_0017640 3300047470 Bacteria 3956
468 Ga0495681_0018426 3300047470 Bacteria 3846
469 Ga0495681_0020104 3300047470 Bacteria 3629
470 Ga0495681_0132112 3300047470 Bacteria 1061
471 Ga0495684_0072338 3300047471 Bacteria 2620
472 Ga0495686_0000054 3300047472 Bacteria 259400
473 Ga0495686_0001166 3300047472 Bacteria 30748
474 Ga0495686_0015119 3300047472 Bacteria 5286
475 Ga0495686_0055268 3300047472 Bacteria 2483
476 Ga0495686_0311015 3300047472 Bacteria 866
477 Ga0495593_0001373 3300047673 Bacteria 14235
478 Ga0495593_0006309 3300047673 Bacteria 6955
479 Ga0495602_0003973 3300048088 Bacteria 15405
480 Ga0495602_0202551 3300048088 Bacteria 1513
481 Ga0495614_0026580 3300048089 Bacteria 2495
482 Ga0495626_0000017 3300048091 Bacteria 231648
483 Ga0495626_0000053 3300048091 Bacteria 155543
484 Ga0495626_0000543 3300048091 Bacteria 37476
485 Ga0495626_0001020 3300048091 Bacteria 24084
486 Ga0495626_0007202 3300048091 Bacteria 6218
487 Ga0495626_0014143 3300048091 Bacteria 4128
488 Ga0495626_0030393 3300048091 Bacteria 2605
489 Ga0495626_0051413 3300048091 Bacteria 1900
490 Ga0495626_0131097 3300048091 Bacteria 1070
491 Ga0496100_0593667 3300048903 Bacteria 859
492 Ga0496101_0000324 3300048904 Bacteria 32661
493 Ga0496101_0002266 3300048904 Bacteria 11752
494 Ga0496103_0003365 3300048906 Bacteria 9782
495 Ga0496105_0024276 3300048908 Bacteria 4927
496 Ga0496111_0002901 3300048914 Bacteria 10472
497 Ga0496114_0024682 3300048917 Bacteria 4908
498 Ga0496116_0013844 3300048919 Bacteria 6476
499 Ga0496116_0022952 3300048919 Bacteria 4658
500 Ga0496116_0113161 3300048919 Bacteria 1589
501 Ga0496117_0000145 3300048920 Bacteria 153289
502 Ga0496117_0007273 3300048920 Bacteria 10879
503 Ga0496117_0129892 3300048920 Bacteria 1529
504 Ga0496118_0000397 3300048921 Bacteria 73353
505 Ga0496118_0094118 3300048921 Bacteria 2050
506 Ga0496118_0171283 3300048921 Bacteria 1326
507 Ga0496119_0023566 3300048922 Bacteria 4358
508 Ga0496120_0001585 3300048923 Bacteria 26456
509 Ga0496120_0066232 3300048923 Bacteria 1998
510 Ga0496121_0007569 3300048924 Bacteria 13079
511 Ga0496121_0014071 3300048924 Bacteria 8535
512 Ga0496121_0029716 3300048924 Bacteria 5042
513 Ga0496122_0008873 3300048925 Bacteria 10722
514 Ga0496122_0014290 3300048925 Bacteria 7689
515 Ga0496122_0030935 3300048925 Bacteria 4470
516 Ga0496122_0107965 3300048925 Bacteria 1837
517 Ga0496123_0002194 3300048926 Bacteria 24832
518 Ga0496123_0002866 3300048926 Bacteria 20263
519 Ga0496123_0007807 3300048926 Bacteria 9961
520 Ga0496123_0114638 3300048926 Bacteria 1531
521 Ga0496124_0005010 3300048927 Bacteria 15149
522 Ga0496124_0022664 3300048927 Bacteria 5751
523 Ga0496124_0024811 3300048927 Bacteria 5443
524 Ga0496124_0039688 3300048927 Bacteria 4078
525 Ga0496124_0144447 3300048927 Bacteria 1874
526 Ga0496124_0146091 3300048927 Bacteria 1860
527 Ga0496124_0154806 3300048927 Bacteria 1794
528 Ga0496124_0284988 3300048927 Bacteria 1202
529 Ga0496124_0401940 3300048927 Bacteria 951
530 Ga0496125_0075693 3300048928 Bacteria 2603
531 Ga0496126_0000248 3300048929 Bacteria 116557
532 Ga0496126_0022569 3300048929 Bacteria 6119
533 Ga0496126_0030527 3300048929 Bacteria 5104
534 Ga0495678_000004 3300049459 Bacteria 532920
535 Ga0495678_000018 3300049459 Bacteria 279747
536 Ga0495678_000024 3300049459 Bacteria 229034
537 Ga0495678_000203 3300049459 Bacteria 69724
538 Ga0495678_000459 3300049459 Bacteria 40493
539 Ga0495678_000835 3300049459 Bacteria 27526
540 Ga0495678_002374 3300049459 Bacteria 12907
541 Ga0495678_002971 3300049459 Bacteria 10823
542 Ga0495678_007634 3300049459 Bacteria 5580
543 Ga0495678_015031 3300049459 Bacteria 3577
544 Ga0495678_041881 3300049459 Bacteria 1829
545 Ga0495678_064746 3300049459 Bacteria 1360
546 Ga0495682_0000004 3300049460 Bacteria 378337
547 Ga0495682_0000716 3300049460 Bacteria 21678
548 Ga0495682_0074820 3300049460 Bacteria 1218
549 Ga0495682_0104585 3300049460 Bacteria 1015
550 Ga0501222_000230 3300049662 Bacteria 9670
551 Ga0501269_000543 3300049766 Bacteria 7315
552 nmdc:mga03683_47888_c1 3300050489 Bacteria 1775
553 nmdc:mga00v17_108346_c1 3300050491 Bacteria 1760
554 Ga0500650_0000107 3300053098 Bacteria 22912
555 Ga0500618_000165 3300053125 Bacteria 55300
556 Ga0500618_000294 3300053125 Bacteria 38052
557 Ga0500618_002626 3300053125 Bacteria 6621
558 Ga0500618_017464 3300053125 Bacteria 1785
559 Ga0500621_000001 3300053126 Bacteria 1049698
560 Ga0500559_0000432 3300053136 Bacteria 29680
561 Ga0500559_0028463 3300053136 Bacteria 2388
562 Ga0500586_031043 3300053145 Bacteria 1761
563 2509127341 2508501125 Bacteria 7208311
564 2511380504 2511231025 Bacteria 5324661
565 2511432832 2511231035 Bacteria 5341610
566 2511434499 2511231035 Bacteria 5341610
567 2514588621 2513237351 Bacteria 6968952
568 2585828802 2585427591 Bacteria 5482980
569 2585834364 2585427592 Bacteria 5370892
570 2599330559 2599185155 Bacteria 5827168
571 2644354822 2643221664 Bacteria 7272945
572 2721025269 2718218334 Bacteria 4765486
573 2738826353 2738541297 Bacteria 6549566
574 2738883045 2738541307 Bacteria 8606193
575 2739150150 2738541357 Bacteria 6549408
576 2739192069 2738543003 Bacteria 6549560
577 2739318546 2738543026 Bacteria 6549408
578 2739336787 2738543029 Bacteria 6549249
579 2778178584 2775507266 Bacteria 7392367
580 2792313856 2791355010 Bacteria 4864581
581 2812367408 2811994881 Bacteria 6298475
582 2842716776 2842711865 Bacteria 7155354
583 2842760760 2842757796 Bacteria 3981385
584 2842916087 2842914999 Bacteria 4419378
585 2857554517 2857553236 Bacteria 6166726
586 2857563890 2857558681 Bacteria 6617694
587 2865014803 2865014394 Bacteria 4764573
588 2876604240 2876601092 Bacteria 5114497
589 2904426964 2904424332 Bacteria 7633521
590 2904479304 2904479285 Bacteria 5073931
591 2923521456 2923519811 Bacteria 6298479
592 2937844588 2937843397 Bacteria 5256375
593 8016735924 8016733728 Bacteria 5274317
594 8019500681 8019499862 Bacteria 5169538
595 8047677433 8047673197 Bacteria 7395230
596 Ga0213871_10081795
597 JGI25162J39368_1000910
598 JGI25164J39214_1000673
599 JGI25151J46595_10000357
600 JGI25165J46597_1000982
601 Ga0055539_1009005
602 Ga0058692_1000208
603 Ga0065714_10066983
604 Ga0070663_100042245
605 Ga0081455_10004476
606 Ga0070717_10044374
607 Ga0075364_10032718
608 Ga0075362_10055929
609 Ga0079104_1001024
610 Ga0105244_10001177
611 Ga0105244_10001181
612 Ga0105244_10005798
613 Ga0105244_10065536
614 Ga0105244_10069878
615 Ga0105243_10032197
616 Ga0105246_10026033
617 Ga0105246_10033481
618 Ga0105246_10113508
619 Ga0157373_10002972
620 Ga0157371_10005670
621 Ga0157370_10006965
622 Ga0157370_10102573
623 Ga0157370_10586365
624 Ga0157369_10128276
625 Ga0163162_10121507
626 Ga0163162_11021440
627 Ga0157372_10046242
628 Ga0157372_10141711
629 Ga0182008_10010735
630 Ga0182006_1037263
631 Ga0182006_1073339
632 Ga0182007_10000404
633 Ga0163161_10004221
634 Ga0163161_10180389
635 Ga0213871_10110368
636 Ga0207427_100143
637 Ga0209437_100255
638 Ga0209677_100786
639 Ga0209233_1000172
640 Ga0209025_1000003
641 Ga0207696_1000042
642 Ga0207696_1010401
643 Ga0207655_1001865
644 Ga0207655_1005408
645 Ga0207655_1010470
646 Ga0207655_1049673
647 Ga0207649_10251677
648 Ga0207709_10019327
649 Ga0207678_10438855
650 Ga0209371_1000134
651 Ga0209371_1001258
652 Ga0209371_1013374
653 Ga0268266_10000356
654 Ga0265338_10002816
655 Ga0268256_1000790
656 Ga0268256_1015855
657 Ga0316176_1135288
658 Ga0314311_1021826
659 Ga0316183_1023281
660 Ga0316181_1287062
661 Ga0307405_10029935
662 Ga0307405_10213491
663 Ga0307518_10078044
664 Ga0307406_10002013
665 Ga0307407_10275758
666 Ga0307412_10204595
667 Ga0307409_100194322
668 Ga0307414_10516444
669 Ga0307411_10166935
670 Ga0316574_0024662
671 Ga0395905_0057923
672 Ga0436364_1370784
673 Ga0436360_0084702
674 Ga0436361_0646404
675 Ga0436361_0666781
676 Ga0439438_000035
677 Ga0439438_000082
678 Ga0439438_003497
679 Ga0439447_001625
680 Ga0439432_000585
681 Ga0439452_005262
682 Ga0450907_001474
683 Ga0439464_0014971
684 Ga0453684_0030363
685 Ga0466958_0238699
686 Ga0495617_000020
687 Ga0495617_000028
688 Ga0495617_029577
689 Ga0495617_051688
690 Ga0495627_000007
691 Ga0495627_003944
692 Ga0495627_004183
693 Ga0495627_027052
694 Ga0495627_096263
695 Ga0495627_105823
696 Ga0495592_0024462
697 Ga0495603_0025463
698 Ga0495590_0000001
699 Ga0495590_0000013
700 Ga0495590_0114518
701 Ga0495591_000013
702 Ga0495591_000109
703 Ga0495591_000679
704 Ga0495591_002214
705 Ga0495591_005630
706 Ga0495591_019299
707 Ga0495591_023665
708 Ga0495591_039494
709 Ga0495629_0007591
710 Ga0495629_0098855
711 Ga0495638_0000184
712 Ga0495641_0121045
713 Ga0495651_0001767
714 Ga0495653_0000082
715 Ga0495653_0007736
716 Ga0495653_0014301
717 Ga0495653_0017087
718 Ga0495653_0040476
719 Ga0495650_0000001
720 Ga0495650_0000033
721 Ga0495650_0000108
722 Ga0495650_0000462
723 Ga0495650_0000643
724 Ga0495650_0002761
725 Ga0495650_0022896
726 Ga0495580_0003497
727 Ga0495580_0117528
728 Ga0495605_0000008
729 Ga0495605_0000056
730 Ga0495605_0006763
731 Ga0495605_0025453
732 Ga0495605_0026465
733 Ga0495605_0041710
734 Ga0495605_0137784
735 Ga0495605_0213141
736 Ga0495664_0031270
737 Ga0495584_0000074
738 Ga0495584_0000158
739 Ga0495584_0012453
740 Ga0495584_0021973
741 Ga0495584_0028083
742 Ga0495584_0043918
743 Ga0495584_0058764
744 Ga0495584_0125781
745 Ga0495585_0000048
746 Ga0495585_0000424
747 Ga0495585_0000726
748 Ga0495585_0005179
749 Ga0495585_0014320
750 Ga0495585_0040925
751 Ga0495585_0108897
752 Ga0495585_0136357
753 Ga0495585_0186631
754 Ga0495594_0000625
755 Ga0495594_0013754
756 Ga0495594_0028369
757 Ga0495596_0003828
758 Ga0495596_0006325
759 Ga0495596_0007719
760 Ga0495596_0019847
761 Ga0495596_0025226
762 Ga0495596_0050990
763 Ga0495596_0194825
764 Ga0495607_0000324
765 Ga0495607_0000479
766 Ga0495607_0001178
767 Ga0495607_0001248
768 Ga0495607_0002143
769 Ga0495607_0002148
770 Ga0495607_0004315
771 Ga0495607_0028018
772 Ga0495607_0080935
773 Ga0495607_0268541
774 Ga0495583_0000039
775 Ga0495583_0000119
776 Ga0495583_0001888
777 Ga0495583_0008530
778 Ga0495583_0013518
779 Ga0495583_0054230
780 Ga0495583_0121013
781 Ga0495606_0000007
782 Ga0495606_0000070
783 Ga0495606_0000161
784 Ga0495606_0000408
785 Ga0495606_0000440
786 Ga0495606_0001523
787 Ga0495606_0004327
788 Ga0495606_0012272
789 Ga0495606_0013928
790 Ga0495606_0078854
791 Ga0495606_0190110
792 Ga0495608_0018485
793 Ga0495610_0000014
794 Ga0495610_0000313
795 Ga0495610_0005896
796 Ga0495610_0007336
797 Ga0495610_0015587
798 Ga0495610_0018777
799 Ga0495616_0000273
800 Ga0495616_0000705
801 Ga0495616_0003218
802 Ga0495616_0005194
803 Ga0495616_0032621
804 Ga0495616_0111219
805 Ga0495616_0206469
806 Ga0495618_0003519
807 Ga0495620_0000046
808 Ga0495620_0000068
809 Ga0495628_0036114
810 Ga0495630_0002157
811 Ga0495631_0002669
812 Ga0495631_0003716
813 Ga0495631_0004385
814 Ga0495631_0006672
815 Ga0495631_0015151
816 Ga0495631_0015402
817 Ga0495631_0076168
818 Ga0495631_0137187
819 Ga0495631_0215214
820 Ga0495632_0000503
821 Ga0495632_0000555
822 Ga0495632_0001943
823 Ga0495632_0034670
824 Ga0495637_0000008
825 Ga0495637_0000443
826 Ga0495637_0000528
827 Ga0495637_0005975
828 Ga0495637_0114357
829 Ga0495643_0000361
830 Ga0495643_0000459
831 Ga0495643_0000505
832 Ga0495643_0021148
833 Ga0495643_0024129
834 Ga0495643_0033376
835 Ga0495643_0038355
836 Ga0495643_0043129
837 Ga0495643_0153271
838 Ga0495644_0010652
839 Ga0495644_0013925
840 Ga0495644_0021679
841 Ga0495644_0108511
842 Ga0495648_0000001
843 Ga0495648_0001043
844 Ga0495648_0001083
845 Ga0495648_0011562
846 Ga0495648_0012949
847 Ga0495648_0018753
848 Ga0495648_0019418
849 Ga0495648_0021220
850 Ga0495648_0055877
851 Ga0495663_0001261
852 Ga0495666_0000847
853 Ga0495666_0001810
854 Ga0495666_0123782
855 Ga0495642_0000191
856 Ga0495642_0001888
857 Ga0495642_0004660
858 Ga0495642_0007488
859 Ga0495642_0011959
860 Ga0495642_0031155
861 Ga0495642_0066632
862 Ga0495642_0113602
863 Ga0495642_0200825
864 Ga0495652_0003824
865 Ga0495652_0352060
866 Ga0495654_0000002
867 Ga0495654_0000020
868 Ga0495654_0000038
869 Ga0495654_0000041
870 Ga0495654_0000807
871 Ga0495654_0001662
872 Ga0495654_0003890
873 Ga0495654_0012222
874 Ga0495654_0012437
875 Ga0495654_0047148
876 Ga0495665_0007388
877 Ga0495665_0017320
878 Ga0495640_0000889
879 Ga0495640_0149961
880 Ga0495640_0476140
881 Ga0495586_0015854
882 Ga0495587_0007121
883 Ga0495587_0080390
884 Ga0495609_0000031
885 Ga0495609_0000095
886 Ga0495609_0001197
887 Ga0495609_0004440
888 Ga0495609_0007887
889 Ga0495609_0030218
890 Ga0495609_0032900
891 Ga0495609_0035465
892 Ga0495609_0036430
893 Ga0495609_0064384
894 Ga0495597_0004891
895 Ga0495597_0012324
896 Ga0495622_0000276
897 Ga0495622_0020782
898 Ga0495633_0000011
899 Ga0495633_0000132
900 Ga0495633_0000171
901 Ga0495633_0000792
902 Ga0495633_0002160
903 Ga0495633_0007057
904 Ga0495633_0064061
905 Ga0495656_0022925
906 Ga0495656_0122377
907 Ga0495656_0216678
908 Ga0495656_0294489
909 Ga0495668_0000146
910 Ga0495668_0000487
911 Ga0495668_0000579
912 Ga0495668_0011759
913 Ga0495668_0027156
914 Ga0495668_0054328
915 Ga0495668_0288307
916 Ga0495634_0001994
917 Ga0495634_0023001
918 Ga0495611_0000214
919 Ga0495611_0002426
920 Ga0495611_0003086
921 Ga0495611_0005403
922 Ga0495611_0247343
923 Ga0495625_0000483
924 Ga0495625_0020252
925 Ga0495625_0034279
926 Ga0495625_0063553
927 Ga0495625_0066735
928 Ga0495625_0206263
929 Ga0495625_0301861
930 Ga0495635_0022236
931 Ga0495635_0104832
932 Ga0495661_0000012
933 Ga0495661_0000493
934 Ga0495661_0000591
935 Ga0495661_0001091
936 Ga0495661_0002208
937 Ga0495661_0002775
938 Ga0495661_0002864
939 Ga0495661_0009220
940 Ga0495661_0011222
941 Ga0495661_0030741
942 Ga0495661_0049395
943 Ga0495661_0057056
944 Ga0495661_0064923
945 Ga0495661_0122667
946 Ga0495588_0005068
947 Ga0495588_0012626
948 Ga0495588_0077750
949 Ga0495588_0100825
950 Ga0495599_0016376
951 Ga0495623_0003308
952 Ga0495623_0005569
953 Ga0495623_0014267
954 Ga0495623_0203120
955 Ga0495646_0001168
956 Ga0495669_0005169
957 Ga0495669_0008660
958 Ga0495613_0029128
959 Ga0495613_0092323
960 Ga0495624_0002313
961 Ga0495624_0247337
962 Ga0495670_0004445
963 Ga0495670_0007409
964 Ga0495670_0017252
965 Ga0495670_0057396
966 Ga0495670_0162235
967 Ga0495670_0172886
968 Ga0495670_0226107
969 Ga0495671_0000005
970 Ga0495671_0007573
971 Ga0495671_0009682
972 Ga0495671_0014256
973 Ga0495671_0033699
974 Ga0495671_0046775
975 Ga0495671_0054682
976 Ga0495671_0067057
977 Ga0495649_0000535
978 Ga0495649_0096039
979 Ga0495649_0237063
980 Ga0495589_0000007
981 Ga0495589_0000054
982 Ga0495589_0000293
983 Ga0495589_0000550
984 Ga0495589_0001653
985 Ga0495589_0016350
986 Ga0495589_0017358
987 Ga0495589_0019173
988 Ga0495589_0043559
989 Ga0495589_0045759
990 Ga0495589_0120362
991 Ga0495589_0136818
992 Ga0495600_0000280
993 Ga0495600_0068268
994 Ga0495660_0000011
995 Ga0495660_0000055
996 Ga0495660_0000172
997 Ga0495660_0000779
998 Ga0495660_0002144
999 Ga0495660_0003099
1000 Ga0495660_0024399
1001 Ga0495660_0026237
1002 Ga0495660_0061324
1003 Ga0495660_0099465
1004 Ga0495604_0008804
1005 Ga0495604_0014677
1006 Ga0495604_0050382
1007 Ga0495636_0219534
1008 Ga0495674_0003883
1009 Ga0495672_0000004
1010 Ga0495672_0000013
1011 Ga0495672_0000032
1012 Ga0495672_0000033
1013 Ga0495672_0000096
1014 Ga0495672_0000386
1015 Ga0495672_0000580
1016 Ga0495672_0016673
1017 Ga0495672_0130749
1018 Ga0495672_0218796
1019 Ga0495676_0000273
1020 Ga0495676_0077590
1021 Ga0495680_0003145
1022 Ga0495680_0003552
1023 Ga0495683_0000114
1024 Ga0495683_0000301
1025 Ga0495683_0000345
1026 Ga0495683_0000819
1027 Ga0495683_0019864
1028 Ga0495683_0042630
1029 Ga0495683_0043935
1030 Ga0495683_0074368
1031 Ga0495683_0101924
1032 Ga0495687_000003
1033 Ga0495687_000474
1034 Ga0495687_000704
1035 Ga0495687_000843
1036 Ga0495687_003092
1037 Ga0495675_0000447
1038 Ga0495675_0005942
1039 Ga0495675_0242883
1040 Ga0495677_0000005
1041 Ga0495677_0000270
1042 Ga0495677_0001551
1043 Ga0495677_0002228
1044 Ga0495677_0003101
1045 Ga0495677_0010955
1046 Ga0495677_0047928
1047 Ga0495677_0085060
1048 Ga0495677_0128430
1049 Ga0495679_000043
1050 Ga0495679_000304
1051 Ga0495679_002632
1052 Ga0495679_005248
1053 Ga0495685_045432
1054 Ga0495673_0000009
1055 Ga0495673_0000023
1056 Ga0495673_0000028
1057 Ga0495673_0016244
1058 Ga0495673_0018474
1059 Ga0495681_0002816
1060 Ga0495681_0004589
1061 Ga0495681_0012673
1062 Ga0495681_0017640
1063 Ga0495681_0018426
1064 Ga0495681_0020104
1065 Ga0495681_0132112
1066 Ga0495684_0072338
1067 Ga0495686_0000054
1068 Ga0495686_0001166
1069 Ga0495686_0015119
1070 Ga0495686_0055268
1071 Ga0495686_0311015
1072 Ga0495593_0001373
1073 Ga0495593_0006309
1074 Ga0495602_0003973
1075 Ga0495602_0202551
1076 Ga0495614_0026580
1077 Ga0495626_0000017
1078 Ga0495626_0000053
1079 Ga0495626_0000543
1080 Ga0495626_0001020
1081 Ga0495626_0007202
1082 Ga0495626_0014143
1083 Ga0495626_0030393
1084 Ga0495626_0051413
1085 Ga0495626_0131097
1086 Ga0496100_0593667
1087 Ga0496101_0000324
1088 Ga0496101_0002266
1089 Ga0496103_0003365
1090 Ga0496105_0024276
1091 Ga0496111_0002901
1092 Ga0496114_0024682
1093 Ga0496116_0013844
1094 Ga0496116_0022952
1095 Ga0496116_0113161
1096 Ga0496117_0000145
1097 Ga0496117_0007273
1098 Ga0496117_0129892
1099 Ga0496118_0000397
1100 Ga0496118_0094118
1101 Ga0496118_0171283
1102 Ga0496119_0023566
1103 Ga0496120_0001585
1104 Ga0496120_0066232
1105 Ga0496121_0007569
1106 Ga0496121_0014071
1107 Ga0496121_0029716
1108 Ga0496122_0008873
1109 Ga0496122_0014290
1110 Ga0496122_0030935
1111 Ga0496122_0107965
1112 Ga0496123_0002194
1113 Ga0496123_0002866
1114 Ga0496123_0007807
1115 Ga0496123_0114638
1116 Ga0496124_0005010
1117 Ga0496124_0022664
1118 Ga0496124_0024811
1119 Ga0496124_0039688
1120 Ga0496124_0144447
1121 Ga0496124_0146091
1122 Ga0496124_0154806
1123 Ga0496124_0284988
1124 Ga0496124_0401940
1125 Ga0496125_0075693
1126 Ga0496126_0000248
1127 Ga0496126_0022569
1128 Ga0496126_0030527
1129 Ga0495678_000004
1130 Ga0495678_000018
1131 Ga0495678_000024
1132 Ga0495678_000203
1133 Ga0495678_000459
1134 Ga0495678_000835
1135 Ga0495678_002374
1136 Ga0495678_002971
1137 Ga0495678_007634
1138 Ga0495678_015031
1139 Ga0495678_041881
1140 Ga0495678_064746
1141 Ga0495682_0000004
1142 Ga0495682_0000716
1143 Ga0495682_0074820
1144 Ga0495682_0104585
1145 Ga0501222_000230
1146 Ga0501269_000543
1147 nmdc:mga03683_47888_c1
1148 nmdc:mga00v17_108346_c1
1149 Ga0500650_0000107
1150 Ga0500618_000165
1151 Ga0500618_000294
1152 Ga0500618_002626
1153 Ga0500618_017464
1154 Ga0500621_000001
1155 Ga0500559_0000432
1156 Ga0500559_0028463
1157 Ga0500586_031043
1158 2509127341
1159 2511380504
1160 2511432832
1161 2511434499
1162 2514588621
1163 2585828802
1164 2585834364
1165 2599330559
1166 2644354822
1167 2721025269
1168 2738826353
1169 2738883045
1170 2739150150
1171 2739192069
1172 2739318546
1173 2739336787
1174 2778178584
1175 2792313856
1176 2812367408
1177 2842716776
1178 2842760760
1179 2842916087
1180 2857554517
1181 2857563890
1182 2865014803
1183 2876604240
1184 2904426964
1185 2904479304
1186 2923521456
1187 2937844588
1188 8016735924
1189 8019500681
1190 8047677433

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

19

216

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.956 2 225
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9349 2 224
1qvv-assembly1.cif.gz_D-2 crystal structure of the s. cerevisiae ydr533c protein 0.9336 1 224
4qyx-assembly1.cif.gz_A crystal structure of ydr533cp 0.9335 2 225
1qvz-assembly1.cif.gz_B crystal structure of the s. cerevisiae ydr533c protein 0.9328 2 224
ID Description Score Start End Superfamily
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9596 1 220 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9557 2 225 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9428 1 220 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9392 2 225 3.40.50.880
1u9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9331 2 224 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A351NYN2-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 1.001 127 225 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-W4RWS6-F1-model_v4 ThiJ/PfpI family protein 0.9985 107 224 GO:0005737
GO:0019172
GO:0019243
AF-A0A844BBE8-F1-model_v4 DJ-1/PfpI family protein 0.998 122 224 GO:0005737
GO:0019172
GO:0019243
AF-A0A455U1L9-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9977 136 225 GO:0005737
GO:0019172
GO:0019243
AF-A0A520DH63-F1-model_v4 Tail specific protease domain-containing protein 0.9966 1 95 GO:0006508
GO:0008236

Map