F468013

General Info

Members Datasets Scaffolds Average Seq Length
600 313 1200 440

Family's Representative Sequence

Representative Sequence 3300046692|Ga0495671_0018039|Ga0495671_0018039_549_1925
Length 458
Sequence MSPYAERRARLMAQMEPGSVAVIATAPEVLRNGDSDYPYRHDSSFYYLTGFTEPEAVLLLVAGRGTSQPQSILFCREKNIEHEIWEGYRYGPEAARAEFGLDFAYPIGQLDEHMTRQLANASALYCSLARNTTLDAQVMRWLESVRRMARSGVTAPSSVRDLLPLIDEMRLLKDEGEQATMLRAGEIAGGAHERAMRAARPGMFEYEIEAELLYEFRRHGAQFPAYTPIVASGANACVLHYNSNNRQTQDGDLVLIDAGCELNGYASDITRTFPVNGKFSGPQRALYDLVLASQDASAAATKAGNRFTDPHDAAVRVLAQGMLDFGLLDANKVGSVDDVIDSRAYFQFYMHRTGHWLGMDVHDCGSYVEPTQVGEVSERKDPLSNELIKNRPSRILQPGMVLTLEPGIYVRPADGVPAQFHNIGIRIEDDAIVTSTGCELISRGVPVKADEIEALMRA

Samples

Sample ID Description Type Environment
1 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
302 2643221556 Massilia sp. Root1485 Isolate Unclassified
303 2643221638 Duganella sp. Root336D2 Isolate Unclassified
304 2643221645 Massilia sp. Root351 Isolate Unclassified
305 2643221664 Massilia sp. Root418 Isolate Unclassified
306 2643221684 Massilia sp. Root133 Isolate Unclassified
307 2738541280 Massilia sp. GV090 Isolate Unclassified
308 2738541300 Massilia sp. GV016 Isolate Unclassified
309 2738543018 Massilia sp. GV045 Isolate Unclassified
310 2738543030 Massilia sp. GV097 Isolate Unclassified
311 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
312 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
313 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.33
Nodule 0.33
Rhizoplane 2.67
Rhizosphere 83.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495671_0018039 3300046692 Bacteria 3753
2 JGI25158J39367_1001321 3300002739 Bacteria 4399
3 JGI25152J39213_1000263 3300002773 Bacteria 35142
4 JGI25150J39212_1000764 3300002774 Bacteria 11096
5 JGI25159J45721_1000645 3300002987 Bacteria 15469
6 JGI25153J46596_10000821 3300003215 Bacteria 18951
7 rootL2_10018597 3300003322 Bacteria 4294
8 JGI25161J50226_1002622 3300003374 Bacteria 4514
9 Ga0055525_1000081 3300003759 Bacteria 161329
10 Ga0055526_1003162 3300003771 Bacteria 10670
11 Ga0055526_1003633 3300003771 Bacteria 9660
12 Ga0055526_1011821 3300003771 Bacteria 3877
13 Ga0055537_1000128 3300003773 Bacteria 58218
14 Ga0055537_1004883 3300003773 Bacteria 3716
15 Ga0055524_1000026 3300003775 Bacteria 214653
16 Ga0055524_1001343 3300003775 Bacteria 14339
17 Ga0055524_1002841 3300003775 Bacteria 8681
18 Ga0055524_1004326 3300003775 Bacteria 6583
19 Ga0055524_1030565 3300003775 Bacteria 1567
20 Ga0055534_1000120 3300003784 Bacteria 57897
21 Ga0055534_1003227 3300003784 Bacteria 5234
22 Ga0055528_1000069 3300003790 Bacteria 83002
23 Ga0055528_1009531 3300003790 Bacteria 4045
24 Ga0055530_10007411 3300003791 Bacteria 4630
25 Ga0055531_10007725 3300003794 Bacteria 5806
26 Ga0055531_10012841 3300003794 Bacteria 3904
27 Ga0055543_1003202 3300004625 Bacteria 4978
28 Ga0055543_1007174 3300004625 Bacteria 2603
29 Ga0065165_1000067 3300005262 Bacteria 170811
30 Ga0065165_1008156 3300005262 Bacteria 4978
31 Ga0065165_1027766 3300005262 Bacteria 1838
32 Ga0070658_10105090 3300005327 Bacteria 2336
33 Ga0070690_100002693 3300005330 Bacteria 9580
34 Ga0070670_100000420 3300005331 Bacteria 34942
35 Ga0068869_100000049 3300005334 Bacteria 50658
36 Ga0068869_100002298 3300005334 Bacteria 11499
37 Ga0070666_10027648 3300005335 Bacteria 3717
38 Ga0070680_100003537 3300005336 Bacteria 11657
39 Ga0070680_100016773 3300005336 Bacteria 5764
40 Ga0068868_100000341 3300005338 Bacteria 31563
41 Ga0068868_100000481 3300005338 Bacteria 26493
42 Ga0070660_100055058 3300005339 Bacteria 3073
43 Ga0070660_100071518 3300005339 Bacteria 2708
44 Ga0070689_100003497 3300005340 Bacteria 10451
45 Ga0070689_100027300 3300005340 Bacteria 4303
46 Ga0070691_10000934 3300005341 Bacteria 11862
47 Ga0070687_100000369 3300005343 Bacteria 15363
48 Ga0070692_10000874 3300005345 Bacteria 10149
49 Ga0070675_100011753 3300005354 Bacteria 6857
50 Ga0070671_100000233 3300005355 Bacteria 37258
51 Ga0070674_100150105 3300005356 Bacteria 1758
52 Ga0070673_100034846 3300005364 Bacteria 3814
53 Ga0070659_100072178 3300005366 Bacteria 2746
54 Ga0070701_10000173 3300005438 Bacteria 20020
55 Ga0070705_100002026 3300005440 Bacteria 10362
56 Ga0070694_100000045 3300005444 Bacteria 57135
57 Ga0070694_100024371 3300005444 Bacteria 3905
58 Ga0070708_100182284 3300005445 Bacteria 1963
59 Ga0068867_100004883 3300005459 Bacteria 9437
60 Ga0070707_100224731 3300005468 Bacteria 1828
61 Ga0070698_100018197 3300005471 Bacteria 7398
62 Ga0070684_100002834 3300005535 Bacteria 12880
63 Ga0070686_100054240 3300005544 Bacteria 2563
64 Ga0070695_100000126 3300005545 Bacteria 34457
65 Ga0070695_100043879 3300005545 Bacteria 2844
66 Ga0070696_100003057 3300005546 Bacteria 11117
67 Ga0070693_100000731 3300005547 Bacteria 14461
68 Ga0070704_100000195 3300005549 Bacteria 24991
69 Ga0070704_100000303 3300005549 Bacteria 21834
70 Ga0068855_100007080 3300005563 Bacteria 13604
71 Ga0068855_100021589 3300005563 Bacteria 7721
72 Ga0070664_100052561 3300005564 Bacteria 3452
73 Ga0068854_100003263 3300005578 Bacteria 10104
74 Ga0068856_100015746 3300005614 Bacteria 7311
75 Ga0070702_100000019 3300005615 Bacteria 46900
76 Ga0068852_100004168 3300005616 Bacteria 10185
77 Ga0068859_100111961 3300005617 Bacteria 2793
78 Ga0068864_100079465 3300005618 Bacteria 2872
79 Ga0068866_10001065 3300005718 Bacteria 12079
80 Ga0068861_100002221 3300005719 Bacteria 12602
81 Ga0068851_10019420 3300005834 Bacteria 3284
82 Ga0068863_100012296 3300005841 Bacteria 8263
83 Ga0068858_100000751 3300005842 Bacteria 33969
84 Ga0068860_100005413 3300005843 Bacteria 12953
85 Ga0068860_100118453 3300005843 Bacteria 2535
86 Ga0068862_100005525 3300005844 Bacteria 10561
87 Ga0081539_10000226 3300005985 Bacteria 132618
88 Ga0070715_10066419 3300006163 Bacteria 1599
89 Ga0097621_100002059 3300006237 Bacteria 13752
90 Ga0097621_100026445 3300006237 Bacteria 4552
91 Ga0068871_100003308 3300006358 Bacteria 11060
92 Ga0075428_100002204 3300006844 Bacteria 21090
93 Ga0075430_100028919 3300006846 Bacteria 4705
94 Ga0075431_100039747 3300006847 Bacteria 4847
95 Ga0075433_10001856 3300006852 Bacteria 15871
96 Ga0075433_10108451 3300006852 Bacteria 2463
97 Ga0075434_100001295 3300006871 Bacteria 20857
98 Ga0075434_100081623 3300006871 Bacteria 3231
99 Ga0075429_100000015 3300006880 Bacteria 78823
100 Ga0075429_100000143 3300006880 Bacteria 43584
101 Ga0068865_100001242 3300006881 Bacteria 14825
102 Ga0075436_100000475 3300006914 Bacteria 26074
103 Ga0075436_100073466 3300006914 Bacteria 2367
104 Ga0097620_100111962 3300006931 Bacteria 2793
105 Ga0099826_10000003 3300006948 Bacteria 1067817
106 Ga0075435_100000811 3300007076 Bacteria 19470
107 Ga0075435_100001385 3300007076 Bacteria 15654
108 Ga0075435_100018574 3300007076 Bacteria 5293
109 Ga0111539_10020073 3300009094 Bacteria 8232
110 Ga0111539_10064434 3300009094 Bacteria 4335
111 Ga0105245_10005835 3300009098 Bacteria 10810
112 Ga0114129_10001740 3300009147 Bacteria 29637
113 Ga0114129_10049912 3300009147 Bacteria 5878
114 Ga0105243_10004530 3300009148 Bacteria 10982
115 Ga0105243_10076465 3300009148 Bacteria 2720
116 Ga0105243_10082673 3300009148 Bacteria 2625
117 Ga0105241_10014386 3300009174 Bacteria 5794
118 Ga0105242_10020708 3300009176 Bacteria 5158
119 Ga0105242_10141356 3300009176 Bacteria 2089
120 Ga0105238_10175054 3300009551 Bacteria 2122
121 Ga0157374_10079072 3300013296 Bacteria 3115
122 Ga0157378_10000579 3300013297 Bacteria 34490
123 Ga0163162_10380998 3300013306 Bacteria 1544
124 Ga0157375_10001103 3300013308 Bacteria 23426
125 Ga0157380_10266469 3300014326 Bacteria 1559
126 Ga0157376_10007532 3300014969 Bacteria 7780
127 Ga0209436_100496 3300025208 Bacteria 17304
128 Ga0209436_101174 3300025208 Bacteria 9642
129 Ga0209563_100015 3300025230 Bacteria 879901
130 Ga0207425_1000006 3300025245 Bacteria 808854
131 Ga0207425_1000531 3300025245 Bacteria 23148
132 Ga0209148_1000413 3300025254 Bacteria 48939
133 Ga0209129_1000009 3300025258 Bacteria 633100
134 Ga0209565_1000006 3300025263 Bacteria 897294
135 Ga0209565_1000163 3300025263 Bacteria 87185
136 Ga0209565_1000562 3300025263 Bacteria 25566
137 Ga0209565_1000674 3300025263 Bacteria 21593
138 Ga0209565_1003189 3300025263 Bacteria 5432
139 Ga0209565_1010193 3300025263 Bacteria 2341
140 Ga0209565_1010863 3300025263 Bacteria 2243
141 Ga0209673_1000004 3300025273 Bacteria 896155
142 Ga0209130_1000223 3300025284 Bacteria 74374
143 Ga0209130_1001753 3300025284 Bacteria 12876
144 Ga0209675_1000224 3300025291 Bacteria 57961
145 Ga0209675_1000292 3300025291 Bacteria 46656
146 Ga0209675_1003337 3300025291 Bacteria 7705
147 Ga0209564_1000098 3300025295 Bacteria 228906
148 Ga0209564_1000102 3300025295 Bacteria 222597
149 Ga0209564_1001497 3300025295 Bacteria 23484
150 Ga0209564_1001667 3300025295 Bacteria 21297
151 Ga0209564_1017469 3300025295 Bacteria 2793
152 Ga0209758_1000071 3300025297 Bacteria 283749
153 Ga0209050_1000183 3300025298 Bacteria 142357
154 Ga0209050_1000731 3300025298 Bacteria 47889
155 Ga0209256_1000372 3300025299 Bacteria 71907
156 Ga0209256_1000495 3300025299 Bacteria 57952
157 Ga0209256_1001594 3300025299 Bacteria 22196
158 Ga0209256_1002381 3300025299 Bacteria 15508
159 Ga0209257_1000010 3300025304 Bacteria 1158682
160 Ga0207642_10001096 3300025899 Bacteria 8394
161 Ga0207685_10042791 3300025905 Bacteria 1703
162 Ga0207705_10007248 3300025909 Bacteria 8162
163 Ga0207707_10054759 3300025912 Bacteria 3472
164 Ga0207660_10004091 3300025917 Bacteria 9500
165 Ga0207662_10000049 3300025918 Bacteria 51921
166 Ga0207657_10028630 3300025919 Bacteria 5078
167 Ga0207650_10034709 3300025925 Bacteria 3659
168 Ga0207659_10031167 3300025926 Bacteria 3647
169 Ga0207687_10004654 3300025927 Bacteria 9127
170 Ga0207644_10018061 3300025931 Bacteria 4768
171 Ga0207644_10149854 3300025931 Bacteria 1804
172 Ga0207706_10202715 3300025933 Bacteria 1740
173 Ga0207686_10011152 3300025934 Bacteria 4913
174 Ga0207670_10001257 3300025936 Bacteria 13387
175 Ga0207670_10107355 3300025936 Bacteria 2004
176 Ga0207704_10013921 3300025938 Bacteria 4046
177 Ga0207689_10005474 3300025942 Bacteria 11362
178 Ga0207689_10129476 3300025942 Bacteria 2077
179 Ga0207667_10013470 3300025949 Bacteria 9358
180 Ga0207667_10016028 3300025949 Bacteria 8484
181 Ga0207712_10009645 3300025961 Bacteria 6117
182 Ga0207703_10019959 3300026035 Bacteria 5237
183 Ga0207639_10171155 3300026041 Bacteria 1839
184 Ga0207648_10000265 3300026089 Bacteria 56755
185 Ga0207648_10014180 3300026089 Bacteria 7370
186 Ga0207675_100000182 3300026118 Bacteria 56879
187 Ga0207698_10001809 3300026142 Bacteria 12492
188 Ga0209282_1000002 3300027666 Bacteria 1067825
189 Ga0207428_10001034 3300027907 Bacteria 30690
190 Ga0268265_10004295 3300028380 Bacteria 9943
191 Ga0268264_10006840 3300028381 Bacteria 9575
192 Ga0268264_10065283 3300028381 Bacteria 3066
193 Ga0307408_100006870 3300031548 Bacteria 7543
194 Ga0307408_100013254 3300031548 Bacteria 5471
195 Ga0307408_100019088 3300031548 Bacteria 4613
196 Ga0307408_100031244 3300031548 Bacteria 3707
197 Ga0307408_100164761 3300031548 Bacteria 1764
198 Ga0307518_10007601 3300031838 Bacteria 7755
199 Ga0307416_100060623 3300032002 Bacteria 3082
200 Ga0373930_0013137 3300034816 Bacteria 1522
201 Ga0373934_0012223 3300035086 Bacteria 3241
202 Ga0373940_0004497 3300035088 Bacteria 2949
203 Ga0373944_0023243 3300035089 Bacteria 1807
204 Ga0373923_0009299 3300035111 Bacteria 3543
205 Ga0373932_0003784 3300035112 Bacteria 3608
206 Ga0373936_0009286 3300035113 Bacteria 3704
207 Ga0373939_0002155 3300035114 Bacteria 4673
208 Ga0373945_0004513 3300035116 Bacteria 4424
209 Ga0373960_0024817 3300035121 Bacteria 1625
210 Ga0373943_0025865 3300035170 Bacteria 2745
211 Ga0373955_0013178 3300035172 Bacteria 3989
212 Ga0373942_0004590 3300035207 Bacteria 3204
213 Ga0373924_0016085 3300035410 Bacteria 2853
214 Ga0373931_0000062 3300035691 Bacteria 54491
215 Ga0373931_0013701 3300035691 Bacteria 3952
216 Ga0373931_0023168 3300035691 Bacteria 3134
217 Ga0373935_0026642 3300035692 Bacteria 3570
218 Ga0373933_0001438 3300035724 Bacteria 13917
219 Ga0373933_0007663 3300035724 Bacteria 5894
220 Ga0373933_0062891 3300035724 Bacteria 2243
221 Ga0373937_0003410 3300036401 Bacteria 13337
222 Ga0373937_0009139 3300036401 Bacteria 8599
223 Ga0373937_0250045 3300036401 Bacteria 1671
224 Ga0395899_0030598 3300037312 Bacteria 4048
225 Ga0395900_0000532 3300037418 Bacteria 53751
226 Ga0395900_0010039 3300037418 Bacteria 9687
227 Ga0395900_0020349 3300037418 Bacteria 6773
228 Ga0395900_0070410 3300037418 Bacteria 3595
229 Ga0395900_0070768 3300037418 Bacteria 3585
230 Ga0395900_0266732 3300037418 Bacteria 1708
231 Ga0395898_0023643 3300037466 Bacteria 6206
232 Ga0395898_0068367 3300037466 Bacteria 3437
233 Ga0395898_0157460 3300037466 Bacteria 2172
234 Ga0395905_0025537 3300037471 Bacteria 5571
235 Ga0395905_0032398 3300037471 Bacteria 4915
236 Ga0395905_0042850 3300037471 Bacteria 4246
237 Ga0395901_0000387 3300038443 Bacteria 52634
238 Ga0395901_0003072 3300038443 Bacteria 16814
239 Ga0395901_0136625 3300038443 Bacteria 2576
240 Ga0395901_0209547 3300038443 Bacteria 2040
241 Ga0451853_1159476 3300041512 Bacteria 1588
242 Ga0439441_008716 3300042001 Bacteria 1664
243 Ga0439448_0003230 3300042005 Bacteria 4500
244 Ga0451577_0018812 3300042876 Bacteria 6356
245 Ga0451577_0097648 3300042876 Bacteria 2624
246 Ga0466972_0008353 3300044658 Bacteria 5189
247 Ga0466965_0000667 3300044683 Bacteria 12598
248 Ga0466965_0081054 3300044683 Bacteria 1640
249 Ga0466966_0024006 3300044684 Bacteria 3990
250 Ga0466966_0025591 3300044684 Bacteria 3854
251 Ga0466966_0027270 3300044684 Bacteria 3725
252 Ga0466966_0055391 3300044684 Bacteria 2509
253 Ga0466961_0045812 3300044693 Bacteria 2798
254 Ga0466963_0084919 3300044694 Bacteria 2148
255 Ga0466964_0000392 3300044706 Bacteria 13313
256 Ga0466964_0009938 3300044706 Bacteria 3583
257 Ga0466968_0000256 3300044735 Bacteria 16878
258 Ga0466970_0022088 3300044765 Bacteria 3321
259 Ga0466957_0000388 3300044842 Bacteria 21542
260 Ga0466957_0024097 3300044842 Bacteria 3601
261 Ga0466959_0012486 3300045049 Bacteria 6139
262 Ga0451576_0001787 3300045051 Bacteria 35253
263 Ga0451576_0008064 3300045051 Bacteria 12423
264 Ga0451576_0012002 3300045051 Bacteria 9784
265 Ga0451576_0278373 3300045051 Bacteria 1749
266 Ga0466958_0028127 3300045836 Bacteria 3331
267 Ga0495627_000247 3300046453 Bacteria 56624
268 Ga0495627_018772 3300046453 Bacteria 2326
269 Ga0495592_0009024 3300046454 Bacteria 7493
270 Ga0495603_0011608 3300046455 Bacteria 5329
271 Ga0495603_0040983 3300046455 Bacteria 2770
272 Ga0495629_0018036 3300046459 Bacteria 5058
273 Ga0495638_0015616 3300046460 Bacteria 5097
274 Ga0495638_0043249 3300046460 Bacteria 2842
275 Ga0495638_0066858 3300046460 Bacteria 2208
276 Ga0495653_0039936 3300046463 Bacteria 3672
277 Ga0495650_0010129 3300046471 Bacteria 5287
278 Ga0495580_0006729 3300046472 Bacteria 9331
279 Ga0495582_0010843 3300046473 Bacteria 5015
280 Ga0495605_0000307 3300046474 Bacteria 52199
281 Ga0495605_0000369 3300046474 Bacteria 42654
282 Ga0495605_0029247 3300046474 Bacteria 2838
283 Ga0495639_0012157 3300046475 Bacteria 3711
284 Ga0495662_0013392 3300046476 Bacteria 3991
285 Ga0495662_0047475 3300046476 Bacteria 2072
286 Ga0495584_0000762 3300046491 Bacteria 21279
287 Ga0495584_0002453 3300046491 Bacteria 10518
288 Ga0495584_0003217 3300046491 Bacteria 9068
289 Ga0495584_0003805 3300046491 Bacteria 8210
290 Ga0495584_0016521 3300046491 Bacteria 3763
291 Ga0495584_0020747 3300046491 Bacteria 3337
292 Ga0495585_0000148 3300046492 Bacteria 76376
293 Ga0495585_0000613 3300046492 Bacteria 33250
294 Ga0495585_0001019 3300046492 Bacteria 23308
295 Ga0495585_0001344 3300046492 Bacteria 19505
296 Ga0495585_0001953 3300046492 Bacteria 15407
297 Ga0495585_0004701 3300046492 Bacteria 8798
298 Ga0495585_0009131 3300046492 Bacteria 5968
299 Ga0495585_0014629 3300046492 Bacteria 4566
300 Ga0495585_0020438 3300046492 Bacteria 3808
301 Ga0495585_0028325 3300046492 Bacteria 3195
302 Ga0495585_0028800 3300046492 Bacteria 3164
303 Ga0495585_0042845 3300046492 Bacteria 2533
304 Ga0495585_0051478 3300046492 Bacteria 2282
305 Ga0495596_0000778 3300046500 Bacteria 19414
306 Ga0495596_0000952 3300046500 Bacteria 17275
307 Ga0495596_0001117 3300046500 Bacteria 15863
308 Ga0495596_0001924 3300046500 Bacteria 11506
309 Ga0495596_0026250 3300046500 Bacteria 2348
310 Ga0495596_0038172 3300046500 Bacteria 1899
311 Ga0495607_0001816 3300046501 Bacteria 18209
312 Ga0495607_0002834 3300046501 Bacteria 13765
313 Ga0495607_0002875 3300046501 Bacteria 13606
314 Ga0495607_0060321 3300046501 Bacteria 2159
315 Ga0495583_0000268 3300046506 Bacteria 85709
316 Ga0495583_0000857 3300046506 Bacteria 36987
317 Ga0495583_0005606 3300046506 Bacteria 8460
318 Ga0495583_0028051 3300046506 Bacteria 2772
319 Ga0495583_0040003 3300046506 Bacteria 2205
320 Ga0495606_0036811 3300046507 Bacteria 3329
321 Ga0495606_0051170 3300046507 Bacteria 2696
322 Ga0495606_0083969 3300046507 Bacteria 1973
323 Ga0495608_0004731 3300046511 Bacteria 9740
324 Ga0495616_0000052 3300046513 Bacteria 105258
325 Ga0495616_0000817 3300046513 Bacteria 22704
326 Ga0495616_0003103 3300046513 Bacteria 10753
327 Ga0495616_0019052 3300046513 Bacteria 3751
328 Ga0495616_0019920 3300046513 Bacteria 3655
329 Ga0495616_0020953 3300046513 Bacteria 3549
330 Ga0495616_0031954 3300046513 Bacteria 2753
331 Ga0495618_0023201 3300046514 Bacteria 3835
332 Ga0495628_0007988 3300046516 Bacteria 9116
333 Ga0495630_0001001 3300046517 Bacteria 19663
334 Ga0495631_0000673 3300046518 Bacteria 22036
335 Ga0495631_0003570 3300046518 Bacteria 8498
336 Ga0495631_0006929 3300046518 Bacteria 5808
337 Ga0495631_0012413 3300046518 Bacteria 4160
338 Ga0495631_0021505 3300046518 Bacteria 3004
339 Ga0495631_0027394 3300046518 Bacteria 2608
340 Ga0495631_0039044 3300046518 Bacteria 2108
341 Ga0495632_0000260 3300046519 Bacteria 52561
342 Ga0495632_0000887 3300046519 Bacteria 26268
343 Ga0495632_0001388 3300046519 Bacteria 20299
344 Ga0495632_0001906 3300046519 Bacteria 16686
345 Ga0495632_0021241 3300046519 Bacteria 3501
346 Ga0495637_0045539 3300046520 Bacteria 1860
347 Ga0495643_0000079 3300046522 Bacteria 162735
348 Ga0495643_0005190 3300046522 Bacteria 8884
349 Ga0495643_0014914 3300046522 Bacteria 4608
350 Ga0495643_0021553 3300046522 Bacteria 3695
351 Ga0495643_0034661 3300046522 Bacteria 2784
352 Ga0495644_0005948 3300046523 Bacteria 4756
353 Ga0495644_0018457 3300046523 Bacteria 2665
354 Ga0495648_0000117 3300046524 Bacteria 97341
355 Ga0495648_0005389 3300046524 Bacteria 10636
356 Ga0495663_0006777 3300046525 Bacteria 3159
357 Ga0495663_0020873 3300046525 Bacteria 1882
358 Ga0495666_0001606 3300046526 Bacteria 11122
359 Ga0495666_0006235 3300046526 Bacteria 6007
360 Ga0495642_0000438 3300046528 Bacteria 21966
361 Ga0495642_0000657 3300046528 Bacteria 17307
362 Ga0495642_0002957 3300046528 Bacteria 6770
363 Ga0495642_0009583 3300046528 Bacteria 3706
364 Ga0495642_0030494 3300046528 Bacteria 2157
365 Ga0495642_0031876 3300046528 Bacteria 2114
366 Ga0495642_0051666 3300046528 Bacteria 1691
367 Ga0495652_0089281 3300046529 Bacteria 2524
368 Ga0495654_0001281 3300046530 Bacteria 17634
369 Ga0495654_0001433 3300046530 Bacteria 16412
370 Ga0495654_0012235 3300046530 Bacteria 4614
371 Ga0495665_0003893 3300046531 Bacteria 8078
372 Ga0495665_0018236 3300046531 Bacteria 3772
373 Ga0495665_0027527 3300046531 Bacteria 3051
374 Ga0495640_0004549 3300046533 Bacteria 11056
375 Ga0495586_0001499 3300046535 Bacteria 12886
376 Ga0495586_0001789 3300046535 Bacteria 11753
377 Ga0495586_0002428 3300046535 Bacteria 10100
378 Ga0495586_0021527 3300046535 Bacteria 3437
379 Ga0495587_0024366 3300046536 Bacteria 3710
380 Ga0495598_0000961 3300046537 Bacteria 5558
381 Ga0495609_0000028 3300046538 Bacteria 219908
382 Ga0495609_0001706 3300046538 Bacteria 14244
383 Ga0495609_0004384 3300046538 Bacteria 7743
384 Ga0495609_0008429 3300046538 Bacteria 5050
385 Ga0495609_0014166 3300046538 Bacteria 3754
386 Ga0495609_0020110 3300046538 Bacteria 3085
387 Ga0495597_0002300 3300046542 Bacteria 12402
388 Ga0495597_0002834 3300046542 Bacteria 10618
389 Ga0495597_0010739 3300046542 Bacteria 4463
390 Ga0495597_0023534 3300046542 Bacteria 2848
391 Ga0495597_0028110 3300046542 Bacteria 2575
392 Ga0495645_0099538 3300046543 Bacteria 2068
393 Ga0495622_0002273 3300046557 Bacteria 9341
394 Ga0495622_0004624 3300046557 Bacteria 6375
395 Ga0495622_0008654 3300046557 Bacteria 4716
396 Ga0495622_0058697 3300046557 Bacteria 1782
397 Ga0495633_0001933 3300046558 Bacteria 15072
398 Ga0495633_0008066 3300046558 Bacteria 5983
399 Ga0495633_0012332 3300046558 Bacteria 4552
400 Ga0495633_0021914 3300046558 Bacteria 3189
401 Ga0495667_0010845 3300046559 Bacteria 6160
402 Ga0495667_0141394 3300046559 Bacteria 1551
403 Ga0495656_0002755 3300046615 Bacteria 5879
404 Ga0495656_0003684 3300046615 Bacteria 5200
405 Ga0495656_0010145 3300046615 Bacteria 3414
406 Ga0495656_0017064 3300046615 Bacteria 2764
407 Ga0495668_0000008 3300046616 Bacteria 498364
408 Ga0495668_0000768 3300046616 Bacteria 37462
409 Ga0495668_0002938 3300046616 Bacteria 13450
410 Ga0495668_0006624 3300046616 Bacteria 7553
411 Ga0495668_0007764 3300046616 Bacteria 6805
412 Ga0495668_0023799 3300046616 Bacteria 3488
413 Ga0495668_0024715 3300046616 Bacteria 3416
414 Ga0495668_0041180 3300046616 Bacteria 2574
415 Ga0495634_0011090 3300046642 Bacteria 6573
416 Ga0495611_0005434 3300046648 Bacteria 5447
417 Ga0495625_0001449 3300046660 Bacteria 28796
418 Ga0495625_0010265 3300046660 Bacteria 7763
419 Ga0495625_0013090 3300046660 Bacteria 6682
420 Ga0495625_0013261 3300046660 Bacteria 6631
421 Ga0495635_0163233 3300046663 Bacteria 1516
422 Ga0495659_0000128 3300046664 Bacteria 33389
423 Ga0495659_0036067 3300046664 Bacteria 1745
424 Ga0495661_0000157 3300046665 Bacteria 80637
425 Ga0495661_0000710 3300046665 Bacteria 32881
426 Ga0495661_0000932 3300046665 Bacteria 26643
427 Ga0495661_0002284 3300046665 Bacteria 14824
428 Ga0495661_0003893 3300046665 Bacteria 10910
429 Ga0495661_0004318 3300046665 Bacteria 10295
430 Ga0495661_0023638 3300046665 Bacteria 3986
431 Ga0495661_0042382 3300046665 Bacteria 2806
432 Ga0495661_0043966 3300046665 Bacteria 2741
433 Ga0495661_0072596 3300046665 Bacteria 2007
434 Ga0495661_0091422 3300046665 Bacteria 1730
435 Ga0495588_0000113 3300046674 Bacteria 137279
436 Ga0495588_0006726 3300046674 Bacteria 5196
437 Ga0495588_0019718 3300046674 Bacteria 3307
438 Ga0495588_0033810 3300046674 Bacteria 2584
439 Ga0495599_0015568 3300046678 Bacteria 4721
440 Ga0495623_0036973 3300046679 Bacteria 3127
441 Ga0495623_0055002 3300046679 Bacteria 2510
442 Ga0495658_0011040 3300046683 Bacteria 4531
443 Ga0495669_0000218 3300046684 Bacteria 34510
444 Ga0495669_0002189 3300046684 Bacteria 8019
445 Ga0495669_0002436 3300046684 Bacteria 7605
446 Ga0495613_0006610 3300046689 Bacteria 8666
447 Ga0495624_0074815 3300046690 Bacteria 2103
448 Ga0495670_0001954 3300046691 Bacteria 10144
449 Ga0495670_0002681 3300046691 Bacteria 8785
450 Ga0495671_0000234 3300046692 Bacteria 47760
451 Ga0495671_0000358 3300046692 Bacteria 37933
452 Ga0495671_0018164 3300046692 Bacteria 3734
453 Ga0495671_0037569 3300046692 Bacteria 2448
454 Ga0495649_0004762 3300046694 Bacteria 8797
455 Ga0495649_0007589 3300046694 Bacteria 6594
456 Ga0495649_0044510 3300046694 Bacteria 2423
457 Ga0495589_0000113 3300046794 Bacteria 76949
458 Ga0495589_0000117 3300046794 Bacteria 75549
459 Ga0495589_0000712 3300046794 Bacteria 21540
460 Ga0495589_0022273 3300046794 Bacteria 3233
461 Ga0495600_0004232 3300046809 Bacteria 8571
462 Ga0495660_0001770 3300046810 Bacteria 14302
463 Ga0495660_0003899 3300046810 Bacteria 9116
464 Ga0495660_0006758 3300046810 Bacteria 6767
465 Ga0495660_0024655 3300046810 Bacteria 3425
466 Ga0495660_0027227 3300046810 Bacteria 3235
467 Ga0495581_0020592 3300047315 Bacteria 3827
468 Ga0495581_0073341 3300047315 Bacteria 1980
469 Ga0495604_0027355 3300047317 Bacteria 4536
470 Ga0495604_0040259 3300047317 Bacteria 3670
471 Ga0495604_0074502 3300047317 Bacteria 2558
472 Ga0495604_0160270 3300047317 Bacteria 1590
473 Ga0495636_0004863 3300047318 Bacteria 5261
474 Ga0495636_0013453 3300047318 Bacteria 3248
475 Ga0495674_0008080 3300047319 Bacteria 10042
476 Ga0495674_0102129 3300047319 Bacteria 2439
477 Ga0495672_0000035 3300047320 Bacteria 290329
478 Ga0495672_0000423 3300047320 Bacteria 50688
479 Ga0495672_0002295 3300047320 Bacteria 17743
480 Ga0495672_0003282 3300047320 Bacteria 13998
481 Ga0495676_0000034 3300047321 Bacteria 124977
482 Ga0495676_0019334 3300047321 Bacteria 5992
483 Ga0495676_0092812 3300047321 Bacteria 2252
484 Ga0495680_0005270 3300047322 Bacteria 12208
485 Ga0495680_0021252 3300047322 Bacteria 5436
486 Ga0495683_0000275 3300047323 Bacteria 45085
487 Ga0495683_0003535 3300047323 Bacteria 9096
488 Ga0495683_0035227 3300047323 Bacteria 2544
489 Ga0495683_0039375 3300047323 Bacteria 2389
490 Ga0495687_000054 3300047443 Bacteria 194607
491 Ga0495687_000060 3300047443 Bacteria 179124
492 Ga0495687_000410 3300047443 Bacteria 53080
493 Ga0495687_001251 3300047443 Bacteria 24150
494 Ga0495687_019355 3300047443 Bacteria 3345
495 Ga0495675_0087793 3300047444 Bacteria 1954
496 Ga0495677_0000012 3300047445 Bacteria 146763
497 Ga0495677_0000316 3300047445 Bacteria 20934
498 Ga0495677_0001363 3300047445 Bacteria 9764
499 Ga0495677_0033768 3300047445 Bacteria 1864
500 Ga0495677_0050226 3300047445 Bacteria 1534
501 Ga0495679_002389 3300047446 Bacteria 9596
502 Ga0495679_004610 3300047446 Bacteria 6289
503 Ga0495685_000383 3300047447 Bacteria 13981
504 Ga0495685_006840 3300047447 Bacteria 3752
505 Ga0495673_0010194 3300047469 Bacteria 5132
506 Ga0495681_0001235 3300047470 Bacteria 19424
507 Ga0495681_0003816 3300047470 Bacteria 10432
508 Ga0495681_0010086 3300047470 Bacteria 5747
509 Ga0495681_0017378 3300047470 Bacteria 3995
510 Ga0495681_0024463 3300047470 Bacteria 3181
511 Ga0495686_0001141 3300047472 Bacteria 31302
512 Ga0495686_0001783 3300047472 Bacteria 21899
513 Ga0495686_0004197 3300047472 Bacteria 11961
514 Ga0495686_0023678 3300047472 Bacteria 4046
515 Ga0495593_0012675 3300047673 Bacteria 4814
516 Ga0495614_0004953 3300048089 Bacteria 6009
517 Ga0495615_0000815 3300048090 Bacteria 4375
518 Ga0495626_0000036 3300048091 Bacteria 180464
519 Ga0495626_0000044 3300048091 Bacteria 165533
520 Ga0495626_0001270 3300048091 Bacteria 20653
521 Ga0495626_0004212 3300048091 Bacteria 8907
522 Ga0495626_0015575 3300048091 Bacteria 3888
523 Ga0495626_0019590 3300048091 Bacteria 3383
524 Ga0495626_0029263 3300048091 Bacteria 2666
525 Ga0495626_0031582 3300048091 Bacteria 2547
526 Ga0495626_0037913 3300048091 Bacteria 2288
527 Ga0495626_0040214 3300048091 Bacteria 2209
528 Ga0495626_0054725 3300048091 Bacteria 1831
529 Ga0496100_0008941 3300048903 Bacteria 5602
530 Ga0496101_0026051 3300048904 Bacteria 4063
531 Ga0496102_0000192 3300048905 Bacteria 83166
532 Ga0496102_0001818 3300048905 Bacteria 18420
533 Ga0496102_0098690 3300048905 Bacteria 2710
534 Ga0496102_0112583 3300048905 Bacteria 2538
535 Ga0496103_0002975 3300048906 Bacteria 10494
536 Ga0496103_0042689 3300048906 Bacteria 2791
537 Ga0496104_0084096 3300048907 Bacteria 3036
538 Ga0496108_0007533 3300048911 Bacteria 8823
539 Ga0496109_0038840 3300048912 Bacteria 4306
540 Ga0496110_0000706 3300048913 Bacteria 23078
541 Ga0496110_0005159 3300048913 Bacteria 10211
542 Ga0496113_0015050 3300048916 Bacteria 5300
543 Ga0496113_0145259 3300048916 Bacteria 1868
544 Ga0496114_0045051 3300048917 Bacteria 3663
545 Ga0496122_0003307 3300048925 Bacteria 21338
546 Ga0496122_0003441 3300048925 Bacteria 20818
547 Ga0496122_0041646 3300048925 Bacteria 3627
548 Ga0496123_0000905 3300048926 Bacteria 46722
549 Ga0496123_0007158 3300048926 Bacteria 10593
550 Ga0496124_0002911 3300048927 Bacteria 21581
551 Ga0496124_0007329 3300048927 Bacteria 11751
552 Ga0496125_0002954 3300048928 Bacteria 21370
553 Ga0495678_002016 3300049459 Bacteria 14566
554 Ga0495682_0020688 3300049460 Bacteria 2469
555 Ga0501032_0058792 3300049569 Bacteria 2581
556 Ga0501034_0008329 3300049571 Bacteria 10970
557 Ga0501034_0047636 3300049571 Bacteria 4328
558 Ga0501040_0033552 3300049576 Bacteria 3478
559 Ga0501046_0042098 3300049580 Bacteria 3642
560 Ga0501068_0001055 3300049584 Bacteria 14604
561 Ga0501069_0049021 3300049585 Bacteria 2347
562 Ga0501070_0003078 3300049586 Bacteria 14519
563 Ga0501071_0116377 3300049587 Bacteria 1979
564 Ga0501072_0116010 3300049588 Bacteria 2132
565 Ga0501073_0003022 3300049589 Bacteria 12609
566 Ga0501074_0019604 3300049590 Bacteria 4909
567 Ga0501238_002466 3300049671 Bacteria 2215
568 Ga0501080_0012613 3300049742 Bacteria 7749
569 Ga0501035_0001554 3300049822 Bacteria 23406
570 Ga0501045_0150952 3300049824 Bacteria 1729
571 nmdc:mga05p37_133_c1 3300050507 Bacteria 68369
572 nmdc:mga05p37_3424_c1 3300050507 Bacteria 18509
573 nmdc:mga09592_1698_c1 3300050508 Bacteria 17757
574 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
575 nmdc:mga0qj67_325035_c1 3300050509 Bacteria 1245
576 nmdc:mga06r32_55548_c1 3300050510 Bacteria 3798
577 nmdc:mga08y16_1548_c1 3300050511 Bacteria 23173
578 nmdc:mga08y16_85765_c1 3300050511 Bacteria 3282
579 nmdc:mga0n895_28767_c1 3300050512 Bacteria 5291
580 nmdc:mga0n895_5586_c1 3300050512 Bacteria 10529
581 nmdc:mga0rr50_13378_c1 3300050513 Bacteria 5341
582 nmdc:mga0rr50_436_c1 3300050513 Bacteria 22427
583 nmdc:mga08x19_1428_c1 3300050514 Bacteria 14774
584 nmdc:mga0a205_1353_c1 3300050515 Bacteria 20648
585 nmdc:mga0a205_28199_c1 3300050515 Bacteria 5367
586 Ga0501082_0112780 3300060353 Bacteria 2354
587 Ga0501082_0167951 3300060353 Bacteria 1907
588 2643789162 2643221554 Bacteria 6603920
589 2643800454 2643221556 Bacteria 7251154
590 2644215102 2643221638 Bacteria 6579467
591 2644249264 2643221645 Bacteria 7207331
592 2644355808 2643221664 Bacteria 7272945
593 2644470363 2643221684 Bacteria 7145183
594 2738740694 2738541280 Bacteria 6630198
595 2738845012 2738541300 Bacteria 6675882
596 2739277427 2738543018 Bacteria 6718814
597 2739346470 2738543030 Bacteria 6719714
598 2846034626 2846033681 Bacteria 4377894
599 2846038782 2846037992 Bacteria 4526407
600 8047678753 8047673197 Bacteria 7395230
601 Ga0495671_0018039
602 JGI25158J39367_1001321
603 JGI25152J39213_1000263
604 JGI25150J39212_1000764
605 JGI25159J45721_1000645
606 JGI25153J46596_10000821
607 rootL2_10018597
608 JGI25161J50226_1002622
609 Ga0055525_1000081
610 Ga0055526_1003162
611 Ga0055526_1003633
612 Ga0055526_1011821
613 Ga0055537_1000128
614 Ga0055537_1004883
615 Ga0055524_1000026
616 Ga0055524_1001343
617 Ga0055524_1002841
618 Ga0055524_1004326
619 Ga0055524_1030565
620 Ga0055534_1000120
621 Ga0055534_1003227
622 Ga0055528_1000069
623 Ga0055528_1009531
624 Ga0055530_10007411
625 Ga0055531_10007725
626 Ga0055531_10012841
627 Ga0055543_1003202
628 Ga0055543_1007174
629 Ga0065165_1000067
630 Ga0065165_1008156
631 Ga0065165_1027766
632 Ga0070658_10105090
633 Ga0070690_100002693
634 Ga0070670_100000420
635 Ga0068869_100000049
636 Ga0068869_100002298
637 Ga0070666_10027648
638 Ga0070680_100003537
639 Ga0070680_100016773
640 Ga0068868_100000341
641 Ga0068868_100000481
642 Ga0070660_100055058
643 Ga0070660_100071518
644 Ga0070689_100003497
645 Ga0070689_100027300
646 Ga0070691_10000934
647 Ga0070687_100000369
648 Ga0070692_10000874
649 Ga0070675_100011753
650 Ga0070671_100000233
651 Ga0070674_100150105
652 Ga0070673_100034846
653 Ga0070659_100072178
654 Ga0070701_10000173
655 Ga0070705_100002026
656 Ga0070694_100000045
657 Ga0070694_100024371
658 Ga0070708_100182284
659 Ga0068867_100004883
660 Ga0070707_100224731
661 Ga0070698_100018197
662 Ga0070684_100002834
663 Ga0070686_100054240
664 Ga0070695_100000126
665 Ga0070695_100043879
666 Ga0070696_100003057
667 Ga0070693_100000731
668 Ga0070704_100000195
669 Ga0070704_100000303
670 Ga0068855_100007080
671 Ga0068855_100021589
672 Ga0070664_100052561
673 Ga0068854_100003263
674 Ga0068856_100015746
675 Ga0070702_100000019
676 Ga0068852_100004168
677 Ga0068859_100111961
678 Ga0068864_100079465
679 Ga0068866_10001065
680 Ga0068861_100002221
681 Ga0068851_10019420
682 Ga0068863_100012296
683 Ga0068858_100000751
684 Ga0068860_100005413
685 Ga0068860_100118453
686 Ga0068862_100005525
687 Ga0081539_10000226
688 Ga0070715_10066419
689 Ga0097621_100002059
690 Ga0097621_100026445
691 Ga0068871_100003308
692 Ga0075428_100002204
693 Ga0075430_100028919
694 Ga0075431_100039747
695 Ga0075433_10001856
696 Ga0075433_10108451
697 Ga0075434_100001295
698 Ga0075434_100081623
699 Ga0075429_100000015
700 Ga0075429_100000143
701 Ga0068865_100001242
702 Ga0075436_100000475
703 Ga0075436_100073466
704 Ga0097620_100111962
705 Ga0099826_10000003
706 Ga0075435_100000811
707 Ga0075435_100001385
708 Ga0075435_100018574
709 Ga0111539_10020073
710 Ga0111539_10064434
711 Ga0105245_10005835
712 Ga0114129_10001740
713 Ga0114129_10049912
714 Ga0105243_10004530
715 Ga0105243_10076465
716 Ga0105243_10082673
717 Ga0105241_10014386
718 Ga0105242_10020708
719 Ga0105242_10141356
720 Ga0105238_10175054
721 Ga0157374_10079072
722 Ga0157378_10000579
723 Ga0163162_10380998
724 Ga0157375_10001103
725 Ga0157380_10266469
726 Ga0157376_10007532
727 Ga0209436_100496
728 Ga0209436_101174
729 Ga0209563_100015
730 Ga0207425_1000006
731 Ga0207425_1000531
732 Ga0209148_1000413
733 Ga0209129_1000009
734 Ga0209565_1000006
735 Ga0209565_1000163
736 Ga0209565_1000562
737 Ga0209565_1000674
738 Ga0209565_1003189
739 Ga0209565_1010193
740 Ga0209565_1010863
741 Ga0209673_1000004
742 Ga0209130_1000223
743 Ga0209130_1001753
744 Ga0209675_1000224
745 Ga0209675_1000292
746 Ga0209675_1003337
747 Ga0209564_1000098
748 Ga0209564_1000102
749 Ga0209564_1001497
750 Ga0209564_1001667
751 Ga0209564_1017469
752 Ga0209758_1000071
753 Ga0209050_1000183
754 Ga0209050_1000731
755 Ga0209256_1000372
756 Ga0209256_1000495
757 Ga0209256_1001594
758 Ga0209256_1002381
759 Ga0209257_1000010
760 Ga0207642_10001096
761 Ga0207685_10042791
762 Ga0207705_10007248
763 Ga0207707_10054759
764 Ga0207660_10004091
765 Ga0207662_10000049
766 Ga0207657_10028630
767 Ga0207650_10034709
768 Ga0207659_10031167
769 Ga0207687_10004654
770 Ga0207644_10018061
771 Ga0207644_10149854
772 Ga0207706_10202715
773 Ga0207686_10011152
774 Ga0207670_10001257
775 Ga0207670_10107355
776 Ga0207704_10013921
777 Ga0207689_10005474
778 Ga0207689_10129476
779 Ga0207667_10013470
780 Ga0207667_10016028
781 Ga0207712_10009645
782 Ga0207703_10019959
783 Ga0207639_10171155
784 Ga0207648_10000265
785 Ga0207648_10014180
786 Ga0207675_100000182
787 Ga0207698_10001809
788 Ga0209282_1000002
789 Ga0207428_10001034
790 Ga0268265_10004295
791 Ga0268264_10006840
792 Ga0268264_10065283
793 Ga0307408_100006870
794 Ga0307408_100013254
795 Ga0307408_100019088
796 Ga0307408_100031244
797 Ga0307408_100164761
798 Ga0307518_10007601
799 Ga0307416_100060623
800 Ga0373930_0013137
801 Ga0373934_0012223
802 Ga0373940_0004497
803 Ga0373944_0023243
804 Ga0373923_0009299
805 Ga0373932_0003784
806 Ga0373936_0009286
807 Ga0373939_0002155
808 Ga0373945_0004513
809 Ga0373960_0024817
810 Ga0373943_0025865
811 Ga0373955_0013178
812 Ga0373942_0004590
813 Ga0373924_0016085
814 Ga0373931_0000062
815 Ga0373931_0013701
816 Ga0373931_0023168
817 Ga0373935_0026642
818 Ga0373933_0001438
819 Ga0373933_0007663
820 Ga0373933_0062891
821 Ga0373937_0003410
822 Ga0373937_0009139
823 Ga0373937_0250045
824 Ga0395899_0030598
825 Ga0395900_0000532
826 Ga0395900_0010039
827 Ga0395900_0020349
828 Ga0395900_0070410
829 Ga0395900_0070768
830 Ga0395900_0266732
831 Ga0395898_0023643
832 Ga0395898_0068367
833 Ga0395898_0157460
834 Ga0395905_0025537
835 Ga0395905_0032398
836 Ga0395905_0042850
837 Ga0395901_0000387
838 Ga0395901_0003072
839 Ga0395901_0136625
840 Ga0395901_0209547
841 Ga0451853_1159476
842 Ga0439441_008716
843 Ga0439448_0003230
844 Ga0451577_0018812
845 Ga0451577_0097648
846 Ga0466972_0008353
847 Ga0466965_0000667
848 Ga0466965_0081054
849 Ga0466966_0024006
850 Ga0466966_0025591
851 Ga0466966_0027270
852 Ga0466966_0055391
853 Ga0466961_0045812
854 Ga0466963_0084919
855 Ga0466964_0000392
856 Ga0466964_0009938
857 Ga0466968_0000256
858 Ga0466970_0022088
859 Ga0466957_0000388
860 Ga0466957_0024097
861 Ga0466959_0012486
862 Ga0451576_0001787
863 Ga0451576_0008064
864 Ga0451576_0012002
865 Ga0451576_0278373
866 Ga0466958_0028127
867 Ga0495627_000247
868 Ga0495627_018772
869 Ga0495592_0009024
870 Ga0495603_0011608
871 Ga0495603_0040983
872 Ga0495629_0018036
873 Ga0495638_0015616
874 Ga0495638_0043249
875 Ga0495638_0066858
876 Ga0495653_0039936
877 Ga0495650_0010129
878 Ga0495580_0006729
879 Ga0495582_0010843
880 Ga0495605_0000307
881 Ga0495605_0000369
882 Ga0495605_0029247
883 Ga0495639_0012157
884 Ga0495662_0013392
885 Ga0495662_0047475
886 Ga0495584_0000762
887 Ga0495584_0002453
888 Ga0495584_0003217
889 Ga0495584_0003805
890 Ga0495584_0016521
891 Ga0495584_0020747
892 Ga0495585_0000148
893 Ga0495585_0000613
894 Ga0495585_0001019
895 Ga0495585_0001344
896 Ga0495585_0001953
897 Ga0495585_0004701
898 Ga0495585_0009131
899 Ga0495585_0014629
900 Ga0495585_0020438
901 Ga0495585_0028325
902 Ga0495585_0028800
903 Ga0495585_0042845
904 Ga0495585_0051478
905 Ga0495596_0000778
906 Ga0495596_0000952
907 Ga0495596_0001117
908 Ga0495596_0001924
909 Ga0495596_0026250
910 Ga0495596_0038172
911 Ga0495607_0001816
912 Ga0495607_0002834
913 Ga0495607_0002875
914 Ga0495607_0060321
915 Ga0495583_0000268
916 Ga0495583_0000857
917 Ga0495583_0005606
918 Ga0495583_0028051
919 Ga0495583_0040003
920 Ga0495606_0036811
921 Ga0495606_0051170
922 Ga0495606_0083969
923 Ga0495608_0004731
924 Ga0495616_0000052
925 Ga0495616_0000817
926 Ga0495616_0003103
927 Ga0495616_0019052
928 Ga0495616_0019920
929 Ga0495616_0020953
930 Ga0495616_0031954
931 Ga0495618_0023201
932 Ga0495628_0007988
933 Ga0495630_0001001
934 Ga0495631_0000673
935 Ga0495631_0003570
936 Ga0495631_0006929
937 Ga0495631_0012413
938 Ga0495631_0021505
939 Ga0495631_0027394
940 Ga0495631_0039044
941 Ga0495632_0000260
942 Ga0495632_0000887
943 Ga0495632_0001388
944 Ga0495632_0001906
945 Ga0495632_0021241
946 Ga0495637_0045539
947 Ga0495643_0000079
948 Ga0495643_0005190
949 Ga0495643_0014914
950 Ga0495643_0021553
951 Ga0495643_0034661
952 Ga0495644_0005948
953 Ga0495644_0018457
954 Ga0495648_0000117
955 Ga0495648_0005389
956 Ga0495663_0006777
957 Ga0495663_0020873
958 Ga0495666_0001606
959 Ga0495666_0006235
960 Ga0495642_0000438
961 Ga0495642_0000657
962 Ga0495642_0002957
963 Ga0495642_0009583
964 Ga0495642_0030494
965 Ga0495642_0031876
966 Ga0495642_0051666
967 Ga0495652_0089281
968 Ga0495654_0001281
969 Ga0495654_0001433
970 Ga0495654_0012235
971 Ga0495665_0003893
972 Ga0495665_0018236
973 Ga0495665_0027527
974 Ga0495640_0004549
975 Ga0495586_0001499
976 Ga0495586_0001789
977 Ga0495586_0002428
978 Ga0495586_0021527
979 Ga0495587_0024366
980 Ga0495598_0000961
981 Ga0495609_0000028
982 Ga0495609_0001706
983 Ga0495609_0004384
984 Ga0495609_0008429
985 Ga0495609_0014166
986 Ga0495609_0020110
987 Ga0495597_0002300
988 Ga0495597_0002834
989 Ga0495597_0010739
990 Ga0495597_0023534
991 Ga0495597_0028110
992 Ga0495645_0099538
993 Ga0495622_0002273
994 Ga0495622_0004624
995 Ga0495622_0008654
996 Ga0495622_0058697
997 Ga0495633_0001933
998 Ga0495633_0008066
999 Ga0495633_0012332
1000 Ga0495633_0021914
1001 Ga0495667_0010845
1002 Ga0495667_0141394
1003 Ga0495656_0002755
1004 Ga0495656_0003684
1005 Ga0495656_0010145
1006 Ga0495656_0017064
1007 Ga0495668_0000008
1008 Ga0495668_0000768
1009 Ga0495668_0002938
1010 Ga0495668_0006624
1011 Ga0495668_0007764
1012 Ga0495668_0023799
1013 Ga0495668_0024715
1014 Ga0495668_0041180
1015 Ga0495634_0011090
1016 Ga0495611_0005434
1017 Ga0495625_0001449
1018 Ga0495625_0010265
1019 Ga0495625_0013090
1020 Ga0495625_0013261
1021 Ga0495635_0163233
1022 Ga0495659_0000128
1023 Ga0495659_0036067
1024 Ga0495661_0000157
1025 Ga0495661_0000710
1026 Ga0495661_0000932
1027 Ga0495661_0002284
1028 Ga0495661_0003893
1029 Ga0495661_0004318
1030 Ga0495661_0023638
1031 Ga0495661_0042382
1032 Ga0495661_0043966
1033 Ga0495661_0072596
1034 Ga0495661_0091422
1035 Ga0495588_0000113
1036 Ga0495588_0006726
1037 Ga0495588_0019718
1038 Ga0495588_0033810
1039 Ga0495599_0015568
1040 Ga0495623_0036973
1041 Ga0495623_0055002
1042 Ga0495658_0011040
1043 Ga0495669_0000218
1044 Ga0495669_0002189
1045 Ga0495669_0002436
1046 Ga0495613_0006610
1047 Ga0495624_0074815
1048 Ga0495670_0001954
1049 Ga0495670_0002681
1050 Ga0495671_0000234
1051 Ga0495671_0000358
1052 Ga0495671_0018164
1053 Ga0495671_0037569
1054 Ga0495649_0004762
1055 Ga0495649_0007589
1056 Ga0495649_0044510
1057 Ga0495589_0000113
1058 Ga0495589_0000117
1059 Ga0495589_0000712
1060 Ga0495589_0022273
1061 Ga0495600_0004232
1062 Ga0495660_0001770
1063 Ga0495660_0003899
1064 Ga0495660_0006758
1065 Ga0495660_0024655
1066 Ga0495660_0027227
1067 Ga0495581_0020592
1068 Ga0495581_0073341
1069 Ga0495604_0027355
1070 Ga0495604_0040259
1071 Ga0495604_0074502
1072 Ga0495604_0160270
1073 Ga0495636_0004863
1074 Ga0495636_0013453
1075 Ga0495674_0008080
1076 Ga0495674_0102129
1077 Ga0495672_0000035
1078 Ga0495672_0000423
1079 Ga0495672_0002295
1080 Ga0495672_0003282
1081 Ga0495676_0000034
1082 Ga0495676_0019334
1083 Ga0495676_0092812
1084 Ga0495680_0005270
1085 Ga0495680_0021252
1086 Ga0495683_0000275
1087 Ga0495683_0003535
1088 Ga0495683_0035227
1089 Ga0495683_0039375
1090 Ga0495687_000054
1091 Ga0495687_000060
1092 Ga0495687_000410
1093 Ga0495687_001251
1094 Ga0495687_019355
1095 Ga0495675_0087793
1096 Ga0495677_0000012
1097 Ga0495677_0000316
1098 Ga0495677_0001363
1099 Ga0495677_0033768
1100 Ga0495677_0050226
1101 Ga0495679_002389
1102 Ga0495679_004610
1103 Ga0495685_000383
1104 Ga0495685_006840
1105 Ga0495673_0010194
1106 Ga0495681_0001235
1107 Ga0495681_0003816
1108 Ga0495681_0010086
1109 Ga0495681_0017378
1110 Ga0495681_0024463
1111 Ga0495686_0001141
1112 Ga0495686_0001783
1113 Ga0495686_0004197
1114 Ga0495686_0023678
1115 Ga0495593_0012675
1116 Ga0495614_0004953
1117 Ga0495615_0000815
1118 Ga0495626_0000036
1119 Ga0495626_0000044
1120 Ga0495626_0001270
1121 Ga0495626_0004212
1122 Ga0495626_0015575
1123 Ga0495626_0019590
1124 Ga0495626_0029263
1125 Ga0495626_0031582
1126 Ga0495626_0037913
1127 Ga0495626_0040214
1128 Ga0495626_0054725
1129 Ga0496100_0008941
1130 Ga0496101_0026051
1131 Ga0496102_0000192
1132 Ga0496102_0001818
1133 Ga0496102_0098690
1134 Ga0496102_0112583
1135 Ga0496103_0002975
1136 Ga0496103_0042689
1137 Ga0496104_0084096
1138 Ga0496108_0007533
1139 Ga0496109_0038840
1140 Ga0496110_0000706
1141 Ga0496110_0005159
1142 Ga0496113_0015050
1143 Ga0496113_0145259
1144 Ga0496114_0045051
1145 Ga0496122_0003307
1146 Ga0496122_0003441
1147 Ga0496122_0041646
1148 Ga0496123_0000905
1149 Ga0496123_0007158
1150 Ga0496124_0002911
1151 Ga0496124_0007329
1152 Ga0496125_0002954
1153 Ga0495678_002016
1154 Ga0495682_0020688
1155 Ga0501032_0058792
1156 Ga0501034_0008329
1157 Ga0501034_0047636
1158 Ga0501040_0033552
1159 Ga0501046_0042098
1160 Ga0501068_0001055
1161 Ga0501069_0049021
1162 Ga0501070_0003078
1163 Ga0501071_0116377
1164 Ga0501072_0116010
1165 Ga0501073_0003022
1166 Ga0501074_0019604
1167 Ga0501238_002466
1168 Ga0501080_0012613
1169 Ga0501035_0001554
1170 Ga0501045_0150952
1171 nmdc:mga05p37_133_c1
1172 nmdc:mga05p37_3424_c1
1173 nmdc:mga09592_1698_c1
1174 nmdc:mga09592_26_c1
1175 nmdc:mga0qj67_325035_c1
1176 nmdc:mga06r32_55548_c1
1177 nmdc:mga08y16_1548_c1
1178 nmdc:mga08y16_85765_c1
1179 nmdc:mga0n895_28767_c1
1180 nmdc:mga0n895_5586_c1
1181 nmdc:mga0rr50_13378_c1
1182 nmdc:mga0rr50_436_c1
1183 nmdc:mga08x19_1428_c1
1184 nmdc:mga0a205_1353_c1
1185 nmdc:mga0a205_28199_c1
1186 Ga0501082_0112780
1187 Ga0501082_0167951
1188 2643789162
1189 2643800454
1190 2644215102
1191 2644249264
1192 2644355808
1193 2644470363
1194 2738740694
1195 2738845012
1196 2739277427
1197 2739346470
1198 2846034626
1199 2846038782
1200 8047678753

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05195

AMP_N

Aminopeptidase P, N-terminal domain

4

125

0.96

PF00557

Peptidase_M24

Metallopeptidase family M24

179

435

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wze-assembly1.cif.gz_C the structure of pseudomonas aeruginosa aminopeptidase pepp 0.9357 1 437
1jaw-assembly1.cif.gz_A aminopeptidase p from e. coli low ph form 0.9352 2 437
2bwu-assembly1.cif.gz_A asp271ala escherichia coli aminopeptidase p 0.93 2 437
2bwt-assembly1.cif.gz_A asp260ala escherichia coli aminopeptidase p 0.9296 2 437
2bww-assembly1.cif.gz_A his350ala escherichia coli aminopeptidase p 0.9294 2 437
ID Description Score Start End Superfamily
af_Q4CSP6_205_383_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9661 171 344 3.90.230.10
4pv4A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9628 169 437 3.90.230.10
3ig4F02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9574 171 436 3.90.230.10
af_Q9NQH7_247_507_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9485 171 437 3.90.230.10
4pv4A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9485 169 437 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A3C1SPG2-F1-model_v4 Xaa-Pro aminopeptidase (EC 3.4.11.9) 0.9855 203 381 GO:0004177
GO:0005829
GO:0006508
GO:0046872
AF-A0A521PJ32-F1-model_v4 Xaa-Pro aminopeptidase (EC 3.4.11.9) 0.9853 217 437 GO:0004177
GO:0005829
GO:0006508
GO:0046872
AF-A0A7Y7AV82-F1-model_v4 deleted 0.981 250 437
AF-A0A3M2BWW8-F1-model_v4 Xaa-Pro aminopeptidase (EC 3.4.11.9) 0.9776 214 435 GO:0004177
GO:0005829
GO:0006508
GO:0008235
AF-A0A800EEM3-F1-model_v4 deleted 0.9773 266 434

Map