F468014

General Info

Members Datasets Scaffolds Average Seq Length
600 241 1200 471

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0044440|Ga0495672_0044440_1063_2469
Length 468
Sequence MDSNFNPDKQHTLQSSINISGTGLHTGVKVDMTLKPANAGFGYQFQRIDLAGRPLIKADCDLVTDTSRGTTLEENGVKVSTVEHILAALVGMGVDNCLIEINGPEIPIIDGSSEPFVEIIEEAGVIEQDAAKAWYTIDTNISYYDEKKRVEMVAMPAMEYKVTTLIDFNSPVLGTQHAGLKRMMDFKTEIAPCRTFCFLHELEMLLDNDLIKGGDINNAIVVVDRPVTKEEMTRLAKVFGREKMEIKSEGYLNNLELRFPNEPARHKLLDVIGDLALTGYSVKGHIIANRPGHSTNVAFAKKIKQYIKKNKHLKNIPVYDPSQQPIFNIQQIEKTLPHRYPFLLIDKIIELTDKYIVGVKNVTFNEPFFVGHFPGNPIMPGVLQIEAMAQTGGILCINAMPAGDYDTYFLKIDNCKFKQMVKPGDTMLMKLELLTPIRRGICEMRGTVYVGNKIVTEADLMAQLVKRS

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
229 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
230 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 2738541278 Niastella sp. CF465 Isolate Unclassified
238 2818991444 Filimonas endophytica 3197 Isolate Unclassified
239 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
240 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
241 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0
Rhizoplane 0.67
Rhizosphere 87.67
Stem 0
Stem Tuber 0
Unclassified 2.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0044440 3300047320 Bacteria 2665
2 JGI24740J21852_10012939 3300001979 Bacteria 3132
3 JGI24740J21852_10015804 3300001979 Bacteria 2744
4 JGI24739J22299_10000573 3300001989 Bacteria 13281
5 JGI25154J39366_1000021 3300002738 Bacteria 221559
6 JGI25157J39369_1004453 3300002741 Bacteria 2535
7 JGI25153J46596_10000222 3300003215 Bacteria 49028
8 rootH1_10116196 3300003316 Bacteria 2445
9 rootH2_10001918 3300003320 Bacteria 9017
10 rootH2_10049592 3300003320 Bacteria 3811
11 rootH2_10053498 3300003320 Bacteria 5848
12 rootL2_10076268 3300003322 Bacteria 3374
13 rootL2_10076278 3300003322 Bacteria 1507
14 rootL2_10121572 3300003322 Bacteria 4663
15 rootH1_10017025 3300003323 Bacteria 16245
16 rootH1_10064497 3300003323 Bacteria 5424
17 rootH1_10225010 3300003323 Bacteria 7388
18 rootH1_10317284 3300003323 Bacteria 2356
19 JGI25160J50197_1002216 3300003354 Bacteria 9123
20 JGI25160J50197_1003616 3300003354 Bacteria 6867
21 JGI25160J50197_1005724 3300003354 Bacteria 5132
22 Ga0055526_1023073 3300003771 Bacteria 2088
23 Ga0055530_10001651 3300003791 Bacteria 15904
24 Ga0055531_10032144 3300003794 Bacteria 1720
25 Ga0065165_1000579 3300005262 Bacteria 54043
26 Ga0065712_10001191 3300005290 Bacteria 6519
27 Ga0065712_10011864 3300005290 Bacteria 2141
28 Ga0065715_10004363 3300005293 Bacteria 4116
29 Ga0070658_10003542 3300005327 Bacteria 12813
30 Ga0070676_10002024 3300005328 Bacteria 10294
31 Ga0070676_10002966 3300005328 Bacteria 8767
32 Ga0070676_10046563 3300005328 Bacteria 2530
33 Ga0070683_100000292 3300005329 Bacteria 34475
34 Ga0070683_100001205 3300005329 Bacteria 19694
35 Ga0070683_100015503 3300005329 Bacteria 6697
36 Ga0070683_100064799 3300005329 Bacteria 3402
37 Ga0070690_100102296 3300005330 Unclassified 1901
38 Ga0070670_100052551 3300005331 Bacteria 3499
39 Ga0070670_100061388 3300005331 Bacteria 3227
40 Ga0070670_100089593 3300005331 Bacteria 2644
41 Ga0070670_100098525 3300005331 Bacteria 2515
42 Ga0068869_100008280 3300005334 Bacteria 6698
43 Ga0068869_100013836 3300005334 Bacteria 5377
44 Ga0068869_100015938 3300005334 Bacteria 5057
45 Ga0068869_100037187 3300005334 Bacteria 3460
46 Ga0070666_10000019 3300005335 Bacteria 185877
47 Ga0070666_10008494 3300005335 Bacteria 6379
48 Ga0070666_10010165 3300005335 Bacteria 5878
49 Ga0070666_10013027 3300005335 Bacteria 5265
50 Ga0070680_100023459 3300005336 Bacteria 4920
51 Ga0068868_100002206 3300005338 Bacteria 13455
52 Ga0068868_100004920 3300005338 Bacteria 9381
53 Ga0068868_100007563 3300005338 Bacteria 7740
54 Ga0068868_100007993 3300005338 Bacteria 7559
55 Ga0068868_100061477 3300005338 Bacteria 2976
56 Ga0070689_100006975 3300005340 Bacteria 7868
57 Ga0070689_100019780 3300005340 Bacteria 4982
58 Ga0070661_100000350 3300005344 Bacteria 36459
59 Ga0070661_100003767 3300005344 Bacteria 10453
60 Ga0070668_100002414 3300005347 Bacteria 13757
61 Ga0070668_100028325 3300005347 Bacteria 4253
62 Ga0070669_100059939 3300005353 Bacteria 2794
63 Ga0070675_100019801 3300005354 Bacteria 5367
64 Ga0070675_100129861 3300005354 Bacteria 2146
65 Ga0070671_100001143 3300005355 Bacteria 19757
66 Ga0070671_100175367 3300005355 Unclassified 1814
67 Ga0070674_100101141 3300005356 Unclassified 2100
68 Ga0070674_100182389 3300005356 Unclassified 1609
69 Ga0070673_100014307 3300005364 Bacteria 5519
70 Ga0070673_100019702 3300005364 Bacteria 4848
71 Ga0070673_100035061 3300005364 Bacteria 3803
72 Ga0070688_100006810 3300005365 Bacteria 6133
73 Ga0070688_100044021 3300005365 Bacteria 2753
74 Ga0070688_100082919 3300005365 Bacteria 2079
75 Ga0070659_100005305 3300005366 Bacteria 9246
76 Ga0070667_100000031 3300005367 Bacteria 177447
77 Ga0070667_100010344 3300005367 Bacteria 7704
78 Ga0070667_100037238 3300005367 Bacteria 4078
79 Ga0070667_100052349 3300005367 Bacteria 3445
80 Ga0070667_100071933 3300005367 Bacteria 2946
81 Ga0070663_100058925 3300005455 Bacteria 2759
82 Ga0070662_100001190 3300005457 Bacteria 15972
83 Ga0070662_100001909 3300005457 Bacteria 12799
84 Ga0070662_100089821 3300005457 Bacteria 2305
85 Ga0068867_100009415 3300005459 Bacteria 6891
86 Ga0068867_100009690 3300005459 Bacteria 6790
87 Ga0068867_100012634 3300005459 Bacteria 5972
88 Ga0068867_100053480 3300005459 Bacteria 2983
89 Ga0070685_10013706 3300005466 Bacteria 4282
90 Ga0070698_100005311 3300005471 Bacteria 14097
91 Ga0070698_100011645 3300005471 Bacteria 9330
92 Ga0070698_100031376 3300005471 Bacteria 5510
93 Ga0070679_100237158 3300005530 Bacteria 1782
94 Ga0070684_100000508 3300005535 Bacteria 26690
95 Ga0070684_100025502 3300005535 Bacteria 4971
96 Ga0070684_100031486 3300005535 Bacteria 4516
97 Ga0068853_100001666 3300005539 Bacteria 16252
98 Ga0068853_100011866 3300005539 Bacteria 7086
99 Ga0068853_100019053 3300005539 Bacteria 5686
100 Ga0068853_100019166 3300005539 Bacteria 5671
101 Ga0068853_100036255 3300005539 Bacteria 4193
102 Ga0068853_100049879 3300005539 Bacteria 3599
103 Ga0070672_100005602 3300005543 Bacteria 8350
104 Ga0070672_100120217 3300005543 Bacteria 2149
105 Ga0070693_100009128 3300005547 Bacteria 4923
106 Ga0070665_100000018 3300005548 Bacteria 434118
107 Ga0070665_100002650 3300005548 Bacteria 19467
108 Ga0070665_100021714 3300005548 Bacteria 6455
109 Ga0070665_100123688 3300005548 Unclassified 2589
110 Ga0068855_100001866 3300005563 Bacteria 26188
111 Ga0068855_100003963 3300005563 Bacteria 18072
112 Ga0068855_100032219 3300005563 Bacteria 6258
113 Ga0068855_100315211 3300005563 Bacteria 1730
114 Ga0070664_100000445 3300005564 Bacteria 31196
115 Ga0070664_100064059 3300005564 Bacteria 3135
116 Ga0068857_100010937 3300005577 Bacteria 7899
117 Ga0068857_100037620 3300005577 Bacteria 4288
118 Ga0068857_100038637 3300005577 Bacteria 4227
119 Ga0068857_100043089 3300005577 Bacteria 4004
120 Ga0068854_100014549 3300005578 Bacteria 5191
121 Ga0068856_100014734 3300005614 Bacteria 7546
122 Ga0068852_100000274 3300005616 Bacteria 34259
123 Ga0068852_100040671 3300005616 Bacteria 3924
124 Ga0068852_100048586 3300005616 Bacteria 3626
125 Ga0068852_100058866 3300005616 Bacteria 3330
126 Ga0068852_100126443 3300005616 Bacteria 2348
127 Ga0068859_100000013 3300005617 Bacteria 291126
128 Ga0068859_100000451 3300005617 Bacteria 40880
129 Ga0068859_100030431 3300005617 Bacteria 5417
130 Ga0068859_100135628 3300005617 Bacteria 2534
131 Ga0068859_100208896 3300005617 Bacteria 2038
132 Ga0068864_100006018 3300005618 Bacteria 9961
133 Ga0068864_100009714 3300005618 Bacteria 7938
134 Ga0068864_100031437 3300005618 Bacteria 4504
135 Ga0068864_100072565 3300005618 Bacteria 3000
136 Ga0068866_10054303 3300005718 Bacteria 2052
137 Ga0068861_100005961 3300005719 Bacteria 8278
138 Ga0068861_100049205 3300005719 Bacteria 3190
139 Ga0068861_100166549 3300005719 Bacteria 1823
140 Ga0068851_10001096 3300005834 Bacteria 11756
141 Ga0068851_10009552 3300005834 Bacteria 4514
142 Ga0068851_10033809 3300005834 Bacteria 2549
143 Ga0068851_10047500 3300005834 Bacteria 2174
144 Ga0068870_10033666 3300005840 Bacteria 2616
145 Ga0068870_10037944 3300005840 Unclassified 2486
146 Ga0068863_100005507 3300005841 Bacteria 12454
147 Ga0068863_100018879 3300005841 Bacteria 6598
148 Ga0068863_100023592 3300005841 Bacteria 5872
149 Ga0068863_100025539 3300005841 Bacteria 5632
150 Ga0068863_100087680 3300005841 Bacteria 2949
151 Ga0068858_100004954 3300005842 Bacteria 13046
152 Ga0068858_100021942 3300005842 Bacteria 5963
153 Ga0068858_100049792 3300005842 Bacteria 3879
154 Ga0068858_100086984 3300005842 Bacteria 2907
155 Ga0068860_100000040 3300005843 Bacteria 231652
156 Ga0068860_100000948 3300005843 Bacteria 32094
157 Ga0068860_100005457 3300005843 Bacteria 12891
158 Ga0068860_100016192 3300005843 Bacteria 7272
159 Ga0068860_100029845 3300005843 Bacteria 5246
160 Ga0068860_100051471 3300005843 Bacteria 3919
161 Ga0068860_100139082 3300005843 Unclassified 2333
162 Ga0068860_100240183 3300005843 Bacteria 1762
163 Ga0068860_100299886 3300005843 Bacteria 1574
164 Ga0068862_100158146 3300005844 Bacteria 2021
165 Ga0070715_10008824 3300006163 Bacteria 3529
166 Ga0075366_10002314 3300006195 Bacteria 9745
167 Ga0075366_10015119 3300006195 Bacteria 4417
168 Ga0097621_100001789 3300006237 Bacteria 14756
169 Ga0097621_100003766 3300006237 Bacteria 10512
170 Ga0097621_100006952 3300006237 Bacteria 8056
171 Ga0097621_100008416 3300006237 Bacteria 7428
172 Ga0097621_100009337 3300006237 Bacteria 7121
173 Ga0097621_100184397 3300006237 Bacteria 1804
174 Ga0097621_100216916 3300006237 Unclassified 1666
175 Ga0068871_100000075 3300006358 Bacteria 55346
176 Ga0068871_100001976 3300006358 Bacteria 13888
177 Ga0068871_100004482 3300006358 Bacteria 9721
178 Ga0068871_100007909 3300006358 Bacteria 7623
179 Ga0068871_100016350 3300006358 Bacteria 5586
180 Ga0068871_100197741 3300006358 Bacteria 1734
181 Ga0068871_100209620 3300006358 Bacteria 1685
182 Ga0075428_100005318 3300006844 Bacteria 14309
183 Ga0075428_100052566 3300006844 Bacteria 4464
184 Ga0075430_100010757 3300006846 Bacteria 7754
185 Ga0075430_100025027 3300006846 Bacteria 5078
186 Ga0075429_100000991 3300006880 Bacteria 22562
187 Ga0068865_100004346 3300006881 Bacteria 8550
188 Ga0097620_100000013 3300006931 Bacteria 291126
189 Ga0097620_100000451 3300006931 Bacteria 40880
190 Ga0097620_100030429 3300006931 Bacteria 5417
191 Ga0097620_100135626 3300006931 Bacteria 2534
192 Ga0097620_100208892 3300006931 Bacteria 2038
193 Ga0105240_10000138 3300009093 Bacteria 149330
194 Ga0105240_10000785 3300009093 Bacteria 57570
195 Ga0105240_10003502 3300009093 Bacteria 24345
196 Ga0105240_10005325 3300009093 Bacteria 19195
197 Ga0105240_10009847 3300009093 Bacteria 13490
198 Ga0105240_10025643 3300009093 Bacteria 7743
199 Ga0105240_10025938 3300009093 Bacteria 7697
200 Ga0105240_10027963 3300009093 Bacteria 7376
201 Ga0105240_10038013 3300009093 Bacteria 6179
202 Ga0105240_10039588 3300009093 Bacteria 6035
203 Ga0105240_10051730 3300009093 Bacteria 5167
204 Ga0105240_10203335 3300009093 Bacteria 2320
205 Ga0111539_10080351 3300009094 Bacteria 3835
206 Ga0105247_10010798 3300009101 Bacteria 5515
207 Ga0114129_10055684 3300009147 Bacteria 5542
208 Ga0114129_10101951 3300009147 Bacteria 3970
209 Ga0114129_10136259 3300009147 Bacteria 3368
210 Ga0105241_10000297 3300009174 Bacteria 37174
211 Ga0105241_10016359 3300009174 Bacteria 5440
212 Ga0105241_10031694 3300009174 Bacteria 3958
213 Ga0105241_10042983 3300009174 Bacteria 3421
214 Ga0105242_10005909 3300009176 Bacteria 9438
215 Ga0105242_10022521 3300009176 Bacteria 4957
216 Ga0105242_10035688 3300009176 Bacteria 3987
217 Ga0105242_10109560 3300009176 Bacteria 2351
218 Ga0105242_10184785 3300009176 Bacteria 1841
219 Ga0105248_10046424 3300009177 Bacteria 4868
220 Ga0105237_10000473 3300009545 Bacteria 57014
221 Ga0105237_10003067 3300009545 Bacteria 20140
222 Ga0105237_10006182 3300009545 Bacteria 13376
223 Ga0105237_10012903 3300009545 Bacteria 8779
224 Ga0105237_10013588 3300009545 Bacteria 8530
225 Ga0105237_10028722 3300009545 Bacteria 5661
226 Ga0105237_10114937 3300009545 Bacteria 2684
227 Ga0105238_10001633 3300009551 Bacteria 22466
228 Ga0105249_10003772 3300009553 Bacteria 13079
229 Ga0105249_10007096 3300009553 Bacteria 9780
230 Ga0105249_10009750 3300009553 Bacteria 8413
231 Ga0105249_10151484 3300009553 Bacteria 2233
232 Ga0105249_10236286 3300009553 Unclassified 1805
233 Ga0105249_10252241 3300009553 Bacteria 1750
234 Ga0105239_10000204 3300010375 Bacteria 87242
235 Ga0105239_10000998 3300010375 Bacteria 39651
236 Ga0105239_10001030 3300010375 Bacteria 38874
237 Ga0105239_10001781 3300010375 Bacteria 28334
238 Ga0105239_10006070 3300010375 Bacteria 14067
239 Ga0105239_10006812 3300010375 Bacteria 13182
240 Ga0105239_10085257 3300010375 Bacteria 3481
241 Ga0105239_10086949 3300010375 Bacteria 3446
242 Ga0105239_10319936 3300010375 Bacteria 1749
243 Ga0105246_10042223 3300011119 Bacteria 3088
244 Ga0105246_10059210 3300011119 Bacteria 2656
245 Ga0105246_10098892 3300011119 Bacteria 2120
246 Ga0157373_10064655 3300013100 Bacteria 2589
247 Ga0157373_10100357 3300013100 Bacteria 2037
248 Ga0157370_10006139 3300013104 Bacteria 13332
249 Ga0157370_10021907 3300013104 Bacteria 6364
250 Ga0157370_10095570 3300013104 Bacteria 2788
251 Ga0157369_10043109 3300013105 Bacteria 4919
252 Ga0157369_10077048 3300013105 Bacteria 3574
253 Ga0157374_10000025 3300013296 Bacteria 245131
254 Ga0157374_10005476 3300013296 Bacteria 10655
255 Ga0157374_10015781 3300013296 Bacteria 6634
256 Ga0157374_10065006 3300013296 Bacteria 3425
257 Ga0157374_10082951 3300013296 Bacteria 3044
258 Ga0157374_10135369 3300013296 Bacteria 2388
259 Ga0157378_10014751 3300013297 Bacteria 6847
260 Ga0157378_10016084 3300013297 Bacteria 6552
261 Ga0157378_10043173 3300013297 Bacteria 4003
262 Ga0157378_10141774 3300013297 Bacteria 2232
263 Ga0157378_10152001 3300013297 Bacteria 2158
264 Ga0157378_10158110 3300013297 Bacteria 2117
265 Ga0163162_10001619 3300013306 Bacteria 21066
266 Ga0163162_10003073 3300013306 Bacteria 15950
267 Ga0163162_10008228 3300013306 Bacteria 10180
268 Ga0163162_10008308 3300013306 Bacteria 10129
269 Ga0163162_10015172 3300013306 Bacteria 7525
270 Ga0163162_10018688 3300013306 Bacteria 6791
271 Ga0163162_10022781 3300013306 Bacteria 6175
272 Ga0163162_10030938 3300013306 Bacteria 5306
273 Ga0163162_10038660 3300013306 Unclassified 4762
274 Ga0163162_10067468 3300013306 Bacteria 3627
275 Ga0163162_10113996 3300013306 Bacteria 2802
276 Ga0163162_10155053 3300013306 Bacteria 2410
277 Ga0157372_10000080 3300013307 Bacteria 100216
278 Ga0157372_10022220 3300013307 Bacteria 6863
279 Ga0157372_10024003 3300013307 Bacteria 6615
280 Ga0157372_10037811 3300013307 Bacteria 5324
281 Ga0157372_10054934 3300013307 Bacteria 4446
282 Ga0157372_10094716 3300013307 Bacteria 3401
283 Ga0157372_10149567 3300013307 Bacteria 2694
284 Ga0157372_10274791 3300013307 Bacteria 1958
285 Ga0157375_10000186 3300013308 Bacteria 58217
286 Ga0157375_10005180 3300013308 Bacteria 11311
287 Ga0157375_10023788 3300013308 Bacteria 5660
288 Ga0157375_10063424 3300013308 Bacteria 3676
289 Ga0157375_10147016 3300013308 Bacteria 2488
290 Ga0157375_10248717 3300013308 Unclassified 1938
291 Ga0163163_10000174 3300014325 Bacteria 67568
292 Ga0163163_10000895 3300014325 Bacteria 25277
293 Ga0163163_10001739 3300014325 Bacteria 18346
294 Ga0163163_10022398 3300014325 Bacteria 5982
295 Ga0163163_10049198 3300014325 Bacteria 4148
296 Ga0163163_10124258 3300014325 Bacteria 2617
297 Ga0157380_10016160 3300014326 Bacteria 5499
298 Ga0157380_10139568 3300014326 Bacteria 2080
299 Ga0157380_10187972 3300014326 Bacteria 1821
300 Ga0157377_10002702 3300014745 Bacteria 7882
301 Ga0157377_10085132 3300014745 Bacteria 1855
302 Ga0157379_10008261 3300014968 Bacteria 9044
303 Ga0157379_10015024 3300014968 Bacteria 6792
304 Ga0157379_10017290 3300014968 Bacteria 6354
305 Ga0157379_10037623 3300014968 Bacteria 4316
306 Ga0157379_10066128 3300014968 Bacteria 3232
307 Ga0157376_10000101 3300014969 Bacteria 62612
308 Ga0157376_10004595 3300014969 Bacteria 9614
309 Ga0157376_10005019 3300014969 Bacteria 9234
310 Ga0157376_10020628 3300014969 Bacteria 5103
311 Ga0157376_10029662 3300014969 Bacteria 4359
312 Ga0163161_10003928 3300017792 Bacteria 10427
313 Ga0163161_10009734 3300017792 Bacteria 6659
314 Ga0163161_10017422 3300017792 Bacteria 5027
315 Ga0213876_10001264 3300021384 Bacteria 15967
316 Ga0213876_10014783 3300021384 Bacteria 4137
317 Ga0209646_1000050 3300025246 Bacteria 296599
318 Ga0209646_1003802 3300025246 Bacteria 2885
319 Ga0209026_1000195 3300025250 Bacteria 84589
320 Ga0209673_1000339 3300025273 Bacteria 85906
321 Ga0209564_1004514 3300025295 Bacteria 8472
322 Ga0209758_1000653 3300025297 Bacteria 52393
323 Ga0209758_1010093 3300025297 Bacteria 5720
324 Ga0209050_1000256 3300025298 Bacteria 114192
325 Ga0207426_1000026 3300025302 Bacteria 515228
326 Ga0207426_1001367 3300025302 Bacteria 20677
327 Ga0207426_1002135 3300025302 Bacteria 13503
328 Ga0209257_1000659 3300025304 Bacteria 54234
329 Ga0207656_10012024 3300025321 Bacteria 3284
330 Ga0207656_10036795 3300025321 Bacteria 2056
331 Ga0207682_10027770 3300025893 Bacteria 2255
332 Ga0207680_10000222 3300025903 Bacteria 27423
333 Ga0207680_10005574 3300025903 Bacteria 6019
334 Ga0207680_10008802 3300025903 Bacteria 4975
335 Ga0207680_10024020 3300025903 Bacteria 3338
336 Ga0207647_10034338 3300025904 Bacteria 3239
337 Ga0207645_10000606 3300025907 Bacteria 29699
338 Ga0207643_10015070 3300025908 Bacteria 4203
339 Ga0207643_10036643 3300025908 Bacteria 2751
340 Ga0207705_10027777 3300025909 Bacteria 4035
341 Ga0207707_10016419 3300025912 Bacteria 6458
342 Ga0207695_10000064 3300025913 Bacteria 346010
343 Ga0207695_10000146 3300025913 Bacteria 209416
344 Ga0207695_10000248 3300025913 Bacteria 140288
345 Ga0207695_10000260 3300025913 Bacteria 133317
346 Ga0207695_10003406 3300025913 Bacteria 22456
347 Ga0207695_10013801 3300025913 Bacteria 9611
348 Ga0207695_10030928 3300025913 Bacteria 5886
349 Ga0207695_10034967 3300025913 Bacteria 5455
350 Ga0207695_10035312 3300025913 Bacteria 5424
351 Ga0207695_10046334 3300025913 Bacteria 4609
352 Ga0207671_10000103 3300025914 Bacteria 129408
353 Ga0207671_10001260 3300025914 Bacteria 29830
354 Ga0207671_10002573 3300025914 Bacteria 19198
355 Ga0207671_10002891 3300025914 Bacteria 17784
356 Ga0207671_10003161 3300025914 Bacteria 16663
357 Ga0207671_10014091 3300025914 Bacteria 6336
358 Ga0207671_10035278 3300025914 Bacteria 3713
359 Ga0207660_10007186 3300025917 Bacteria 7208
360 Ga0207649_10004662 3300025920 Bacteria 7417
361 Ga0207649_10056852 3300025920 Bacteria 2444
362 Ga0207652_10015549 3300025921 Bacteria 6190
363 Ga0207681_10015509 3300025923 Bacteria 4753
364 Ga0207681_10186669 3300025923 Unclassified 1583
365 Ga0207681_10187537 3300025923 Bacteria 1580
366 Ga0207694_10007106 3300025924 Bacteria 8506
367 Ga0207650_10018642 3300025925 Bacteria 4872
368 Ga0207650_10078981 3300025925 Bacteria 2491
369 Ga0207659_10029643 3300025926 Bacteria 3732
370 Ga0207659_10071502 3300025926 Bacteria 2533
371 Ga0207644_10001876 3300025931 Bacteria 13686
372 Ga0207690_10004641 3300025932 Bacteria 8127
373 Ga0207706_10001359 3300025933 Bacteria 24443
374 Ga0207706_10004896 3300025933 Bacteria 12524
375 Ga0207706_10099997 3300025933 Bacteria 2552
376 Ga0207686_10001833 3300025934 Bacteria 11830
377 Ga0207686_10028230 3300025934 Bacteria 3296
378 Ga0207686_10071227 3300025934 Bacteria 2236
379 Ga0207686_10115395 3300025934 Bacteria 1819
380 Ga0207670_10005523 3300025936 Bacteria 6949
381 Ga0207670_10057843 3300025936 Bacteria 2631
382 Ga0207704_10019869 3300025938 Bacteria 3540
383 Ga0207691_10017060 3300025940 Bacteria 6889
384 Ga0207691_10027168 3300025940 Bacteria 5369
385 Ga0207691_10037249 3300025940 Bacteria 4506
386 Ga0207691_10050919 3300025940 Bacteria 3789
387 Ga0207691_10168485 3300025940 Bacteria 1919
388 Ga0207691_10264375 3300025940 Unclassified 1482
389 Ga0207689_10000585 3300025942 Bacteria 34768
390 Ga0207689_10005429 3300025942 Bacteria 11407
391 Ga0207689_10006595 3300025942 Bacteria 10236
392 Ga0207689_10024938 3300025942 Bacteria 5012
393 Ga0207689_10049619 3300025942 Bacteria 3462
394 Ga0207661_10000454 3300025944 Bacteria 26362
395 Ga0207661_10006868 3300025944 Bacteria 8071
396 Ga0207661_10010307 3300025944 Bacteria 6723
397 Ga0207679_10003277 3300025945 Bacteria 9993
398 Ga0207679_10010888 3300025945 Bacteria 5865
399 Ga0207679_10037721 3300025945 Bacteria 3438
400 Ga0207679_10066081 3300025945 Bacteria 2709
401 Ga0207667_10000270 3300025949 Bacteria 71998
402 Ga0207667_10000520 3300025949 Bacteria 50760
403 Ga0207667_10004340 3300025949 Bacteria 17365
404 Ga0207667_10153766 3300025949 Bacteria 2367
405 Ga0207651_10008410 3300025960 Bacteria 5573
406 Ga0207651_10039834 3300025960 Bacteria 3102
407 Ga0207651_10149408 3300025960 Bacteria 1816
408 Ga0207712_10002290 3300025961 Bacteria 12423
409 Ga0207712_10005504 3300025961 Bacteria 7986
410 Ga0207712_10013848 3300025961 Bacteria 5171
411 Ga0207712_10057916 3300025961 Bacteria 2736
412 Ga0207712_10068352 3300025961 Bacteria 2545
413 Ga0207668_10000298 3300025972 Bacteria 32532
414 Ga0207640_10035640 3300025981 Bacteria 3115
415 Ga0207658_10013104 3300025986 Bacteria 5662
416 Ga0207658_10013509 3300025986 Bacteria 5581
417 Ga0207658_10085911 3300025986 Bacteria 2424
418 Ga0207658_10145385 3300025986 Unclassified 1925
419 Ga0207658_10190446 3300025986 Bacteria 1704
420 Ga0207677_10004006 3300026023 Bacteria 7860
421 Ga0207677_10005051 3300026023 Bacteria 7130
422 Ga0207677_10012669 3300026023 Bacteria 4858
423 Ga0207677_10021555 3300026023 Bacteria 3939
424 Ga0207677_10132079 3300026023 Bacteria 1898
425 Ga0207703_10006003 3300026035 Bacteria 9726
426 Ga0207703_10006892 3300026035 Bacteria 9047
427 Ga0207703_10018673 3300026035 Bacteria 5416
428 Ga0207703_10123612 3300026035 Bacteria 2225
429 Ga0207639_10006391 3300026041 Bacteria 8004
430 Ga0207639_10007545 3300026041 Bacteria 7418
431 Ga0207639_10015040 3300026041 Bacteria 5450
432 Ga0207678_10016784 3300026067 Bacteria 6430
433 Ga0207702_10020842 3300026078 Bacteria 5422
434 Ga0207702_10088939 3300026078 Bacteria 2700
435 Ga0207641_10000184 3300026088 Bacteria 86994
436 Ga0207641_10003682 3300026088 Bacteria 13499
437 Ga0207641_10009560 3300026088 Bacteria 7987
438 Ga0207641_10054205 3300026088 Bacteria 3402
439 Ga0207648_10003304 3300026089 Bacteria 16933
440 Ga0207648_10004110 3300026089 Bacteria 15064
441 Ga0207648_10018137 3300026089 Bacteria 6375
442 Ga0207648_10031381 3300026089 Bacteria 4698
443 Ga0207648_10053441 3300026089 Bacteria 3531
444 Ga0207648_10055852 3300026089 Bacteria 3446
445 Ga0207648_10064789 3300026089 Bacteria 3185
446 Ga0207648_10154650 3300026089 Bacteria 2024
447 Ga0207648_10179126 3300026089 Unclassified 1876
448 Ga0207676_10003554 3300026095 Bacteria 11027
449 Ga0207676_10009360 3300026095 Bacteria 6972
450 Ga0207676_10024928 3300026095 Bacteria 4433
451 Ga0207676_10095738 3300026095 Bacteria 2449
452 Ga0207674_10004795 3300026116 Bacteria 16200
453 Ga0207674_10026414 3300026116 Bacteria 6168
454 Ga0207674_10026681 3300026116 Bacteria 6129
455 Ga0207674_10032102 3300026116 Bacteria 5509
456 Ga0207674_10103142 3300026116 Bacteria 2832
457 Ga0207674_10119036 3300026116 Bacteria 2610
458 Ga0207675_100073885 3300026118 Bacteria 3190
459 Ga0207675_100092134 3300026118 Bacteria 2850
460 Ga0207675_100096251 3300026118 Bacteria 2786
461 Ga0207683_10011496 3300026121 Bacteria 7557
462 Ga0207683_10030580 3300026121 Bacteria 4666
463 Ga0207683_10048435 3300026121 Bacteria 3721
464 Ga0207683_10090404 3300026121 Unclassified 2726
465 Ga0207683_10219796 3300026121 Bacteria 1731
466 Ga0207698_10000963 3300026142 Bacteria 16738
467 Ga0207698_10021199 3300026142 Bacteria 4489
468 Ga0207698_10021249 3300026142 Bacteria 4484
469 Ga0207698_10057494 3300026142 Bacteria 3010
470 Ga0268266_10000026 3300028379 Bacteria 434485
471 Ga0268266_10013819 3300028379 Bacteria 6949
472 Ga0268266_10020935 3300028379 Bacteria 5575
473 Ga0268265_10125281 3300028380 Bacteria 2125
474 Ga0268264_10000019 3300028381 Bacteria 488112
475 Ga0268264_10003219 3300028381 Bacteria 14141
476 Ga0268264_10003983 3300028381 Bacteria 12642
477 Ga0268264_10039181 3300028381 Bacteria 3916
478 Ga0268264_10049286 3300028381 Bacteria 3504
479 Ga0268264_10100328 3300028381 Bacteria 2514
480 Ga0268264_10246372 3300028381 Bacteria 1658
481 Ga0307517_10004138 3300028786 Bacteria 22383
482 Ga0307517_10048080 3300028786 Bacteria 4401
483 Ga0307515_10000001 3300028794 Bacteria 4259510
484 Ga0307515_10000455 3300028794 Bacteria 97670
485 Ga0307511_10000182 3300030521 Bacteria 62310
486 Ga0265327_10000034 3300031251 Bacteria 316018
487 Ga0265327_10000048 3300031251 Bacteria 269173
488 Ga0265327_10000390 3300031251 Bacteria 82772
489 Ga0265327_10014097 3300031251 Bacteria 5254
490 Ga0265327_10018948 3300031251 Bacteria 4248
491 Ga0307509_10147116 3300031507 Bacteria 2279
492 Ga0307508_10016080 3300031616 Bacteria 6815
493 Ga0307414_10057150 3300032004 Bacteria 2741
494 Ga0307510_10000068 3300033180 Bacteria 78208
495 Ga0373937_0009187 3300036401 Bacteria 8581
496 Ga0373937_0186322 3300036401 Bacteria 1949
497 Ga0436365_1560297 3300039437 Bacteria 11044
498 Ga0436365_1874674 3300039437 Bacteria 58580
499 Ga0451851_0645281 3300041507 Bacteria 2321
500 Ga0439449_0019064 3300042007 Bacteria 2573
501 Ga0439457_000035 3300042014 Bacteria 28526
502 Ga0439462_0001746 3300042015 Bacteria 4914
503 Ga0451577_0004359 3300042876 Bacteria 14984
504 Ga0466969_0000543 3300044656 Bacteria 20665
505 Ga0466972_0000016 3300044658 Bacteria 208802
506 Ga0466972_0000105 3300044658 Bacteria 73294
507 Ga0453683_0085704 3300044673 Bacteria 1974
508 Ga0466965_0020578 3300044683 Bacteria 3173
509 Ga0466966_0036553 3300044684 Bacteria 3170
510 Ga0453684_0050707 3300044712 Bacteria 5455
511 Ga0453684_0053754 3300044712 Bacteria 5254
512 Ga0466968_0018640 3300044735 Bacteria 2786
513 Ga0466970_0001127 3300044765 Bacteria 12952
514 Ga0466970_0038168 3300044765 Bacteria 2547
515 Ga0466957_0129716 3300044842 Bacteria 1614
516 Ga0466959_0000076 3300045049 Bacteria 62314
517 Ga0466959_0032034 3300045049 Bacteria 3890
518 Ga0495629_0028475 3300046459 Bacteria 3967
519 Ga0495580_0032932 3300046472 Bacteria 3735
520 Ga0495582_0015665 3300046473 Bacteria 4161
521 Ga0495662_0038799 3300046476 Bacteria 2302
522 Ga0495606_0004028 3300046507 Bacteria 14985
523 Ga0495630_0018405 3300046517 Bacteria 5132
524 Ga0495648_0003503 3300046524 Bacteria 13761
525 Ga0495652_0058503 3300046529 Bacteria 3263
526 Ga0495668_0000078 3300046616 Bacteria 157809
527 Ga0495668_0033726 3300046616 Bacteria 2875
528 Ga0495611_0000072 3300046648 Bacteria 70916
529 Ga0495623_0076584 3300046679 Bacteria 2076
530 Ga0495658_0029575 3300046683 Bacteria 2968
531 Ga0495670_0030682 3300046691 Bacteria 2670
532 Ga0495636_0000002 3300047318 Bacteria 145900
533 Ga0495674_0050697 3300047319 Bacteria 3662
534 Ga0495672_0015121 3300047320 Bacteria 5253
535 Ga0495687_000031 3300047443 Bacteria 274659
536 Ga0495686_0000005 3300047472 Bacteria 827143
537 Ga0495686_0000480 3300047472 Bacteria 59448
538 Ga0495686_0021042 3300047472 Bacteria 4341
539 Ga0496108_0140010 3300048911 Unclassified 2084
540 Ga0496114_0000297 3300048917 Bacteria 36559
541 Ga0496114_0019221 3300048917 Bacteria 5536
542 Ga0496115_0013024 3300048918 Bacteria 6278
543 Ga0501031_0010242 3300049568 Bacteria 6104
544 Ga0501034_0070521 3300049571 Bacteria 3505
545 Ga0501034_0266141 3300049571 Bacteria 1656
546 Ga0501036_0005958 3300049572 Bacteria 9882
547 Ga0501036_0056884 3300049572 Bacteria 3313
548 Ga0501038_0004158 3300049574 Bacteria 13460
549 Ga0501047_0010114 3300049581 Bacteria 8918
550 Ga0501047_0029344 3300049581 Bacteria 5306
551 Ga0501047_0111831 3300049581 Bacteria 2613
552 Ga0501047_0222613 3300049581 Bacteria 1743
553 Ga0501048_0040331 3300049582 Bacteria 3347
554 Ga0501067_0031370 3300049583 Bacteria 2949
555 Ga0501069_0041351 3300049585 Bacteria 2547
556 Ga0501073_0020388 3300049589 Bacteria 4782
557 Ga0501074_0017551 3300049590 Bacteria 5195
558 Ga0501074_0039174 3300049590 Bacteria 3432
559 Ga0501219_000076 3300049703 Bacteria 17037
560 Ga0501080_0064178 3300049742 Bacteria 3416
561 Ga0501080_0088114 3300049742 Bacteria 2883
562 Ga0501083_0010722 3300049744 Bacteria 6447
563 Ga0501083_0042760 3300049744 Bacteria 3070
564 Ga0501035_0040581 3300049822 Bacteria 4204
565 Ga0501035_0070308 3300049822 Bacteria 3101
566 Ga0501035_0128140 3300049822 Bacteria 2214
567 Ga0501044_0003735 3300049823 Bacteria 17103
568 Ga0501044_0014396 3300049823 Bacteria 8542
569 Ga0501044_0052083 3300049823 Bacteria 4220
570 Ga0501044_0127040 3300049823 Bacteria 2546
571 Ga0501044_0193782 3300049823 Bacteria 1993
572 Ga0501284_00006 3300050005 Bacteria 153628
573 nmdc:mga0k408_62121_c2 3300050493 Bacteria 1287
574 nmdc:mga0k408_64004_c1 3300050493 Bacteria 2140
575 nmdc:mga09592_139547_c1 3300050508 Bacteria 2089
576 nmdc:mga0qj67_116810_c1 3300050509 Bacteria 2156
577 nmdc:mga0qj67_24930_c1 3300050509 Bacteria 4616
578 nmdc:mga06r32_193811_c1 3300050510 Bacteria 2019
579 Ga0500578_0000100 3300053086 Bacteria 99827
580 Ga0500646_0011854 3300053090 Bacteria 2246
581 Ga0500583_0000009 3300053092 Bacteria 160749
582 Ga0500562_000219 3300053108 Bacteria 15356
583 Ga0500559_0010601 3300053136 Bacteria 3953
584 Ga0500568_0001667 3300053139 Bacteria 13916
585 Ga0500588_0006799 3300053146 Bacteria 2612
586 Ga0500589_004823 3300053147 Bacteria 5152
587 Ga0500603_022152 3300053150 Bacteria 1571
588 Ga0500616_0001244 3300053153 Bacteria 25549
589 Ga0500622_0000615 3300053156 Bacteria 32225
590 Ga0500622_0003672 3300053156 Bacteria 10078
591 Ga0500636_0042243 3300053177 Bacteria 2695
592 Ga0500645_003248 3300053730 Bacteria 6721
593 Ga0500645_009136 3300053730 Bacteria 3344
594 Ga0501082_0019650 3300060353 Bacteria 5824
595 Ga0466962_0018397 3300061719 Bacteria 3360
596 2738725975 2738541278 Bacteria 9755573
597 2819590478 2818991444 Bacteria 6968812
598 2929158643 2929154850 Bacteria 6753285
599 2929922449 2929921140 Bacteria 8649150
600 8003153873 8003151029 Bacteria 8187759
601 Ga0495672_0044440
602 JGI24740J21852_10012939
603 JGI24740J21852_10015804
604 JGI24739J22299_10000573
605 JGI25154J39366_1000021
606 JGI25157J39369_1004453
607 JGI25153J46596_10000222
608 rootH1_10116196
609 rootH2_10001918
610 rootH2_10049592
611 rootH2_10053498
612 rootL2_10076268
613 rootL2_10076278
614 rootL2_10121572
615 rootH1_10017025
616 rootH1_10064497
617 rootH1_10225010
618 rootH1_10317284
619 JGI25160J50197_1002216
620 JGI25160J50197_1003616
621 JGI25160J50197_1005724
622 Ga0055526_1023073
623 Ga0055530_10001651
624 Ga0055531_10032144
625 Ga0065165_1000579
626 Ga0065712_10001191
627 Ga0065712_10011864
628 Ga0065715_10004363
629 Ga0070658_10003542
630 Ga0070676_10002024
631 Ga0070676_10002966
632 Ga0070676_10046563
633 Ga0070683_100000292
634 Ga0070683_100001205
635 Ga0070683_100015503
636 Ga0070683_100064799
637 Ga0070690_100102296
638 Ga0070670_100052551
639 Ga0070670_100061388
640 Ga0070670_100089593
641 Ga0070670_100098525
642 Ga0068869_100008280
643 Ga0068869_100013836
644 Ga0068869_100015938
645 Ga0068869_100037187
646 Ga0070666_10000019
647 Ga0070666_10008494
648 Ga0070666_10010165
649 Ga0070666_10013027
650 Ga0070680_100023459
651 Ga0068868_100002206
652 Ga0068868_100004920
653 Ga0068868_100007563
654 Ga0068868_100007993
655 Ga0068868_100061477
656 Ga0070689_100006975
657 Ga0070689_100019780
658 Ga0070661_100000350
659 Ga0070661_100003767
660 Ga0070668_100002414
661 Ga0070668_100028325
662 Ga0070669_100059939
663 Ga0070675_100019801
664 Ga0070675_100129861
665 Ga0070671_100001143
666 Ga0070671_100175367
667 Ga0070674_100101141
668 Ga0070674_100182389
669 Ga0070673_100014307
670 Ga0070673_100019702
671 Ga0070673_100035061
672 Ga0070688_100006810
673 Ga0070688_100044021
674 Ga0070688_100082919
675 Ga0070659_100005305
676 Ga0070667_100000031
677 Ga0070667_100010344
678 Ga0070667_100037238
679 Ga0070667_100052349
680 Ga0070667_100071933
681 Ga0070663_100058925
682 Ga0070662_100001190
683 Ga0070662_100001909
684 Ga0070662_100089821
685 Ga0068867_100009415
686 Ga0068867_100009690
687 Ga0068867_100012634
688 Ga0068867_100053480
689 Ga0070685_10013706
690 Ga0070698_100005311
691 Ga0070698_100011645
692 Ga0070698_100031376
693 Ga0070679_100237158
694 Ga0070684_100000508
695 Ga0070684_100025502
696 Ga0070684_100031486
697 Ga0068853_100001666
698 Ga0068853_100011866
699 Ga0068853_100019053
700 Ga0068853_100019166
701 Ga0068853_100036255
702 Ga0068853_100049879
703 Ga0070672_100005602
704 Ga0070672_100120217
705 Ga0070693_100009128
706 Ga0070665_100000018
707 Ga0070665_100002650
708 Ga0070665_100021714
709 Ga0070665_100123688
710 Ga0068855_100001866
711 Ga0068855_100003963
712 Ga0068855_100032219
713 Ga0068855_100315211
714 Ga0070664_100000445
715 Ga0070664_100064059
716 Ga0068857_100010937
717 Ga0068857_100037620
718 Ga0068857_100038637
719 Ga0068857_100043089
720 Ga0068854_100014549
721 Ga0068856_100014734
722 Ga0068852_100000274
723 Ga0068852_100040671
724 Ga0068852_100048586
725 Ga0068852_100058866
726 Ga0068852_100126443
727 Ga0068859_100000013
728 Ga0068859_100000451
729 Ga0068859_100030431
730 Ga0068859_100135628
731 Ga0068859_100208896
732 Ga0068864_100006018
733 Ga0068864_100009714
734 Ga0068864_100031437
735 Ga0068864_100072565
736 Ga0068866_10054303
737 Ga0068861_100005961
738 Ga0068861_100049205
739 Ga0068861_100166549
740 Ga0068851_10001096
741 Ga0068851_10009552
742 Ga0068851_10033809
743 Ga0068851_10047500
744 Ga0068870_10033666
745 Ga0068870_10037944
746 Ga0068863_100005507
747 Ga0068863_100018879
748 Ga0068863_100023592
749 Ga0068863_100025539
750 Ga0068863_100087680
751 Ga0068858_100004954
752 Ga0068858_100021942
753 Ga0068858_100049792
754 Ga0068858_100086984
755 Ga0068860_100000040
756 Ga0068860_100000948
757 Ga0068860_100005457
758 Ga0068860_100016192
759 Ga0068860_100029845
760 Ga0068860_100051471
761 Ga0068860_100139082
762 Ga0068860_100240183
763 Ga0068860_100299886
764 Ga0068862_100158146
765 Ga0070715_10008824
766 Ga0075366_10002314
767 Ga0075366_10015119
768 Ga0097621_100001789
769 Ga0097621_100003766
770 Ga0097621_100006952
771 Ga0097621_100008416
772 Ga0097621_100009337
773 Ga0097621_100184397
774 Ga0097621_100216916
775 Ga0068871_100000075
776 Ga0068871_100001976
777 Ga0068871_100004482
778 Ga0068871_100007909
779 Ga0068871_100016350
780 Ga0068871_100197741
781 Ga0068871_100209620
782 Ga0075428_100005318
783 Ga0075428_100052566
784 Ga0075430_100010757
785 Ga0075430_100025027
786 Ga0075429_100000991
787 Ga0068865_100004346
788 Ga0097620_100000013
789 Ga0097620_100000451
790 Ga0097620_100030429
791 Ga0097620_100135626
792 Ga0097620_100208892
793 Ga0105240_10000138
794 Ga0105240_10000785
795 Ga0105240_10003502
796 Ga0105240_10005325
797 Ga0105240_10009847
798 Ga0105240_10025643
799 Ga0105240_10025938
800 Ga0105240_10027963
801 Ga0105240_10038013
802 Ga0105240_10039588
803 Ga0105240_10051730
804 Ga0105240_10203335
805 Ga0111539_10080351
806 Ga0105247_10010798
807 Ga0114129_10055684
808 Ga0114129_10101951
809 Ga0114129_10136259
810 Ga0105241_10000297
811 Ga0105241_10016359
812 Ga0105241_10031694
813 Ga0105241_10042983
814 Ga0105242_10005909
815 Ga0105242_10022521
816 Ga0105242_10035688
817 Ga0105242_10109560
818 Ga0105242_10184785
819 Ga0105248_10046424
820 Ga0105237_10000473
821 Ga0105237_10003067
822 Ga0105237_10006182
823 Ga0105237_10012903
824 Ga0105237_10013588
825 Ga0105237_10028722
826 Ga0105237_10114937
827 Ga0105238_10001633
828 Ga0105249_10003772
829 Ga0105249_10007096
830 Ga0105249_10009750
831 Ga0105249_10151484
832 Ga0105249_10236286
833 Ga0105249_10252241
834 Ga0105239_10000204
835 Ga0105239_10000998
836 Ga0105239_10001030
837 Ga0105239_10001781
838 Ga0105239_10006070
839 Ga0105239_10006812
840 Ga0105239_10085257
841 Ga0105239_10086949
842 Ga0105239_10319936
843 Ga0105246_10042223
844 Ga0105246_10059210
845 Ga0105246_10098892
846 Ga0157373_10064655
847 Ga0157373_10100357
848 Ga0157370_10006139
849 Ga0157370_10021907
850 Ga0157370_10095570
851 Ga0157369_10043109
852 Ga0157369_10077048
853 Ga0157374_10000025
854 Ga0157374_10005476
855 Ga0157374_10015781
856 Ga0157374_10065006
857 Ga0157374_10082951
858 Ga0157374_10135369
859 Ga0157378_10014751
860 Ga0157378_10016084
861 Ga0157378_10043173
862 Ga0157378_10141774
863 Ga0157378_10152001
864 Ga0157378_10158110
865 Ga0163162_10001619
866 Ga0163162_10003073
867 Ga0163162_10008228
868 Ga0163162_10008308
869 Ga0163162_10015172
870 Ga0163162_10018688
871 Ga0163162_10022781
872 Ga0163162_10030938
873 Ga0163162_10038660
874 Ga0163162_10067468
875 Ga0163162_10113996
876 Ga0163162_10155053
877 Ga0157372_10000080
878 Ga0157372_10022220
879 Ga0157372_10024003
880 Ga0157372_10037811
881 Ga0157372_10054934
882 Ga0157372_10094716
883 Ga0157372_10149567
884 Ga0157372_10274791
885 Ga0157375_10000186
886 Ga0157375_10005180
887 Ga0157375_10023788
888 Ga0157375_10063424
889 Ga0157375_10147016
890 Ga0157375_10248717
891 Ga0163163_10000174
892 Ga0163163_10000895
893 Ga0163163_10001739
894 Ga0163163_10022398
895 Ga0163163_10049198
896 Ga0163163_10124258
897 Ga0157380_10016160
898 Ga0157380_10139568
899 Ga0157380_10187972
900 Ga0157377_10002702
901 Ga0157377_10085132
902 Ga0157379_10008261
903 Ga0157379_10015024
904 Ga0157379_10017290
905 Ga0157379_10037623
906 Ga0157379_10066128
907 Ga0157376_10000101
908 Ga0157376_10004595
909 Ga0157376_10005019
910 Ga0157376_10020628
911 Ga0157376_10029662
912 Ga0163161_10003928
913 Ga0163161_10009734
914 Ga0163161_10017422
915 Ga0213876_10001264
916 Ga0213876_10014783
917 Ga0209646_1000050
918 Ga0209646_1003802
919 Ga0209026_1000195
920 Ga0209673_1000339
921 Ga0209564_1004514
922 Ga0209758_1000653
923 Ga0209758_1010093
924 Ga0209050_1000256
925 Ga0207426_1000026
926 Ga0207426_1001367
927 Ga0207426_1002135
928 Ga0209257_1000659
929 Ga0207656_10012024
930 Ga0207656_10036795
931 Ga0207682_10027770
932 Ga0207680_10000222
933 Ga0207680_10005574
934 Ga0207680_10008802
935 Ga0207680_10024020
936 Ga0207647_10034338
937 Ga0207645_10000606
938 Ga0207643_10015070
939 Ga0207643_10036643
940 Ga0207705_10027777
941 Ga0207707_10016419
942 Ga0207695_10000064
943 Ga0207695_10000146
944 Ga0207695_10000248
945 Ga0207695_10000260
946 Ga0207695_10003406
947 Ga0207695_10013801
948 Ga0207695_10030928
949 Ga0207695_10034967
950 Ga0207695_10035312
951 Ga0207695_10046334
952 Ga0207671_10000103
953 Ga0207671_10001260
954 Ga0207671_10002573
955 Ga0207671_10002891
956 Ga0207671_10003161
957 Ga0207671_10014091
958 Ga0207671_10035278
959 Ga0207660_10007186
960 Ga0207649_10004662
961 Ga0207649_10056852
962 Ga0207652_10015549
963 Ga0207681_10015509
964 Ga0207681_10186669
965 Ga0207681_10187537
966 Ga0207694_10007106
967 Ga0207650_10018642
968 Ga0207650_10078981
969 Ga0207659_10029643
970 Ga0207659_10071502
971 Ga0207644_10001876
972 Ga0207690_10004641
973 Ga0207706_10001359
974 Ga0207706_10004896
975 Ga0207706_10099997
976 Ga0207686_10001833
977 Ga0207686_10028230
978 Ga0207686_10071227
979 Ga0207686_10115395
980 Ga0207670_10005523
981 Ga0207670_10057843
982 Ga0207704_10019869
983 Ga0207691_10017060
984 Ga0207691_10027168
985 Ga0207691_10037249
986 Ga0207691_10050919
987 Ga0207691_10168485
988 Ga0207691_10264375
989 Ga0207689_10000585
990 Ga0207689_10005429
991 Ga0207689_10006595
992 Ga0207689_10024938
993 Ga0207689_10049619
994 Ga0207661_10000454
995 Ga0207661_10006868
996 Ga0207661_10010307
997 Ga0207679_10003277
998 Ga0207679_10010888
999 Ga0207679_10037721
1000 Ga0207679_10066081
1001 Ga0207667_10000270
1002 Ga0207667_10000520
1003 Ga0207667_10004340
1004 Ga0207667_10153766
1005 Ga0207651_10008410
1006 Ga0207651_10039834
1007 Ga0207651_10149408
1008 Ga0207712_10002290
1009 Ga0207712_10005504
1010 Ga0207712_10013848
1011 Ga0207712_10057916
1012 Ga0207712_10068352
1013 Ga0207668_10000298
1014 Ga0207640_10035640
1015 Ga0207658_10013104
1016 Ga0207658_10013509
1017 Ga0207658_10085911
1018 Ga0207658_10145385
1019 Ga0207658_10190446
1020 Ga0207677_10004006
1021 Ga0207677_10005051
1022 Ga0207677_10012669
1023 Ga0207677_10021555
1024 Ga0207677_10132079
1025 Ga0207703_10006003
1026 Ga0207703_10006892
1027 Ga0207703_10018673
1028 Ga0207703_10123612
1029 Ga0207639_10006391
1030 Ga0207639_10007545
1031 Ga0207639_10015040
1032 Ga0207678_10016784
1033 Ga0207702_10020842
1034 Ga0207702_10088939
1035 Ga0207641_10000184
1036 Ga0207641_10003682
1037 Ga0207641_10009560
1038 Ga0207641_10054205
1039 Ga0207648_10003304
1040 Ga0207648_10004110
1041 Ga0207648_10018137
1042 Ga0207648_10031381
1043 Ga0207648_10053441
1044 Ga0207648_10055852
1045 Ga0207648_10064789
1046 Ga0207648_10154650
1047 Ga0207648_10179126
1048 Ga0207676_10003554
1049 Ga0207676_10009360
1050 Ga0207676_10024928
1051 Ga0207676_10095738
1052 Ga0207674_10004795
1053 Ga0207674_10026414
1054 Ga0207674_10026681
1055 Ga0207674_10032102
1056 Ga0207674_10103142
1057 Ga0207674_10119036
1058 Ga0207675_100073885
1059 Ga0207675_100092134
1060 Ga0207675_100096251
1061 Ga0207683_10011496
1062 Ga0207683_10030580
1063 Ga0207683_10048435
1064 Ga0207683_10090404
1065 Ga0207683_10219796
1066 Ga0207698_10000963
1067 Ga0207698_10021199
1068 Ga0207698_10021249
1069 Ga0207698_10057494
1070 Ga0268266_10000026
1071 Ga0268266_10013819
1072 Ga0268266_10020935
1073 Ga0268265_10125281
1074 Ga0268264_10000019
1075 Ga0268264_10003219
1076 Ga0268264_10003983
1077 Ga0268264_10039181
1078 Ga0268264_10049286
1079 Ga0268264_10100328
1080 Ga0268264_10246372
1081 Ga0307517_10004138
1082 Ga0307517_10048080
1083 Ga0307515_10000001
1084 Ga0307515_10000455
1085 Ga0307511_10000182
1086 Ga0265327_10000034
1087 Ga0265327_10000048
1088 Ga0265327_10000390
1089 Ga0265327_10014097
1090 Ga0265327_10018948
1091 Ga0307509_10147116
1092 Ga0307508_10016080
1093 Ga0307414_10057150
1094 Ga0307510_10000068
1095 Ga0373937_0009187
1096 Ga0373937_0186322
1097 Ga0436365_1560297
1098 Ga0436365_1874674
1099 Ga0451851_0645281
1100 Ga0439449_0019064
1101 Ga0439457_000035
1102 Ga0439462_0001746
1103 Ga0451577_0004359
1104 Ga0466969_0000543
1105 Ga0466972_0000016
1106 Ga0466972_0000105
1107 Ga0453683_0085704
1108 Ga0466965_0020578
1109 Ga0466966_0036553
1110 Ga0453684_0050707
1111 Ga0453684_0053754
1112 Ga0466968_0018640
1113 Ga0466970_0001127
1114 Ga0466970_0038168
1115 Ga0466957_0129716
1116 Ga0466959_0000076
1117 Ga0466959_0032034
1118 Ga0495629_0028475
1119 Ga0495580_0032932
1120 Ga0495582_0015665
1121 Ga0495662_0038799
1122 Ga0495606_0004028
1123 Ga0495630_0018405
1124 Ga0495648_0003503
1125 Ga0495652_0058503
1126 Ga0495668_0000078
1127 Ga0495668_0033726
1128 Ga0495611_0000072
1129 Ga0495623_0076584
1130 Ga0495658_0029575
1131 Ga0495670_0030682
1132 Ga0495636_0000002
1133 Ga0495674_0050697
1134 Ga0495672_0015121
1135 Ga0495687_000031
1136 Ga0495686_0000005
1137 Ga0495686_0000480
1138 Ga0495686_0021042
1139 Ga0496108_0140010
1140 Ga0496114_0000297
1141 Ga0496114_0019221
1142 Ga0496115_0013024
1143 Ga0501031_0010242
1144 Ga0501034_0070521
1145 Ga0501034_0266141
1146 Ga0501036_0005958
1147 Ga0501036_0056884
1148 Ga0501038_0004158
1149 Ga0501047_0010114
1150 Ga0501047_0029344
1151 Ga0501047_0111831
1152 Ga0501047_0222613
1153 Ga0501048_0040331
1154 Ga0501067_0031370
1155 Ga0501069_0041351
1156 Ga0501073_0020388
1157 Ga0501074_0017551
1158 Ga0501074_0039174
1159 Ga0501219_000076
1160 Ga0501080_0064178
1161 Ga0501080_0088114
1162 Ga0501083_0010722
1163 Ga0501083_0042760
1164 Ga0501035_0040581
1165 Ga0501035_0070308
1166 Ga0501035_0128140
1167 Ga0501044_0003735
1168 Ga0501044_0014396
1169 Ga0501044_0052083
1170 Ga0501044_0127040
1171 Ga0501044_0193782
1172 Ga0501284_00006
1173 nmdc:mga0k408_62121_c2
1174 nmdc:mga0k408_64004_c1
1175 nmdc:mga09592_139547_c1
1176 nmdc:mga0qj67_116810_c1
1177 nmdc:mga0qj67_24930_c1
1178 nmdc:mga06r32_193811_c1
1179 Ga0500578_0000100
1180 Ga0500646_0011854
1181 Ga0500583_0000009
1182 Ga0500562_000219
1183 Ga0500559_0010601
1184 Ga0500568_0001667
1185 Ga0500588_0006799
1186 Ga0500589_004823
1187 Ga0500603_022152
1188 Ga0500616_0001244
1189 Ga0500622_0000615
1190 Ga0500622_0003672
1191 Ga0500636_0042243
1192 Ga0500645_003248
1193 Ga0500645_009136
1194 Ga0501082_0019650
1195 Ga0466962_0018397
1196 2738725975
1197 2819590478
1198 2929158643
1199 2929922449
1200 8003153873

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03331

LpxC

UDP-3-O-acyl N-acetylglycosamine deacetylase

10

245

0.95

PF03331

LpxC

UDP-3-O-acyl N-acetylglycosamine deacetylase

242

305

0.95

PF07977

FabA

FabA-like domain

336

459

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ci8-assembly2.cif.gz_B crystal structure of p.aeruginosa lpxc in complex with inhibitor 0.9409 8 302
7k99-assembly2.cif.gz_C crystal structure of p. aeruginosa lpxc with n-hydroxyformamide inhibitor 19 0.9388 7 309
7k9a-assembly2.cif.gz_C crystal structure of p. aeruginosa lpxc with n-hydroxyformamide inhibitor 0.9341 8 302
5u3b-assembly1.cif.gz_A pseudomonas aeruginosa lpxc in complex with nvs-lpxc-01 0.932 7 309
5u3b-assembly2.cif.gz_B pseudomonas aeruginosa lpxc in complex with nvs-lpxc-01 0.9299 7 309
ID Description Score Start End Superfamily
3p3gA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.9599 7 132 3.30.230.20
af_Q10PS1_24_147_3.30.230.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.9471 8 125 3.30.230.20
3p3gA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.9382 7 132 3.30.230.20
af_Q10PS1_24_147_3.30.230.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.8953 8 125 3.30.230.20
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.891 326 466 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7C6FFM7-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9935 7 107 GO:0009245
GO:0016020
GO:0103117
AF-A0A1I8AMA8-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9921 8 104 GO:0009245
GO:0016020
GO:0103117
AF-A0A6M0C3P3-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9895 7 127 GO:0009245
GO:0016020
GO:0103117
AF-A0A7C5EXZ8-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9895 7 127 GO:0009245
GO:0016020
GO:0103117
AF-A0A524Q925-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9889 408 471 GO:0016829

Map