F468024

General Info

Members Datasets Scaffolds Average Seq Length
600 362 1200 431

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0187434|Ga0501080_0187434_256_1791
Length 480
Sequence MIPTVNVAPATGWPTGTTPVAAAGLEVAAFASGLEHPRWLYVLPNGDVLVAESNRPPAPEGSAGGGLKKWVMKRMMARAGAGVASANRITLLRDADGDGVAETRSVFLQDLNSPFGMALIGNAFYVANADAIVRFPYTAGATTMDSGAGVKVVDLPAGINHHWTKNLLASRDGTRLYATVGSNSNIAEKGMAAEEGRAAIWEIDPKAGTKRLFAAGLRNPNGLAWEPRTGALWTVVNERDELGSDLVPDYLTSVVDGGFYGWPYSYWGQNVDERVQPQQPDLVAKAIKPDYALGAHVAPLGLTTSEGAASLPSTYSSGMFVGQHGSWNRRPLSGYSVVFVPFRDGKPSDMPAEILTGFVNSDGEAHGRPVGVAIDKRGALLVADDVGNTIWRVASAAQSGQRSDRPGERTSSDARGRPAKLLLAALSVALADAVAADEEIRPQDRPAAFRELDVDGDGWISVVALNRSDQPGKFRNPDQG

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
102 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
121 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
129 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
212 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
221 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
222 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
226 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
312 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
327 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
328 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
329 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
330 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
331 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
332 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
333 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
337 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
338 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
339 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
340 2643221570 Acidovorax sp. Root568 Isolate Unclassified
341 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
342 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
343 2643221652 Acidovorax sp. Root402 Isolate Unclassified
344 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
345 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
346 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
347 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
348 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
349 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
350 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
351 2857564685 Duganella sp. R-74599 Isolate Unclassified
352 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
353 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
354 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
355 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
356 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
357 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
358 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
359 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
360 639633007 Azoarcus olearius BH72 Isolate Unclassified
361 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
362 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 0
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 1.33
Rhizoplane 1.5
Rhizosphere 80.17
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0187434 3300049742 Bacteria 1902
2 JGI24743J22301_10011591 3300001991 Bacteria 1591
3 JGI25159J45721_1003747 3300002987 Bacteria 5262
4 JGI25153J46596_10028772 3300003215 Bacteria 1921
5 rootL2_10000892 3300003322 Bacteria 46839
6 rootH1_10019014 3300003323 Bacteria 8773
7 JGI25404J52841_10006004 3300003659 Bacteria 2526
8 Ga0055538_1000886 3300003751 Bacteria 7512
9 Ga0055539_1000794 3300003752 Bacteria 7512
10 Ga0055533_1001148 3300003756 Bacteria 7512
11 Ga0055532_1001240 3300003758 Bacteria 7508
12 Ga0055525_1001003 3300003759 Bacteria 7512
13 Ga0055526_1000052 3300003771 Bacteria 116035
14 Ga0055524_1000117 3300003775 Bacteria 93643
15 Ga0055524_1012896 3300003775 Bacteria 3184
16 Ga0055531_10004923 3300003794 Bacteria 7940
17 Ga0055531_10005573 3300003794 Bacteria 7344
18 Ga0055541_1000846 3300003841 Bacteria 7512
19 Ga0055543_1005977 3300004625 Bacteria 3021
20 Ga0065165_1000059 3300005262 Bacteria 182314
21 Ga0065165_1000099 3300005262 Bacteria 142245
22 Ga0065165_1000378 3300005262 Bacteria 72655
23 Ga0065165_1000598 3300005262 Bacteria 52772
24 Ga0065714_10004818 3300005288 Bacteria 4585
25 Ga0065712_10067802 3300005290 Bacteria 31985
26 Ga0065715_10097283 3300005293 Bacteria 3731
27 Ga0070658_10016477 3300005327 Bacteria 5915
28 Ga0070676_10013640 3300005328 Bacteria 4456
29 Ga0070676_10067197 3300005328 Bacteria 2143
30 Ga0070683_100042465 3300005329 Bacteria 4187
31 Ga0070670_100000155 3300005331 Bacteria 62949
32 Ga0070670_100008834 3300005331 Bacteria 8601
33 Ga0070670_100030930 3300005331 Bacteria 4611
34 Ga0070670_100127424 3300005331 Bacteria 2197
35 Ga0070666_10010244 3300005335 Bacteria 5858
36 Ga0070680_100007963 3300005336 Bacteria 8089
37 Ga0070680_100162156 3300005336 Bacteria 1879
38 Ga0070680_100183242 3300005336 Bacteria 1764
39 Ga0070682_100027876 3300005337 Bacteria 3392
40 Ga0070682_100046482 3300005337 Bacteria 2694
41 Ga0068868_100127726 3300005338 Bacteria 2078
42 Ga0070660_100006633 3300005339 Bacteria 8030
43 Ga0070689_100028511 3300005340 Bacteria 4220
44 Ga0070689_100035468 3300005340 Bacteria 3811
45 Ga0070691_10002047 3300005341 Bacteria 8897
46 Ga0070691_10007419 3300005341 Bacteria 5024
47 Ga0070687_100000955 3300005343 Bacteria 9832
48 Ga0070687_100034798 3300005343 Bacteria 2496
49 Ga0070687_100039170 3300005343 Bacteria 2380
50 Ga0070687_100053725 3300005343 Bacteria 2096
51 Ga0070661_100008546 3300005344 Bacteria 7080
52 Ga0070692_10001360 3300005345 Bacteria 8818
53 Ga0070692_10025118 3300005345 Bacteria 2935
54 Ga0070668_100024477 3300005347 Bacteria 4576
55 Ga0070668_100026469 3300005347 Bacteria 4402
56 Ga0070669_100001083 3300005353 Bacteria 19929
57 Ga0070669_100010755 3300005353 Bacteria 6495
58 Ga0070669_100026167 3300005353 Bacteria 4197
59 Ga0070669_100049063 3300005353 Bacteria 3082
60 Ga0070671_100110412 3300005355 Bacteria 2310
61 Ga0070674_100034832 3300005356 Bacteria 3366
62 Ga0070674_100044169 3300005356 Bacteria 3036
63 Ga0070673_100025028 3300005364 Bacteria 4386
64 Ga0070673_100074412 3300005364 Bacteria 2737
65 Ga0070673_100078360 3300005364 Bacteria 2673
66 Ga0070688_100009644 3300005365 Bacteria 5294
67 Ga0070659_100010688 3300005366 Bacteria 6762
68 Ga0070667_100040210 3300005367 Bacteria 3921
69 Ga0070667_100121522 3300005367 Bacteria 2272
70 Ga0070714_100005978 3300005435 Bacteria 9342
71 Ga0070701_10002657 3300005438 Bacteria 6929
72 Ga0070700_100001557 3300005441 Bacteria 11439
73 Ga0070694_100007042 3300005444 Bacteria 6841
74 Ga0070678_100013489 3300005456 Bacteria 5126
75 Ga0070678_100118045 3300005456 Bacteria 2087
76 Ga0070662_100045607 3300005457 Bacteria 3146
77 Ga0070662_100086660 3300005457 Bacteria 2343
78 Ga0070681_10021034 3300005458 Bacteria 6537
79 Ga0070681_10105664 3300005458 Bacteria 2758
80 Ga0068867_100131378 3300005459 Bacteria 1946
81 Ga0070685_10004412 3300005466 Bacteria 7106
82 Ga0070685_10010094 3300005466 Bacteria 4898
83 Ga0070679_100109683 3300005530 Bacteria 2746
84 Ga0070684_100012745 3300005535 Bacteria 6750
85 Ga0070684_100102751 3300005535 Bacteria 2556
86 Ga0070672_100096097 3300005543 Bacteria 2397
87 Ga0070686_100005320 3300005544 Bacteria 7121
88 Ga0070686_100046432 3300005544 Bacteria 2741
89 Ga0070696_100000013 3300005546 Bacteria 78718
90 Ga0070665_100002087 3300005548 Bacteria 22404
91 Ga0070665_100041560 3300005548 Bacteria 4622
92 Ga0070665_100124454 3300005548 Unclassified 2580
93 Ga0068855_100139220 3300005563 Bacteria 2768
94 Ga0068855_100155441 3300005563 Bacteria 2599
95 Ga0070664_100000651 3300005564 Bacteria 26520
96 Ga0068857_100013040 3300005577 Bacteria 7241
97 Ga0068856_100120658 3300005614 Bacteria 2623
98 Ga0070702_100068502 3300005615 Bacteria 2088
99 Ga0070702_100090282 3300005615 Bacteria 1857
100 Ga0068852_100029633 3300005616 Bacteria 4498
101 Ga0068864_100011396 3300005618 Bacteria 7344
102 Ga0068864_100027732 3300005618 Bacteria 4785
103 Ga0068866_10009938 3300005718 Bacteria 4060
104 Ga0068861_100002744 3300005719 Bacteria 11537
105 Ga0068861_100024260 3300005719 Bacteria 4385
106 Ga0068851_10000197 3300005834 Bacteria 29386
107 Ga0068851_10007001 3300005834 Bacteria 5171
108 Ga0068870_10013996 3300005840 Bacteria 3780
109 Ga0068863_100007312 3300005841 Bacteria 10812
110 Ga0068863_100050649 3300005841 Bacteria 3936
111 Ga0068858_100002537 3300005842 Bacteria 18405
112 Ga0068858_100014317 3300005842 Bacteria 7480
113 Ga0068858_100037191 3300005842 Bacteria 4513
114 Ga0068860_100026094 3300005843 Bacteria 5636
115 Ga0068860_100054358 3300005843 Bacteria 3806
116 Ga0068860_100069151 3300005843 Bacteria 3355
117 Ga0068862_100001151 3300005844 Bacteria 25015
118 Ga0068862_100031145 3300005844 Bacteria 4500
119 Ga0068862_100040741 3300005844 Bacteria 3948
120 Ga0068862_100043353 3300005844 Bacteria 3835
121 Ga0081540_1000663 3300005983 Bacteria 32432
122 Ga0081540_1043087 3300005983 Bacteria 2320
123 Ga0075365_10199719 3300006038 Bacteria 1400
124 Ga0075364_10016895 3300006051 Bacteria 4547
125 Ga0075432_10001028 3300006058 Bacteria 8868
126 Ga0075427_10000673 3300006194 Bacteria 4068
127 Ga0097621_100003933 3300006237 Bacteria 10292
128 Ga0075370_10139923 3300006353 Bacteria 1414
129 Ga0075430_100000332 3300006846 Bacteria 33904
130 Ga0075430_100003367 3300006846 Bacteria 13388
131 Ga0075431_100008089 3300006847 Bacteria 10498
132 Ga0075434_100000647 3300006871 Bacteria 26943
133 Ga0075429_100000296 3300006880 Bacteria 35293
134 Ga0075429_100000451 3300006880 Bacteria 30628
135 Ga0068865_100001035 3300006881 Bacteria 16020
136 Ga0068865_100034470 3300006881 Bacteria 3396
137 Ga0079104_1017736 3300006946 Bacteria 2038
138 Ga0075435_100000630 3300007076 Bacteria 21640
139 Ga0105251_10001791 3300009011 Bacteria 17849
140 Ga0105251_10002666 3300009011 Bacteria 13754
141 Ga0105251_10003271 3300009011 Bacteria 11881
142 Ga0105251_10013975 3300009011 Bacteria 4460
143 Ga0105251_10014963 3300009011 Bacteria 4259
144 Ga0105244_10000181 3300009036 Bacteria 63616
145 Ga0105244_10002140 3300009036 Bacteria 15155
146 Ga0105244_10002479 3300009036 Bacteria 13897
147 Ga0105244_10029049 3300009036 Bacteria 2960
148 Ga0105244_10041777 3300009036 Bacteria 2375
149 Ga0105244_10058508 3300009036 Bacteria 1945
150 Ga0105250_10000088 3300009092 Bacteria 80904
151 Ga0105250_10000261 3300009092 Bacteria 43192
152 Ga0105250_10009888 3300009092 Bacteria 4003
153 Ga0105240_10009287 3300009093 Bacteria 13943
154 Ga0105240_10142449 3300009093 Bacteria 2865
155 Ga0105240_10191888 3300009093 Bacteria 2401
156 Ga0111539_10002056 3300009094 Bacteria 26910
157 Ga0111539_10022347 3300009094 Bacteria 7774
158 Ga0111539_10172607 3300009094 Bacteria 2526
159 Ga0114129_10016414 3300009147 Bacteria 10538
160 Ga0114129_10189357 3300009147 Bacteria 2795
161 Ga0105243_10019654 3300009148 Bacteria 5121
162 Ga0105243_10020789 3300009148 Bacteria 4980
163 Ga0105243_10057254 3300009148 Bacteria 3103
164 Ga0105243_10070754 3300009148 Bacteria 2818
165 Ga0105243_10123536 3300009148 Bacteria 2186
166 Ga0105243_10176723 3300009148 Bacteria 1853
167 Ga0105241_10000171 3300009174 Bacteria 47968
168 Ga0105242_10003223 3300009176 Bacteria 12720
169 Ga0105238_10000865 3300009551 Bacteria 31282
170 Ga0105238_10142860 3300009551 Bacteria 2370
171 Ga0105249_10037049 3300009553 Bacteria 4426
172 Ga0105239_10008186 3300010375 Bacteria 11925
173 Ga0105246_10000174 3300011119 Bacteria 31284
174 Ga0105246_10024242 3300011119 Bacteria 3939
175 Ga0157317_1000800 3300012475 Bacteria 1517
176 Ga0157319_1000024 3300012497 Bacteria 65569
177 Ga0157373_10002145 3300013100 Bacteria 14933
178 Ga0157373_10006136 3300013100 Bacteria 8985
179 Ga0157373_10014390 3300013100 Bacteria 5800
180 Ga0157373_10036326 3300013100 Bacteria 3537
181 Ga0157371_10031143 3300013102 Bacteria 3843
182 Ga0157371_10045904 3300013102 Bacteria 3108
183 Ga0157371_10133262 3300013102 Bacteria 1768
184 Ga0157370_10009550 3300013104 Bacteria 10342
185 Ga0157370_10023529 3300013104 Bacteria 6113
186 Ga0157370_10065730 3300013104 Bacteria 3431
187 Ga0157369_10004166 3300013105 Bacteria 17134
188 Ga0157369_10028384 3300013105 Bacteria 6193
189 Ga0157369_10207891 3300013105 Bacteria 2052
190 Ga0157374_10000958 3300013296 Bacteria 25036
191 Ga0157374_10004803 3300013296 Bacteria 11342
192 Ga0157374_10051673 3300013296 Bacteria 3825
193 Ga0163162_10117349 3300013306 Bacteria 2763
194 Ga0157375_10000050 3300013308 Bacteria 134913
195 Ga0157375_10056502 3300013308 Bacteria 3875
196 Ga0157375_10267250 3300013308 Bacteria 1872
197 Ga0163163_10034762 3300014325 Bacteria 4884
198 Ga0157380_10002683 3300014326 Bacteria 12072
199 Ga0157380_10013364 3300014326 Bacteria 5984
200 Ga0157380_10018593 3300014326 Bacteria 5161
201 Ga0182008_10032776 3300014497 Bacteria 2608
202 Ga0157377_10025602 3300014745 Bacteria 3148
203 Ga0157379_10002335 3300014968 Bacteria 15815
204 Ga0157379_10010681 3300014968 Bacteria 7999
205 Ga0157379_10034552 3300014968 Bacteria 4508
206 Ga0157379_10082432 3300014968 Bacteria 2882
207 Ga0182006_1000116 3300015261 Bacteria 86100
208 Ga0182007_10000771 3300015262 Bacteria 17935
209 Ga0182005_1000003 3300015265 Bacteria 683269
210 Ga0163161_10002851 3300017792 Bacteria 12263
211 Ga0163161_10003420 3300017792 Bacteria 11129
212 Ga0163161_10081985 3300017792 Bacteria 2376
213 Ga0163161_10082863 3300017792 Bacteria 2364
214 Ga0213872_10001285 3300021361 Bacteria 16783
215 Ga0209435_103668 3300025206 Bacteria 1744
216 Ga0209784_100414 3300025224 Bacteria 19015
217 Ga0209566_100716 3300025225 Bacteria 18941
218 Ga0209674_100446 3300025226 Bacteria 19015
219 Ga0209147_100742 3300025229 Bacteria 16146
220 Ga0209563_100319 3300025230 Bacteria 19015
221 Ga0209258_100860 3300025242 Bacteria 16144
222 Ga0207425_1000346 3300025245 Bacteria 32243
223 Ga0209646_1000543 3300025246 Bacteria 16214
224 Ga0209677_100627 3300025253 Bacteria 18940
225 Ga0209759_1004314 3300025256 Bacteria 5351
226 Ga0209676_1007332 3300025292 Bacteria 5212
227 Ga0209564_1000026 3300025295 Bacteria 519154
228 Ga0209564_1000097 3300025295 Bacteria 231436
229 Ga0209758_1000314 3300025297 Bacteria 93818
230 Ga0209050_1002726 3300025298 Bacteria 14271
231 Ga0209256_1000075 3300025299 Bacteria 236149
232 Ga0209256_1001776 3300025299 Bacteria 20464
233 Ga0209051_1001190 3300025303 Bacteria 23511
234 Ga0209257_1000244 3300025304 Bacteria 126098
235 Ga0209257_1002005 3300025304 Bacteria 21776
236 Ga0207697_10003666 3300025315 Bacteria 7522
237 Ga0207656_10005798 3300025321 Bacteria 4395
238 Ga0207656_10061085 3300025321 Bacteria 1653
239 Ga0207696_1000091 3300025711 Bacteria 187999
240 Ga0207655_1000113 3300025728 Bacteria 167376
241 Ga0207655_1003222 3300025728 Bacteria 12266
242 Ga0207655_1018389 3300025728 Bacteria 3708
243 Ga0207655_1021767 3300025728 Bacteria 3240
244 Ga0207655_1027492 3300025728 Bacteria 2708
245 Ga0207713_1000432 3300025735 Bacteria 44225
246 Ga0207713_1001595 3300025735 Bacteria 17730
247 Ga0207713_1026716 3300025735 Bacteria 2638
248 Ga0207682_10000905 3300025893 Bacteria 13733
249 Ga0207642_10030927 3300025899 Bacteria 2237
250 Ga0207688_10000676 3300025901 Bacteria 16826
251 Ga0207680_10029668 3300025903 Bacteria 3076
252 Ga0207645_10000860 3300025907 Bacteria 25221
253 Ga0207645_10003294 3300025907 Bacteria 12321
254 Ga0207645_10076298 3300025907 Bacteria 2146
255 Ga0207643_10000205 3300025908 Bacteria 41221
256 Ga0207643_10046800 3300025908 Bacteria 2446
257 Ga0207705_10022392 3300025909 Bacteria 4505
258 Ga0207705_10023899 3300025909 Bacteria 4361
259 Ga0207705_10057204 3300025909 Bacteria 2813
260 Ga0207705_10147410 3300025909 Bacteria 1761
261 Ga0207654_10000134 3300025911 Bacteria 47957
262 Ga0207707_10184056 3300025912 Bacteria 1823
263 Ga0207695_10061489 3300025913 Bacteria 3881
264 Ga0207695_10135915 3300025913 Bacteria 2411
265 Ga0207660_10013510 3300025917 Bacteria 5351
266 Ga0207662_10002164 3300025918 Bacteria 9790
267 Ga0207662_10002300 3300025918 Bacteria 9566
268 Ga0207662_10027596 3300025918 Bacteria 3277
269 Ga0207662_10033083 3300025918 Bacteria 3011
270 Ga0207657_10005467 3300025919 Bacteria 13262
271 Ga0207657_10008770 3300025919 Bacteria 10236
272 Ga0207657_10010663 3300025919 Bacteria 9153
273 Ga0207652_10212463 3300025921 Bacteria 1742
274 Ga0207681_10000690 3300025923 Bacteria 22223
275 Ga0207681_10000883 3300025923 Bacteria 19643
276 Ga0207681_10045876 3300025923 Bacteria 2937
277 Ga0207681_10076723 3300025923 Bacteria 2347
278 Ga0207650_10000373 3300025925 Bacteria 42334
279 Ga0207650_10001078 3300025925 Bacteria 20212
280 Ga0207650_10009278 3300025925 Bacteria 6722
281 Ga0207659_10019339 3300025926 Bacteria 4481
282 Ga0207664_10015167 3300025929 Bacteria 5584
283 Ga0207644_10054444 3300025931 Bacteria 2881
284 Ga0207644_10080072 3300025931 Bacteria 2412
285 Ga0207644_10177020 3300025931 Bacteria 1669
286 Ga0207690_10003250 3300025932 Bacteria 9750
287 Ga0207706_10000618 3300025933 Bacteria 37720
288 Ga0207706_10000935 3300025933 Bacteria 29879
289 Ga0207706_10088459 3300025933 Bacteria 2723
290 Ga0207706_10119314 3300025933 Bacteria 2319
291 Ga0207686_10003655 3300025934 Bacteria 8241
292 Ga0207709_10006905 3300025935 Bacteria 6353
293 Ga0207709_10013101 3300025935 Bacteria 4571
294 Ga0207709_10022219 3300025935 Bacteria 3597
295 Ga0207709_10034258 3300025935 Bacteria 2992
296 Ga0207670_10007157 3300025936 Bacteria 6218
297 Ga0207670_10016919 3300025936 Bacteria 4396
298 Ga0207669_10005612 3300025937 Bacteria 5649
299 Ga0207669_10013934 3300025937 Bacteria 4014
300 Ga0207704_10001205 3300025938 Bacteria 11527
301 Ga0207704_10046148 3300025938 Bacteria 2594
302 Ga0207691_10025775 3300025940 Bacteria 5518
303 Ga0207691_10040837 3300025940 Bacteria 4286
304 Ga0207691_10063173 3300025940 Bacteria 3359
305 Ga0207691_10152739 3300025940 Bacteria 2029
306 Ga0207711_10036064 3300025941 Bacteria 4195
307 Ga0207711_10105405 3300025941 Bacteria 2500
308 Ga0207689_10000451 3300025942 Bacteria 38688
309 Ga0207689_10001368 3300025942 Bacteria 23383
310 Ga0207661_10066704 3300025944 Bacteria 2924
311 Ga0207651_10009135 3300025960 Bacteria 5401
312 Ga0207651_10073619 3300025960 Bacteria 2429
313 Ga0207712_10052028 3300025961 Bacteria 2867
314 Ga0207668_10015582 3300025972 Bacteria 4725
315 Ga0207668_10018685 3300025972 Bacteria 4369
316 Ga0207658_10023813 3300025986 Bacteria 4278
317 Ga0207703_10026738 3300026035 Bacteria 4545
318 Ga0207703_10047521 3300026035 Bacteria 3461
319 Ga0207703_10062701 3300026035 Bacteria 3045
320 Ga0207703_10229393 3300026035 Bacteria 1664
321 Ga0207639_10022982 3300026041 Bacteria 4496
322 Ga0207639_10232614 3300026041 Bacteria 1598
323 Ga0207678_10132975 3300026067 Bacteria 2122
324 Ga0207708_10000114 3300026075 Bacteria 61971
325 Ga0207708_10000557 3300026075 Bacteria 28820
326 Ga0207708_10003529 3300026075 Bacteria 11520
327 Ga0207708_10004301 3300026075 Bacteria 10482
328 Ga0207641_10032348 3300026088 Bacteria 4342
329 Ga0207641_10112818 3300026088 Bacteria 2412
330 Ga0207641_10220374 3300026088 Bacteria 1759
331 Ga0207648_10001471 3300026089 Bacteria 25924
332 Ga0207648_10026748 3300026089 Bacteria 5124
333 Ga0207648_10028967 3300026089 Bacteria 4909
334 Ga0207648_10073941 3300026089 Bacteria 2970
335 Ga0207676_10025509 3300026095 Bacteria 4385
336 Ga0207676_10025835 3300026095 Bacteria 4360
337 Ga0207674_10099881 3300026116 Bacteria 2884
338 Ga0207675_100001090 3300026118 Bacteria 26881
339 Ga0207675_100003064 3300026118 Bacteria 16393
340 Ga0207675_100003701 3300026118 Bacteria 14900
341 Ga0207675_100009061 3300026118 Bacteria 9339
342 Ga0207683_10011402 3300026121 Bacteria 7585
343 Ga0207698_10035718 3300026142 Bacteria 3639
344 Ga0207698_10051297 3300026142 Bacteria 3153
345 Ga0207698_10192873 3300026142 Bacteria 1817
346 Ga0209281_1007615 3300027111 Bacteria 2705
347 Ga0207428_10000180 3300027907 Bacteria 88557
348 Ga0207428_10063229 3300027907 Bacteria 2924
349 Ga0207428_10119781 3300027907 Bacteria 2019
350 Ga0268266_10069528 3300028379 Bacteria 3050
351 Ga0268265_10000621 3300028380 Bacteria 35352
352 Ga0268265_10128985 3300028380 Bacteria 2098
353 Ga0268264_10097899 3300028381 Bacteria 2543
354 Ga0265336_10000039 3300028666 Bacteria 149376
355 Ga0265324_10000223 3300029957 Bacteria 43654
356 Ga0265328_10002757 3300031239 Bacteria 7861
357 Ga0307513_10000066 3300031456 Bacteria 141617
358 Ga0307513_10019665 3300031456 Bacteria 8032
359 Ga0307509_10002265 3300031507 Bacteria 31503
360 Ga0307508_10117654 3300031616 Bacteria 2259
361 Ga0307516_10029384 3300031730 Bacteria 5557
362 Ga0307405_10000054 3300031731 Bacteria 58365
363 Ga0307413_10054238 3300031824 Bacteria 2431
364 Ga0307410_10028059 3300031852 Bacteria 3566
365 Ga0307410_10152065 3300031852 Bacteria 1724
366 Ga0307410_10187076 3300031852 Bacteria 1572
367 Ga0307406_10083892 3300031901 Bacteria 2126
368 Ga0307412_10060034 3300031911 Bacteria 2551
369 Ga0307409_100011300 3300031995 Bacteria 5618
370 Ga0307409_100129374 3300031995 Bacteria 2154
371 Ga0307409_100238299 3300031995 Bacteria 1654
372 Ga0307416_100110227 3300032002 Bacteria 2423
373 Ga0307414_10011556 3300032004 Bacteria 5183
374 Ga0307414_10061929 3300032004 Bacteria 2652
375 Ga0307411_10001564 3300032005 Bacteria 9479
376 Ga0307510_10008623 3300033180 Bacteria 12150
377 Ga0373944_0019089 3300035089 Bacteria 1965
378 Ga0373949_0020485 3300035090 Bacteria 1514
379 Ga0373941_0019456 3300035115 Bacteria 1891
380 Ga0373943_0023996 3300035170 Bacteria 2841
381 Ga0373943_0037106 3300035170 Bacteria 2338
382 Ga0373947_0007862 3300035725 Bacteria 6157
383 Ga0373947_0164796 3300035725 Bacteria 1435
384 Ga0395905_0019451 3300037471 Bacteria 6437
385 Ga0395905_0081841 3300037471 Bacteria 3026
386 Ga0436361_0165235 3300039447 Bacteria 5547
387 Ga0436361_0303811 3300039447 Bacteria 2268
388 Ga0436361_1035230 3300039447 Bacteria 5145
389 Ga0436362_0866046 3300039453 Bacteria 2229
390 Ga0439466_0053396 3300041411 Bacteria 1318
391 Ga0439462_0020776 3300042015 Bacteria 1713
392 Ga0450913_000144 3300042117 Bacteria 2203
393 Ga0450923_003832 3300042125 Bacteria 2311
394 Ga0450904_000412 3300042139 Bacteria 8738
395 Ga0439446_0008790 3300042156 Bacteria 2691
396 Ga0439446_0018222 3300042156 Bacteria 1965
397 Ga0439434_0004984 3300042435 Bacteria 3880
398 Ga0439459_0007697 3300042438 Bacteria 1825
399 Ga0450918_003841 3300042531 Bacteria 2768
400 Ga0451577_0181761 3300042876 Bacteria 1896
401 Ga0466963_0113030 3300044694 Bacteria 1865
402 Ga0451576_0000220 3300045051 Bacteria 141261
403 Ga0451576_0011312 3300045051 Bacteria 10154
404 Ga0495627_000530 3300046453 Bacteria 31551
405 Ga0495627_000888 3300046453 Bacteria 20978
406 Ga0495592_0053899 3300046454 Bacteria 2981
407 Ga0495591_000529 3300046458 Bacteria 29837
408 Ga0495638_0001443 3300046460 Bacteria 21511
409 Ga0495638_0003221 3300046460 Bacteria 12910
410 Ga0495638_0005791 3300046460 Bacteria 9094
411 Ga0495638_0011834 3300046460 Bacteria 6003
412 Ga0495638_0091408 3300046460 Bacteria 1833
413 Ga0495653_0009457 3300046463 Bacteria 7975
414 Ga0495650_0002849 3300046471 Bacteria 13231
415 Ga0495650_0003122 3300046471 Bacteria 12416
416 Ga0495580_0001063 3300046472 Bacteria 24156
417 Ga0495605_0017853 3300046474 Bacteria 3812
418 Ga0495605_0025507 3300046474 Bacteria 3080
419 Ga0495584_0000875 3300046491 Bacteria 19432
420 Ga0495585_0001381 3300046492 Bacteria 19179
421 Ga0495596_0002737 3300046500 Bacteria 9261
422 Ga0495607_0002057 3300046501 Bacteria 16829
423 Ga0495607_0008751 3300046501 Bacteria 6896
424 Ga0495607_0010963 3300046501 Bacteria 6062
425 Ga0495583_0001527 3300046506 Bacteria 22952
426 Ga0495583_0005777 3300046506 Bacteria 8273
427 Ga0495606_0000725 3300046507 Bacteria 50954
428 Ga0495606_0004441 3300046507 Bacteria 14017
429 Ga0495606_0009506 3300046507 Bacteria 8212
430 Ga0495610_0000021 3300046512 Bacteria 336300
431 Ga0495610_0001114 3300046512 Bacteria 24484
432 Ga0495610_0008547 3300046512 Bacteria 6609
433 Ga0495610_0030819 3300046512 Bacteria 2804
434 Ga0495620_0000224 3300046515 Bacteria 42576
435 Ga0495630_0087358 3300046517 Bacteria 2355
436 Ga0495631_0006268 3300046518 Bacteria 6158
437 Ga0495632_0000275 3300046519 Bacteria 50568
438 Ga0495632_0003902 3300046519 Bacteria 10361
439 Ga0495632_0006116 3300046519 Bacteria 7803
440 Ga0495632_0008775 3300046519 Bacteria 6159
441 Ga0495632_0062559 3300046519 Bacteria 1804
442 Ga0495637_0000057 3300046520 Bacteria 97433
443 Ga0495637_0005703 3300046520 Bacteria 6314
444 Ga0495637_0038642 3300046520 Bacteria 2065
445 Ga0495654_0000005 3300046530 Bacteria 491381
446 Ga0495654_0001418 3300046530 Bacteria 16564
447 Ga0495609_0002721 3300046538 Bacteria 10667
448 Ga0495621_0003116 3300046539 Bacteria 4537
449 Ga0495621_0012488 3300046539 Bacteria 2649
450 Ga0495633_0000587 3300046558 Bacteria 35276
451 Ga0495656_0000940 3300046615 Bacteria 9423
452 Ga0495668_0000008 3300046616 Bacteria 498364
453 Ga0495668_0012451 3300046616 Bacteria 5043
454 Ga0495668_0061189 3300046616 Bacteria 2077
455 Ga0495625_0002093 3300046660 Bacteria 22302
456 Ga0495625_0006426 3300046660 Bacteria 10463
457 Ga0495625_0035111 3300046660 Bacteria 3697
458 Ga0495659_0003719 3300046664 Bacteria 4851
459 Ga0495661_0000150 3300046665 Bacteria 81419
460 Ga0495661_0000193 3300046665 Bacteria 70300
461 Ga0495661_0000698 3300046665 Bacteria 33395
462 Ga0495661_0000780 3300046665 Bacteria 30377
463 Ga0495661_0003350 3300046665 Bacteria 11878
464 Ga0495647_0003356 3300046681 Bacteria 5129
465 Ga0495658_0035972 3300046683 Bacteria 2729
466 Ga0495669_0002301 3300046684 Bacteria 7829
467 Ga0495671_0002178 3300046692 Bacteria 12484
468 Ga0495649_0001376 3300046694 Bacteria 18410
469 Ga0495649_0003451 3300046694 Bacteria 10654
470 Ga0495649_0007309 3300046694 Bacteria 6750
471 Ga0495589_0000490 3300046794 Bacteria 28284
472 Ga0495660_0000072 3300046810 Bacteria 109692
473 Ga0495660_0044433 3300046810 Bacteria 2444
474 Ga0495660_0047438 3300046810 Bacteria 2352
475 Ga0495636_0006614 3300047318 Bacteria 4557
476 Ga0495672_0000014 3300047320 Bacteria 505636
477 Ga0495672_0003595 3300047320 Bacteria 13168
478 Ga0495676_0001551 3300047321 Bacteria 19928
479 Ga0495683_0001223 3300047323 Bacteria 17497
480 Ga0495687_014395 3300047443 Bacteria 4076
481 Ga0495679_000226 3300047446 Bacteria 47732
482 Ga0495679_010966 3300047446 Bacteria 3526
483 Ga0495685_007440 3300047447 Bacteria 3615
484 Ga0495673_0000033 3300047469 Bacteria 354152
485 Ga0495673_0004969 3300047469 Bacteria 8178
486 Ga0495681_0004774 3300047470 Bacteria 9180
487 Ga0495681_0059744 3300047470 Bacteria 1761
488 Ga0495686_0000075 3300047472 Bacteria 208031
489 Ga0495686_0001396 3300047472 Bacteria 26729
490 Ga0495686_0032698 3300047472 Bacteria 3364
491 Ga0495626_0000796 3300048091 Bacteria 28573
492 Ga0496102_0089208 3300048905 Bacteria 2852
493 Ga0496104_0015068 3300048907 Bacteria 6997
494 Ga0496105_0007157 3300048908 Bacteria 8610
495 Ga0496106_0032321 3300048909 Bacteria 3901
496 Ga0496108_0013198 3300048911 Bacteria 6733
497 Ga0496109_0012841 3300048912 Bacteria 7239
498 Ga0496110_0006943 3300048913 Bacteria 9006
499 Ga0496110_0197765 3300048913 Bacteria 1826
500 Ga0496112_0093879 3300048915 Bacteria 2970
501 Ga0496117_0000597 3300048920 Bacteria 59321
502 Ga0496117_0073991 3300048920 Bacteria 2270
503 Ga0496118_0014825 3300048921 Bacteria 7268
504 Ga0496118_0016520 3300048921 Bacteria 6768
505 Ga0496120_0007305 3300048923 Bacteria 8248
506 Ga0496120_0111207 3300048923 Bacteria 1431
507 Ga0496121_0028522 3300048924 Bacteria 5193
508 Ga0496122_0040668 3300048925 Bacteria 3689
509 Ga0496123_0001590 3300048926 Bacteria 30876
510 Ga0496123_0037309 3300048926 Bacteria 3432
511 Ga0496124_0001080 3300048927 Bacteria 43080
512 Ga0496124_0015231 3300048927 Bacteria 7380
513 Ga0496124_0044863 3300048927 Bacteria 3791
514 Ga0496124_0158316 3300048927 Bacteria 1768
515 Ga0496125_0000465 3300048928 Bacteria 72631
516 Ga0496125_0010799 3300048928 Bacteria 9196
517 Ga0496125_0019156 3300048928 Bacteria 6468
518 Ga0496125_0023871 3300048928 Bacteria 5634
519 Ga0496125_0036515 3300048928 Bacteria 4288
520 Ga0496126_0005176 3300048929 Bacteria 15077
521 Ga0496126_0005612 3300048929 Bacteria 14267
522 Ga0496126_0092616 3300048929 Bacteria 2655
523 Ga0495678_021657 3300049459 Bacteria 2826
524 Ga0495682_0000234 3300049460 Bacteria 43711
525 Ga0501033_0140251 3300049570 Bacteria 1748
526 Ga0501036_0113813 3300049572 Bacteria 2286
527 Ga0501038_0071930 3300049574 Bacteria 2932
528 Ga0501042_0022237 3300049578 Bacteria 4430
529 Ga0501046_0048746 3300049580 Bacteria 3353
530 Ga0501048_0117177 3300049582 Bacteria 1881
531 Ga0501068_0125863 3300049584 Bacteria 1600
532 Ga0501070_0087678 3300049586 Bacteria 2576
533 Ga0501071_0006469 3300049587 Bacteria 7603
534 Ga0501072_0009204 3300049588 Bacteria 7502
535 Ga0501073_0242638 3300049589 Bacteria 1244
536 Ga0501074_0081114 3300049590 Bacteria 2326
537 Ga0501076_0007362 3300049592 Bacteria 8008
538 Ga0501077_0024467 3300049593 Bacteria 3835
539 Ga0501079_0020373 3300049741 Bacteria 5068
540 Ga0501081_0046870 3300049743 Bacteria 2972
541 Ga0501269_000526 3300049766 Bacteria 7696
542 Ga0501045_0013719 3300049824 Bacteria 5728
543 nmdc:mga00v17_103677_c1 3300050491 Bacteria 1798
544 nmdc:mga0yw44_18038_c1 3300050492 Bacteria 3857
545 nmdc:mga0k408_26218_c1 3300050493 Bacteria 3303
546 nmdc:mga0k408_68597_c1 3300050493 Bacteria 2069
547 nmdc:mga07m45_73054_c1 3300050496 Bacteria 1953
548 nmdc:mga05p37_863_c1 3300050507 Bacteria 34108
549 nmdc:mga09592_15927_c1 3300050508 Bacteria 6143
550 nmdc:mga09592_436_c1 3300050508 Bacteria 30720
551 nmdc:mga0qj67_1189_c1 3300050509 Bacteria 18042
552 nmdc:mga0qj67_3156_c1 3300050509 Bacteria 11863
553 nmdc:mga06r32_7419_c1 3300050510 Bacteria 9864
554 nmdc:mga08y16_132262_c1 3300050511 Bacteria 2594
555 nmdc:mga08y16_15204_c1 3300050511 Bacteria 8095
556 nmdc:mga08y16_156910_c1 3300050511 Bacteria 2365
557 nmdc:mga08y16_83618_c1 3300050511 Bacteria 3327
558 nmdc:mga0n895_427_c1 3300050512 Bacteria 28261
559 nmdc:mga0rr50_2839_c1 3300050513 Bacteria 9853
560 nmdc:mga0a205_1001_c1 3300050515 Bacteria 23411
561 Ga0500635_0000449 3300053080 Bacteria 11894
562 Ga0500643_000169 3300053087 Bacteria 64699
563 Ga0500608_000123 3300053122 Bacteria 32276
564 Ga0500618_000601 3300053125 Bacteria 22092
565 Ga0500618_013509 3300053125 Bacteria 2106
566 Ga0500559_0000954 3300053136 Bacteria 18188
567 Ga0500577_0000079 3300053142 Bacteria 22454
568 Ga0500604_0020364 3300053151 Bacteria 1867
569 Ga0500622_0003490 3300053156 Bacteria 10437
570 Ga0500645_010478 3300053730 Bacteria 3064
571 Ga0501082_0010412 3300060353 Bacteria 8005
572 Ga0501082_0023373 3300060353 Bacteria 5332
573 Ga0501082_0257624 3300060353 Bacteria 1518
574 2513912122 2513237144 Bacteria 7530820
575 2513924029 2513237146 Bacteria 7166346
576 2597859534 2597489887 Bacteria 6666321
577 2599416073 2599185170 Bacteria 7295545
578 2643865711 2643221570 Bacteria 5103772
579 2643894702 2643221577 Bacteria 3710843
580 2644085854 2643221614 Bacteria 4260023
581 2644294411 2643221652 Bacteria 5140275
582 2644344970 2643221661 Bacteria 4267604
583 2644369244 2643221666 Bacteria 4265935
584 2644476851 2643221685 Bacteria 3673288
585 2838036195 2838035591 Bacteria 7166484
586 2838077047 2838074704 Bacteria 6785777
587 2838666466 2838661181 Bacteria 7385261
588 2842807655 2842805378 Bacteria 5385175
589 2857566204 2857564685 Bacteria 6290584
590 2876812346 2876808645 Bacteria 8824342
591 2879118308 2879110137 Bacteria 8907982
592 2886854934 2886848708 Bacteria 5632523
593 2896385849 2896384573 Bacteria 7700774
594 2920761782 2920760137 Bacteria 7427611
595 2928975396 2928972540 Bacteria 3058286
596 3005413418 3005409236 Bacteria 7188837
597 3007424613 3007419365 Bacteria 7026924
598 639787302 639633007 Bacteria 4376040
599 640487051 640427133 Bacteria 4567418
600 651174924 651053060 Bacteria 4689946
601 Ga0501080_0187434
602 JGI24743J22301_10011591
603 JGI25159J45721_1003747
604 JGI25153J46596_10028772
605 rootL2_10000892
606 rootH1_10019014
607 JGI25404J52841_10006004
608 Ga0055538_1000886
609 Ga0055539_1000794
610 Ga0055533_1001148
611 Ga0055532_1001240
612 Ga0055525_1001003
613 Ga0055526_1000052
614 Ga0055524_1000117
615 Ga0055524_1012896
616 Ga0055531_10004923
617 Ga0055531_10005573
618 Ga0055541_1000846
619 Ga0055543_1005977
620 Ga0065165_1000059
621 Ga0065165_1000099
622 Ga0065165_1000378
623 Ga0065165_1000598
624 Ga0065714_10004818
625 Ga0065712_10067802
626 Ga0065715_10097283
627 Ga0070658_10016477
628 Ga0070676_10013640
629 Ga0070676_10067197
630 Ga0070683_100042465
631 Ga0070670_100000155
632 Ga0070670_100008834
633 Ga0070670_100030930
634 Ga0070670_100127424
635 Ga0070666_10010244
636 Ga0070680_100007963
637 Ga0070680_100162156
638 Ga0070680_100183242
639 Ga0070682_100027876
640 Ga0070682_100046482
641 Ga0068868_100127726
642 Ga0070660_100006633
643 Ga0070689_100028511
644 Ga0070689_100035468
645 Ga0070691_10002047
646 Ga0070691_10007419
647 Ga0070687_100000955
648 Ga0070687_100034798
649 Ga0070687_100039170
650 Ga0070687_100053725
651 Ga0070661_100008546
652 Ga0070692_10001360
653 Ga0070692_10025118
654 Ga0070668_100024477
655 Ga0070668_100026469
656 Ga0070669_100001083
657 Ga0070669_100010755
658 Ga0070669_100026167
659 Ga0070669_100049063
660 Ga0070671_100110412
661 Ga0070674_100034832
662 Ga0070674_100044169
663 Ga0070673_100025028
664 Ga0070673_100074412
665 Ga0070673_100078360
666 Ga0070688_100009644
667 Ga0070659_100010688
668 Ga0070667_100040210
669 Ga0070667_100121522
670 Ga0070714_100005978
671 Ga0070701_10002657
672 Ga0070700_100001557
673 Ga0070694_100007042
674 Ga0070678_100013489
675 Ga0070678_100118045
676 Ga0070662_100045607
677 Ga0070662_100086660
678 Ga0070681_10021034
679 Ga0070681_10105664
680 Ga0068867_100131378
681 Ga0070685_10004412
682 Ga0070685_10010094
683 Ga0070679_100109683
684 Ga0070684_100012745
685 Ga0070684_100102751
686 Ga0070672_100096097
687 Ga0070686_100005320
688 Ga0070686_100046432
689 Ga0070696_100000013
690 Ga0070665_100002087
691 Ga0070665_100041560
692 Ga0070665_100124454
693 Ga0068855_100139220
694 Ga0068855_100155441
695 Ga0070664_100000651
696 Ga0068857_100013040
697 Ga0068856_100120658
698 Ga0070702_100068502
699 Ga0070702_100090282
700 Ga0068852_100029633
701 Ga0068864_100011396
702 Ga0068864_100027732
703 Ga0068866_10009938
704 Ga0068861_100002744
705 Ga0068861_100024260
706 Ga0068851_10000197
707 Ga0068851_10007001
708 Ga0068870_10013996
709 Ga0068863_100007312
710 Ga0068863_100050649
711 Ga0068858_100002537
712 Ga0068858_100014317
713 Ga0068858_100037191
714 Ga0068860_100026094
715 Ga0068860_100054358
716 Ga0068860_100069151
717 Ga0068862_100001151
718 Ga0068862_100031145
719 Ga0068862_100040741
720 Ga0068862_100043353
721 Ga0081540_1000663
722 Ga0081540_1043087
723 Ga0075365_10199719
724 Ga0075364_10016895
725 Ga0075432_10001028
726 Ga0075427_10000673
727 Ga0097621_100003933
728 Ga0075370_10139923
729 Ga0075430_100000332
730 Ga0075430_100003367
731 Ga0075431_100008089
732 Ga0075434_100000647
733 Ga0075429_100000296
734 Ga0075429_100000451
735 Ga0068865_100001035
736 Ga0068865_100034470
737 Ga0079104_1017736
738 Ga0075435_100000630
739 Ga0105251_10001791
740 Ga0105251_10002666
741 Ga0105251_10003271
742 Ga0105251_10013975
743 Ga0105251_10014963
744 Ga0105244_10000181
745 Ga0105244_10002140
746 Ga0105244_10002479
747 Ga0105244_10029049
748 Ga0105244_10041777
749 Ga0105244_10058508
750 Ga0105250_10000088
751 Ga0105250_10000261
752 Ga0105250_10009888
753 Ga0105240_10009287
754 Ga0105240_10142449
755 Ga0105240_10191888
756 Ga0111539_10002056
757 Ga0111539_10022347
758 Ga0111539_10172607
759 Ga0114129_10016414
760 Ga0114129_10189357
761 Ga0105243_10019654
762 Ga0105243_10020789
763 Ga0105243_10057254
764 Ga0105243_10070754
765 Ga0105243_10123536
766 Ga0105243_10176723
767 Ga0105241_10000171
768 Ga0105242_10003223
769 Ga0105238_10000865
770 Ga0105238_10142860
771 Ga0105249_10037049
772 Ga0105239_10008186
773 Ga0105246_10000174
774 Ga0105246_10024242
775 Ga0157317_1000800
776 Ga0157319_1000024
777 Ga0157373_10002145
778 Ga0157373_10006136
779 Ga0157373_10014390
780 Ga0157373_10036326
781 Ga0157371_10031143
782 Ga0157371_10045904
783 Ga0157371_10133262
784 Ga0157370_10009550
785 Ga0157370_10023529
786 Ga0157370_10065730
787 Ga0157369_10004166
788 Ga0157369_10028384
789 Ga0157369_10207891
790 Ga0157374_10000958
791 Ga0157374_10004803
792 Ga0157374_10051673
793 Ga0163162_10117349
794 Ga0157375_10000050
795 Ga0157375_10056502
796 Ga0157375_10267250
797 Ga0163163_10034762
798 Ga0157380_10002683
799 Ga0157380_10013364
800 Ga0157380_10018593
801 Ga0182008_10032776
802 Ga0157377_10025602
803 Ga0157379_10002335
804 Ga0157379_10010681
805 Ga0157379_10034552
806 Ga0157379_10082432
807 Ga0182006_1000116
808 Ga0182007_10000771
809 Ga0182005_1000003
810 Ga0163161_10002851
811 Ga0163161_10003420
812 Ga0163161_10081985
813 Ga0163161_10082863
814 Ga0213872_10001285
815 Ga0209435_103668
816 Ga0209784_100414
817 Ga0209566_100716
818 Ga0209674_100446
819 Ga0209147_100742
820 Ga0209563_100319
821 Ga0209258_100860
822 Ga0207425_1000346
823 Ga0209646_1000543
824 Ga0209677_100627
825 Ga0209759_1004314
826 Ga0209676_1007332
827 Ga0209564_1000026
828 Ga0209564_1000097
829 Ga0209758_1000314
830 Ga0209050_1002726
831 Ga0209256_1000075
832 Ga0209256_1001776
833 Ga0209051_1001190
834 Ga0209257_1000244
835 Ga0209257_1002005
836 Ga0207697_10003666
837 Ga0207656_10005798
838 Ga0207656_10061085
839 Ga0207696_1000091
840 Ga0207655_1000113
841 Ga0207655_1003222
842 Ga0207655_1018389
843 Ga0207655_1021767
844 Ga0207655_1027492
845 Ga0207713_1000432
846 Ga0207713_1001595
847 Ga0207713_1026716
848 Ga0207682_10000905
849 Ga0207642_10030927
850 Ga0207688_10000676
851 Ga0207680_10029668
852 Ga0207645_10000860
853 Ga0207645_10003294
854 Ga0207645_10076298
855 Ga0207643_10000205
856 Ga0207643_10046800
857 Ga0207705_10022392
858 Ga0207705_10023899
859 Ga0207705_10057204
860 Ga0207705_10147410
861 Ga0207654_10000134
862 Ga0207707_10184056
863 Ga0207695_10061489
864 Ga0207695_10135915
865 Ga0207660_10013510
866 Ga0207662_10002164
867 Ga0207662_10002300
868 Ga0207662_10027596
869 Ga0207662_10033083
870 Ga0207657_10005467
871 Ga0207657_10008770
872 Ga0207657_10010663
873 Ga0207652_10212463
874 Ga0207681_10000690
875 Ga0207681_10000883
876 Ga0207681_10045876
877 Ga0207681_10076723
878 Ga0207650_10000373
879 Ga0207650_10001078
880 Ga0207650_10009278
881 Ga0207659_10019339
882 Ga0207664_10015167
883 Ga0207644_10054444
884 Ga0207644_10080072
885 Ga0207644_10177020
886 Ga0207690_10003250
887 Ga0207706_10000618
888 Ga0207706_10000935
889 Ga0207706_10088459
890 Ga0207706_10119314
891 Ga0207686_10003655
892 Ga0207709_10006905
893 Ga0207709_10013101
894 Ga0207709_10022219
895 Ga0207709_10034258
896 Ga0207670_10007157
897 Ga0207670_10016919
898 Ga0207669_10005612
899 Ga0207669_10013934
900 Ga0207704_10001205
901 Ga0207704_10046148
902 Ga0207691_10025775
903 Ga0207691_10040837
904 Ga0207691_10063173
905 Ga0207691_10152739
906 Ga0207711_10036064
907 Ga0207711_10105405
908 Ga0207689_10000451
909 Ga0207689_10001368
910 Ga0207661_10066704
911 Ga0207651_10009135
912 Ga0207651_10073619
913 Ga0207712_10052028
914 Ga0207668_10015582
915 Ga0207668_10018685
916 Ga0207658_10023813
917 Ga0207703_10026738
918 Ga0207703_10047521
919 Ga0207703_10062701
920 Ga0207703_10229393
921 Ga0207639_10022982
922 Ga0207639_10232614
923 Ga0207678_10132975
924 Ga0207708_10000114
925 Ga0207708_10000557
926 Ga0207708_10003529
927 Ga0207708_10004301
928 Ga0207641_10032348
929 Ga0207641_10112818
930 Ga0207641_10220374
931 Ga0207648_10001471
932 Ga0207648_10026748
933 Ga0207648_10028967
934 Ga0207648_10073941
935 Ga0207676_10025509
936 Ga0207676_10025835
937 Ga0207674_10099881
938 Ga0207675_100001090
939 Ga0207675_100003064
940 Ga0207675_100003701
941 Ga0207675_100009061
942 Ga0207683_10011402
943 Ga0207698_10035718
944 Ga0207698_10051297
945 Ga0207698_10192873
946 Ga0209281_1007615
947 Ga0207428_10000180
948 Ga0207428_10063229
949 Ga0207428_10119781
950 Ga0268266_10069528
951 Ga0268265_10000621
952 Ga0268265_10128985
953 Ga0268264_10097899
954 Ga0265336_10000039
955 Ga0265324_10000223
956 Ga0265328_10002757
957 Ga0307513_10000066
958 Ga0307513_10019665
959 Ga0307509_10002265
960 Ga0307508_10117654
961 Ga0307516_10029384
962 Ga0307405_10000054
963 Ga0307413_10054238
964 Ga0307410_10028059
965 Ga0307410_10152065
966 Ga0307410_10187076
967 Ga0307406_10083892
968 Ga0307412_10060034
969 Ga0307409_100011300
970 Ga0307409_100129374
971 Ga0307409_100238299
972 Ga0307416_100110227
973 Ga0307414_10011556
974 Ga0307414_10061929
975 Ga0307411_10001564
976 Ga0307510_10008623
977 Ga0373944_0019089
978 Ga0373949_0020485
979 Ga0373941_0019456
980 Ga0373943_0023996
981 Ga0373943_0037106
982 Ga0373947_0007862
983 Ga0373947_0164796
984 Ga0395905_0019451
985 Ga0395905_0081841
986 Ga0436361_0165235
987 Ga0436361_0303811
988 Ga0436361_1035230
989 Ga0436362_0866046
990 Ga0439466_0053396
991 Ga0439462_0020776
992 Ga0450913_000144
993 Ga0450923_003832
994 Ga0450904_000412
995 Ga0439446_0008790
996 Ga0439446_0018222
997 Ga0439434_0004984
998 Ga0439459_0007697
999 Ga0450918_003841
1000 Ga0451577_0181761
1001 Ga0466963_0113030
1002 Ga0451576_0000220
1003 Ga0451576_0011312
1004 Ga0495627_000530
1005 Ga0495627_000888
1006 Ga0495592_0053899
1007 Ga0495591_000529
1008 Ga0495638_0001443
1009 Ga0495638_0003221
1010 Ga0495638_0005791
1011 Ga0495638_0011834
1012 Ga0495638_0091408
1013 Ga0495653_0009457
1014 Ga0495650_0002849
1015 Ga0495650_0003122
1016 Ga0495580_0001063
1017 Ga0495605_0017853
1018 Ga0495605_0025507
1019 Ga0495584_0000875
1020 Ga0495585_0001381
1021 Ga0495596_0002737
1022 Ga0495607_0002057
1023 Ga0495607_0008751
1024 Ga0495607_0010963
1025 Ga0495583_0001527
1026 Ga0495583_0005777
1027 Ga0495606_0000725
1028 Ga0495606_0004441
1029 Ga0495606_0009506
1030 Ga0495610_0000021
1031 Ga0495610_0001114
1032 Ga0495610_0008547
1033 Ga0495610_0030819
1034 Ga0495620_0000224
1035 Ga0495630_0087358
1036 Ga0495631_0006268
1037 Ga0495632_0000275
1038 Ga0495632_0003902
1039 Ga0495632_0006116
1040 Ga0495632_0008775
1041 Ga0495632_0062559
1042 Ga0495637_0000057
1043 Ga0495637_0005703
1044 Ga0495637_0038642
1045 Ga0495654_0000005
1046 Ga0495654_0001418
1047 Ga0495609_0002721
1048 Ga0495621_0003116
1049 Ga0495621_0012488
1050 Ga0495633_0000587
1051 Ga0495656_0000940
1052 Ga0495668_0000008
1053 Ga0495668_0012451
1054 Ga0495668_0061189
1055 Ga0495625_0002093
1056 Ga0495625_0006426
1057 Ga0495625_0035111
1058 Ga0495659_0003719
1059 Ga0495661_0000150
1060 Ga0495661_0000193
1061 Ga0495661_0000698
1062 Ga0495661_0000780
1063 Ga0495661_0003350
1064 Ga0495647_0003356
1065 Ga0495658_0035972
1066 Ga0495669_0002301
1067 Ga0495671_0002178
1068 Ga0495649_0001376
1069 Ga0495649_0003451
1070 Ga0495649_0007309
1071 Ga0495589_0000490
1072 Ga0495660_0000072
1073 Ga0495660_0044433
1074 Ga0495660_0047438
1075 Ga0495636_0006614
1076 Ga0495672_0000014
1077 Ga0495672_0003595
1078 Ga0495676_0001551
1079 Ga0495683_0001223
1080 Ga0495687_014395
1081 Ga0495679_000226
1082 Ga0495679_010966
1083 Ga0495685_007440
1084 Ga0495673_0000033
1085 Ga0495673_0004969
1086 Ga0495681_0004774
1087 Ga0495681_0059744
1088 Ga0495686_0000075
1089 Ga0495686_0001396
1090 Ga0495686_0032698
1091 Ga0495626_0000796
1092 Ga0496102_0089208
1093 Ga0496104_0015068
1094 Ga0496105_0007157
1095 Ga0496106_0032321
1096 Ga0496108_0013198
1097 Ga0496109_0012841
1098 Ga0496110_0006943
1099 Ga0496110_0197765
1100 Ga0496112_0093879
1101 Ga0496117_0000597
1102 Ga0496117_0073991
1103 Ga0496118_0014825
1104 Ga0496118_0016520
1105 Ga0496120_0007305
1106 Ga0496120_0111207
1107 Ga0496121_0028522
1108 Ga0496122_0040668
1109 Ga0496123_0001590
1110 Ga0496123_0037309
1111 Ga0496124_0001080
1112 Ga0496124_0015231
1113 Ga0496124_0044863
1114 Ga0496124_0158316
1115 Ga0496125_0000465
1116 Ga0496125_0010799
1117 Ga0496125_0019156
1118 Ga0496125_0023871
1119 Ga0496125_0036515
1120 Ga0496126_0005176
1121 Ga0496126_0005612
1122 Ga0496126_0092616
1123 Ga0495678_021657
1124 Ga0495682_0000234
1125 Ga0501033_0140251
1126 Ga0501036_0113813
1127 Ga0501038_0071930
1128 Ga0501042_0022237
1129 Ga0501046_0048746
1130 Ga0501048_0117177
1131 Ga0501068_0125863
1132 Ga0501070_0087678
1133 Ga0501071_0006469
1134 Ga0501072_0009204
1135 Ga0501073_0242638
1136 Ga0501074_0081114
1137 Ga0501076_0007362
1138 Ga0501077_0024467
1139 Ga0501079_0020373
1140 Ga0501081_0046870
1141 Ga0501269_000526
1142 Ga0501045_0013719
1143 nmdc:mga00v17_103677_c1
1144 nmdc:mga0yw44_18038_c1
1145 nmdc:mga0k408_26218_c1
1146 nmdc:mga0k408_68597_c1
1147 nmdc:mga07m45_73054_c1
1148 nmdc:mga05p37_863_c1
1149 nmdc:mga09592_15927_c1
1150 nmdc:mga09592_436_c1
1151 nmdc:mga0qj67_1189_c1
1152 nmdc:mga0qj67_3156_c1
1153 nmdc:mga06r32_7419_c1
1154 nmdc:mga08y16_132262_c1
1155 nmdc:mga08y16_15204_c1
1156 nmdc:mga08y16_156910_c1
1157 nmdc:mga08y16_83618_c1
1158 nmdc:mga0n895_427_c1
1159 nmdc:mga0rr50_2839_c1
1160 nmdc:mga0a205_1001_c1
1161 Ga0500635_0000449
1162 Ga0500643_000169
1163 Ga0500608_000123
1164 Ga0500618_000601
1165 Ga0500618_013509
1166 Ga0500559_0000954
1167 Ga0500577_0000079
1168 Ga0500604_0020364
1169 Ga0500622_0003490
1170 Ga0500645_010478
1171 Ga0501082_0010412
1172 Ga0501082_0023373
1173 Ga0501082_0257624
1174 2513912122
1175 2513924029
1176 2597859534
1177 2599416073
1178 2643865711
1179 2643894702
1180 2644085854
1181 2644294411
1182 2644344970
1183 2644369244
1184 2644476851
1185 2838036195
1186 2838077047
1187 2838666466
1188 2842807655
1189 2857566204
1190 2876812346
1191 2879118308
1192 2886854934
1193 2896385849
1194 2920761782
1195 2928975396
1196 3005413418
1197 3007424613
1198 639787302
1199 640487051
1200 651174924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23500

26

226

0.77

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

131

325

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7694 66 435
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7608 66 435
5v36-assembly1.cif.gz_A 1.88 angstrom resolution crystal structure of glutathione reductase from streptococcus mutans ua159 in complex with fad 0.76 402 431
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.7573 68 430
6i1t-assembly1.cif.gz_A calcium structure of trichoderma reesei carbohydrate-active enzymes family aa12 0.7555 47 434
ID Description Score Start End Superfamily
6n7fA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.767 402 431 3.50.50.60
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7574 66 435 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.749 66 435 2.120.10.30
af_P98164_2374_2695_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7436 78 409 2.120.10.30
af_Q8TED0_158_333_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.734 70 275 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A350CV99-F1-model_v4 Sorbosone dehydrogenase 0.9918 252 434
AF-A0A257WQ46-F1-model_v4 deleted 0.991 325 432
AF-A0A2R7L948-F1-model_v4 deleted 0.9908 40 434
AF-A0A2A3CKE1-F1-model_v4 deleted 0.9898 339 434
AF-A0A0J6S040-F1-model_v4 L-sorbosone dehydrogenase 0.9895 261 430

Map