F468047

General Info

Members Datasets Scaffolds Average Seq Length
601 320 1202 155

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10184117|Ga0075364_101841172
Length 169
Sequence MPISHIEHILVSTDDMDGTRDWYAAVLGMHEGWHPEFNFPVYWMYLGDVDVVHIGPSASKAGSNQQTYLGRLGQNTGNGTGALDHIAFRATGLSQMKEHLAKLRIDYKERRANGQALYQLFFFDPNGIKIELNFDAAEAEGHTPRSQRRQLRQADLTRSLTNKFRPTPQ

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
169 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
197 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
202 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
307 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
308 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
309 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
310 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
317 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
318 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.83
Nodule 0
Rhizoplane 0.33
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 9.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10184117 3300006051 Bacteria 1414
2 rootH1_10088835 3300003323 Bacteria 1035
3 Ga0065704_10319741 3300005289 Bacteria 855
4 Ga0065707_10009155 3300005295 Bacteria 2880
5 Ga0065707_10082232 3300005295 Bacteria 18627
6 Ga0065707_10371970 3300005295 Bacteria 889
7 Ga0065707_10409303 3300005295 Bacteria 843
8 Ga0070676_10761227 3300005328 Bacteria 712
9 Ga0070690_100000758 3300005330 Bacteria 16523
10 Ga0068869_100001795 3300005334 Bacteria 12871
11 Ga0068869_100548541 3300005334 Bacteria 971
12 Ga0070680_100007592 3300005336 Bacteria 8272
13 Ga0070680_100037926 3300005336 Bacteria 3896
14 Ga0070680_100085878 3300005336 Bacteria 2600
15 Ga0070680_100097740 3300005336 Bacteria 2435
16 Ga0070680_100417110 3300005336 Bacteria 1145
17 Ga0070682_100013702 3300005337 Bacteria 4673
18 Ga0068868_100079514 3300005338 Bacteria 2626
19 Ga0070689_100002598 3300005340 Bacteria 11834
20 Ga0070691_10000694 3300005341 Bacteria 13130
21 Ga0070691_10460501 3300005341 Bacteria 728
22 Ga0070687_100004636 3300005343 Bacteria 5494
23 Ga0070687_100967817 3300005343 Bacteria 615
24 Ga0070692_10033818 3300005345 Bacteria 2578
25 Ga0070692_10059124 3300005345 Bacteria 2014
26 Ga0070692_10086826 3300005345 Bacteria 1694
27 Ga0070692_10256659 3300005345 Bacteria 1049
28 Ga0070668_100210069 3300005347 Bacteria 1601
29 Ga0070669_100016378 3300005353 Bacteria 5289
30 Ga0070675_100758420 3300005354 Bacteria 886
31 Ga0070671_100119537 3300005355 Bacteria 2217
32 Ga0070673_100209987 3300005364 Bacteria 1681
33 Ga0070659_100738722 3300005366 Bacteria 853
34 Ga0070703_10013476 3300005406 Bacteria 2322
35 Ga0070709_11127310 3300005434 Unclassified 628
36 Ga0070710_10228841 3300005437 Bacteria 1186
37 Ga0070701_10013975 3300005438 Bacteria 3668
38 Ga0070701_10266274 3300005438 Bacteria 1041
39 Ga0070705_100002078 3300005440 Bacteria 10221
40 Ga0070705_100093233 3300005440 Bacteria 1882
41 Ga0070705_100100159 3300005440 Bacteria 1828
42 Ga0070700_100004325 3300005441 Bacteria 7411
43 Ga0070700_100032094 3300005441 Bacteria 3154
44 Ga0070694_100001894 3300005444 Bacteria 12395
45 Ga0070694_100047123 3300005444 Bacteria 2896
46 Ga0070694_100775536 3300005444 Unclassified 784
47 Ga0070708_100261177 3300005445 Bacteria 1628
48 Ga0070708_100575355 3300005445 Bacteria 1062
49 Ga0070662_100586258 3300005457 Unclassified 937
50 Ga0070681_10052319 3300005458 Bacteria 4072
51 Ga0070681_10136044 3300005458 Bacteria 2388
52 Ga0070681_10181547 3300005458 Bacteria 2026
53 Ga0068867_100015782 3300005459 Bacteria 5361
54 Ga0068867_100041922 3300005459 Bacteria 3345
55 Ga0070685_10697709 3300005466 Unclassified 740
56 Ga0070706_100015848 3300005467 Bacteria 6957
57 Ga0070707_100624195 3300005468 Bacteria 1040
58 Ga0070707_101262865 3300005468 Bacteria 705
59 Ga0070699_101202169 3300005518 Unclassified 695
60 Ga0070679_100119601 3300005530 Bacteria 2619
61 Ga0070697_100093798 3300005536 Bacteria 2486
62 Ga0070672_101065538 3300005543 Bacteria 718
63 Ga0070686_100002471 3300005544 Bacteria 10187
64 Ga0070686_100341231 3300005544 Bacteria 1123
65 Ga0070686_100485886 3300005544 Bacteria 956
66 Ga0070695_100011895 3300005545 Bacteria 5209
67 Ga0070695_100024349 3300005545 Bacteria 3728
68 Ga0070695_100088633 3300005545 Unclassified 2061
69 Ga0070696_100002305 3300005546 Bacteria 12593
70 Ga0070696_100003044 3300005546 Bacteria 11138
71 Ga0070696_100124988 3300005546 Bacteria 1865
72 Ga0070696_100517454 3300005546 Bacteria 952
73 Ga0070696_100874867 3300005546 Bacteria 744
74 Ga0070693_100001266 3300005547 Bacteria 11435
75 Ga0070704_100001415 3300005549 Bacteria 12797
76 Ga0070704_100003882 3300005549 Bacteria 8604
77 Ga0070704_100083470 3300005549 Bacteria 2359
78 Ga0070704_100330364 3300005549 Bacteria 1280
79 Ga0068855_100130724 3300005563 Bacteria 2868
80 Ga0068854_100003215 3300005578 Bacteria 10192
81 Ga0068856_100057230 3300005614 Bacteria 3849
82 Ga0068856_100332975 3300005614 Bacteria 1536
83 Ga0070702_100003013 3300005615 Bacteria 7447
84 Ga0070702_100053803 3300005615 Bacteria 2314
85 Ga0068859_100006424 3300005617 Bacteria 11926
86 Ga0068864_100022813 3300005618 Bacteria 5250
87 Ga0068864_100133899 3300005618 Bacteria 2230
88 Ga0068866_10000959 3300005718 Bacteria 12686
89 Ga0068861_100001299 3300005719 Bacteria 15627
90 Ga0068861_100007783 3300005719 Bacteria 7363
91 Ga0068870_10082660 3300005840 Bacteria 1779
92 Ga0068870_10316557 3300005840 Bacteria 990
93 Ga0068863_100212179 3300005841 Bacteria 1865
94 Ga0068858_100016904 3300005842 Bacteria 6850
95 Ga0068858_100068943 3300005842 Bacteria 3278
96 Ga0068860_100005275 3300005843 Bacteria 13119
97 Ga0068860_100138748 3300005843 Bacteria 2336
98 Ga0068862_100002444 3300005844 Bacteria 16490
99 Ga0068862_100013706 3300005844 Bacteria 6716
100 Ga0075365_10233676 3300006038 Bacteria 1291
101 Ga0075368_10001303 3300006042 Bacteria 7900
102 Ga0075363_100506527 3300006048 Bacteria 717
103 Ga0070716_100014162 3300006173 Bacteria 4082
104 Ga0075362_10040734 3300006177 Bacteria 2046
105 Ga0075367_10464687 3300006178 Bacteria 802
106 Ga0075369_10016704 3300006186 Bacteria 2965
107 Ga0075366_10182455 3300006195 Bacteria 1275
108 Ga0097621_100046343 3300006237 Bacteria 3517
109 Ga0097621_101775996 3300006237 Bacteria 588
110 Ga0075370_10234561 3300006353 Bacteria 1086
111 Ga0068871_100006330 3300006358 Bacteria 8365
112 Ga0075428_100283528 3300006844 Bacteria 1782
113 Ga0075430_100003868 3300006846 Bacteria 12611
114 Ga0075430_100012666 3300006846 Bacteria 7183
115 Ga0075430_100085285 3300006846 Bacteria 2645
116 Ga0075430_100364827 3300006846 Bacteria 1192
117 Ga0075430_100392484 3300006846 Bacteria 1145
118 Ga0075431_100111424 3300006847 Bacteria 2824
119 Ga0075431_100324314 3300006847 Bacteria 1552
120 Ga0075431_100393769 3300006847 Bacteria 1387
121 Ga0075433_10001178 3300006852 Bacteria 18995
122 Ga0075433_11708840 3300006852 Unclassified 542
123 Ga0075434_100001217 3300006871 Bacteria 21379
124 Ga0075434_100043127 3300006871 Bacteria 4473
125 Ga0075434_100058412 3300006871 Bacteria 3834
126 Ga0075429_100024299 3300006880 Bacteria 5257
127 Ga0075429_100041289 3300006880 Bacteria 4018
128 Ga0075429_100726925 3300006880 Bacteria 870
129 Ga0068865_100004151 3300006881 Bacteria 8711
130 Ga0068865_100025375 3300006881 Bacteria 3898
131 Ga0068865_100214227 3300006881 Bacteria 1503
132 Ga0068865_100608897 3300006881 Unclassified 924
133 Ga0075436_100003082 3300006914 Bacteria 11419
134 Ga0075436_100092449 3300006914 Bacteria 2103
135 Ga0075436_100111063 3300006914 Bacteria 1914
136 Ga0097620_100006424 3300006931 Bacteria 11926
137 Ga0075435_100000549 3300007076 Bacteria 23038
138 Ga0075435_100085734 3300007076 Bacteria 2593
139 Ga0075435_100682185 3300007076 Bacteria 892
140 Ga0099794_10048646 3300007265 Bacteria 2036
141 Ga0099794_10183148 3300007265 Unclassified 1069
142 Ga0099794_10274802 3300007265 Bacteria 871
143 Ga0105250_10112422 3300009092 Unclassified 1116
144 Ga0105240_11224848 3300009093 Bacteria 794
145 Ga0111539_10101460 3300009094 Bacteria 3379
146 Ga0111539_10114085 3300009094 Bacteria 3169
147 Ga0111539_10263046 3300009094 Bacteria 2008
148 Ga0111539_10803101 3300009094 Bacteria 1095
149 Ga0105245_10000259 3300009098 Bacteria 50388
150 Ga0114129_10037691 3300009147 Bacteria 6824
151 Ga0114129_10040019 3300009147 Bacteria 6611
152 Ga0114129_10176701 3300009147 Bacteria 2908
153 Ga0114129_10313807 3300009147 Bacteria 2086
154 Ga0105243_10004311 3300009148 Bacteria 11260
155 Ga0105243_10018108 3300009148 Bacteria 5330
156 Ga0105243_10892893 3300009148 Bacteria 883
157 Ga0105241_10004693 3300009174 Bacteria 10089
158 Ga0105242_10003634 3300009176 Bacteria 12007
159 Ga0105242_10306357 3300009176 Bacteria 1452
160 Ga0105248_12355630 3300009177 Unclassified 606
161 Ga0105249_10003563 3300009553 Bacteria 13472
162 Ga0105249_10226609 3300009553 Bacteria 1842
163 Ga0099796_10093121 3300010159 Bacteria 1123
164 Ga0105239_10215711 3300010375 Bacteria 2151
165 Ga0157324_1002980 3300012506 Bacteria 1076
166 Ga0157374_11552957 3300013296 Bacteria 686
167 Ga0157378_10007333 3300013297 Bacteria 9633
168 Ga0157378_10493731 3300013297 Bacteria 1222
169 Ga0163162_10264619 3300013306 Bacteria 1851
170 Ga0163162_12085151 3300013306 Unclassified 650
171 Ga0157372_10515575 3300013307 Bacteria 1394
172 Ga0157375_10781894 3300013308 Bacteria 1104
173 Ga0157380_10038348 3300014326 Bacteria 3720
174 Ga0157380_10123508 3300014326 Bacteria 2197
175 Ga0157377_10547902 3300014745 Unclassified 817
176 Ga0157379_10041206 3300014968 Bacteria 4123
177 Ga0157376_10007668 3300014969 Bacteria 7728
178 Ga0209026_1033713 3300025250 Bacteria 754
179 Ga0207682_10021773 3300025893 Bacteria 2522
180 Ga0207692_10190815 3300025898 Bacteria 1199
181 Ga0207642_10031590 3300025899 Bacteria 2220
182 Ga0207680_10194518 3300025903 Bacteria 1379
183 Ga0207647_10131694 3300025904 Bacteria 1469
184 Ga0207685_10099986 3300025905 Bacteria 1238
185 Ga0207699_10954071 3300025906 Unclassified 633
186 Ga0207645_10286135 3300025907 Bacteria 1095
187 Ga0207643_10102359 3300025908 Bacteria 1680
188 Ga0207643_10174851 3300025908 Bacteria 1297
189 Ga0207643_10410319 3300025908 Bacteria 857
190 Ga0207643_10470683 3300025908 Bacteria 801
191 Ga0207684_10064542 3300025910 Unclassified 3109
192 Ga0207654_10058334 3300025911 Bacteria 2247
193 Ga0207707_10092135 3300025912 Unclassified 2648
194 Ga0207707_10137158 3300025912 Bacteria 2139
195 Ga0207707_10337913 3300025912 Unclassified 1299
196 Ga0207660_10005344 3300025917 Bacteria 8344
197 Ga0207660_10045341 3300025917 Bacteria 3097
198 Ga0207660_10182597 3300025917 Bacteria 1630
199 Ga0207660_10304596 3300025917 Bacteria 1269
200 Ga0207662_10000106 3300025918 Bacteria 40137
201 Ga0207652_10286523 3300025921 Bacteria 1486
202 Ga0207652_10969156 3300025921 Bacteria 749
203 Ga0207646_10959579 3300025922 Bacteria 757
204 Ga0207681_10009830 3300025923 Bacteria 5850
205 Ga0207681_10825332 3300025923 Bacteria 775
206 Ga0207659_10688041 3300025926 Bacteria 875
207 Ga0207687_10015020 3300025927 Bacteria 5072
208 Ga0207706_10554161 3300025933 Unclassified 990
209 Ga0207686_10005506 3300025934 Bacteria 6796
210 Ga0207709_10002789 3300025935 Bacteria 10758
211 Ga0207709_10007942 3300025935 Bacteria 5879
212 Ga0207704_10002100 3300025938 Bacteria 8926
213 Ga0207704_10011298 3300025938 Bacteria 4391
214 Ga0207704_10616357 3300025938 Bacteria 890
215 Ga0207665_10003906 3300025939 Bacteria 9975
216 Ga0207691_10522099 3300025940 Bacteria 1008
217 Ga0207691_10724954 3300025940 Bacteria 838
218 Ga0207711_10136950 3300025941 Bacteria 2200
219 Ga0207689_10004637 3300025942 Bacteria 12436
220 Ga0207689_10235626 3300025942 Bacteria 1513
221 Ga0207689_10586771 3300025942 Bacteria 937
222 Ga0207661_10196334 3300025944 Bacteria 1772
223 Ga0207667_10034552 3300025949 Bacteria 5428
224 Ga0207651_10072810 3300025960 Bacteria 2441
225 Ga0207651_10637514 3300025960 Unclassified 935
226 Ga0207712_10006365 3300025961 Bacteria 7452
227 Ga0207668_10082548 3300025972 Bacteria 2335
228 Ga0207640_10004437 3300025981 Bacteria 7612
229 Ga0207677_10001868 3300026023 Bacteria 11132
230 Ga0207677_10917334 3300026023 Bacteria 790
231 Ga0207703_10003689 3300026035 Bacteria 12755
232 Ga0207703_10144624 3300026035 Bacteria 2067
233 Ga0207708_10022592 3300026075 Bacteria 4750
234 Ga0207708_10052811 3300026075 Bacteria 3096
235 Ga0207708_10167570 3300026075 Unclassified 1738
236 Ga0207702_10062564 3300026078 Bacteria 3179
237 Ga0207702_10116735 3300026078 Bacteria 2382
238 Ga0207641_10140600 3300026088 Bacteria 2178
239 Ga0207641_10653003 3300026088 Bacteria 1033
240 Ga0207648_10005290 3300026089 Bacteria 13022
241 Ga0207648_10017552 3300026089 Bacteria 6504
242 Ga0207676_10149328 3300026095 Bacteria 2011
243 Ga0207676_10524059 3300026095 Unclassified 1128
244 Ga0207674_11660834 3300026116 Bacteria 607
245 Ga0207674_11889609 3300026116 Unclassified 563
246 Ga0207675_100042171 3300026118 Bacteria 4259
247 Ga0207675_100526518 3300026118 Bacteria 1179
248 Ga0207675_100600700 3300026118 Unclassified 1103
249 Ga0207683_10396918 3300026121 Bacteria 1269
250 Ga0207683_11824423 3300026121 Unclassified 557
251 Ga0207698_10373333 3300026142 Unclassified 1354
252 Ga0209967_1026859 3300027364 Unclassified 855
253 Ga0209981_1003360 3300027378 Bacteria 2077
254 Ga0209981_1063394 3300027378 Unclassified 567
255 Ga0209996_1007617 3300027395 Bacteria 1412
256 Ga0209995_1032863 3300027471 Bacteria 871
257 Ga0209179_1017864 3300027512 Bacteria 1349
258 Ga0209968_1082852 3300027526 Unclassified 578
259 Ga0209999_1002174 3300027543 Unclassified 3432
260 Ga0209999_1002308 3300027543 Bacteria 3358
261 Ga0209999_1012605 3300027543 Bacteria 1532
262 Ga0209983_1023366 3300027665 Bacteria 1298
263 Ga0209813_10013065 3300027866 Bacteria 2209
264 Ga0209974_10118031 3300027876 Unclassified 938
265 Ga0207428_10012800 3300027907 Bacteria 7359
266 Ga0207428_10059671 3300027907 Bacteria 3024
267 Ga0207428_10249007 3300027907 Bacteria 1325
268 Ga0268265_10003603 3300028380 Bacteria 11062
269 Ga0268265_10014636 3300028380 Bacteria 5348
270 Ga0268264_10005206 3300028381 Bacteria 11019
271 Ga0268264_10474800 3300028381 Bacteria 1215
272 Ga0307511_10000216 3300030521 Bacteria 58288
273 Ga0307408_100079285 3300031548 Bacteria 2450
274 Ga0307408_100162281 3300031548 Bacteria 1776
275 Ga0307408_100263785 3300031548 Bacteria 1427
276 Ga0307408_101840812 3300031548 Bacteria 579
277 Ga0307413_10303510 3300031824 Unclassified 1212
278 Ga0307407_10104892 3300031903 Bacteria 1763
279 Ga0307407_10887496 3300031903 Bacteria 683
280 Ga0307407_11416623 3300031903 Bacteria 548
281 Ga0307412_10396696 3300031911 Unclassified 1122
282 Ga0307412_11317651 3300031911 Bacteria 651
283 Ga0307416_100254813 3300032002 Bacteria 1711
284 Ga0307416_100430600 3300032002 Unclassified 1366
285 Ga0307416_101531215 3300032002 Bacteria 772
286 Ga0307411_10576298 3300032005 Bacteria 964
287 Ga0307411_10826823 3300032005 Bacteria 818
288 Ga0307415_101503719 3300032126 Bacteria 644
289 Ga0373948_0025453 3300034817 Bacteria 1161
290 Ga0373958_0013830 3300034819 Unclassified 1403
291 Ga0373938_0013443 3300034957 Bacteria 1553
292 Ga0373926_0001421 3300035083 Bacteria 7277
293 Ga0373934_0032818 3300035086 Bacteria 2037
294 Ga0373934_0114542 3300035086 Bacteria 1095
295 Ga0373934_0122652 3300035086 Bacteria 1057
296 Ga0373940_0010890 3300035088 Bacteria 2149
297 Ga0373944_0090768 3300035089 Bacteria 1021
298 Ga0373949_0001404 3300035090 Bacteria 6906
299 Ga0373952_0005269 3300035092 Bacteria 2359
300 Ga0373923_0051585 3300035111 Bacteria 1726
301 Ga0373932_0007892 3300035112 Bacteria 2540
302 Ga0373936_0046139 3300035113 Bacteria 1756
303 Ga0373936_0074251 3300035113 Bacteria 1406
304 Ga0373939_0072390 3300035114 Bacteria 1125
305 Ga0373941_0095534 3300035115 Bacteria 1027
306 Ga0373954_0000025 3300035118 Bacteria 57365
307 Ga0373954_0000275 3300035118 Bacteria 18758
308 Ga0373954_0011793 3300035118 Bacteria 3879
309 Ga0373954_0096112 3300035118 Bacteria 1426
310 Ga0373954_0357802 3300035118 Bacteria 721
311 Ga0373956_0011601 3300035119 Bacteria 3632
312 Ga0373956_0057710 3300035119 Bacteria 1755
313 Ga0373956_0097631 3300035119 Bacteria 1360
314 Ga0373956_0105152 3300035119 Bacteria 1311
315 Ga0373956_0138066 3300035119 Bacteria 1144
316 Ga0373957_0086921 3300035120 Bacteria 1238
317 Ga0373960_0008342 3300035121 Bacteria 2481
318 Ga0373960_0014723 3300035121 Bacteria 1986
319 Ga0373946_0008966 3300035171 Bacteria 3678
320 Ga0373946_0018642 3300035171 Bacteria 2667
321 Ga0373955_0011840 3300035172 Bacteria 4174
322 Ga0373955_0238175 3300035172 Bacteria 1089
323 Ga0373942_0043850 3300035207 Unclassified 1230
324 Ga0373961_0157211 3300035241 Bacteria 778
325 Ga0373962_0026842 3300035242 Bacteria 1554
326 Ga0373931_0001493 3300035691 Bacteria 10064
327 Ga0373931_0027947 3300035691 Bacteria 2883
328 Ga0373935_0015015 3300035692 Bacteria 4676
329 Ga0373935_0018116 3300035692 Bacteria 4280
330 Ga0373933_0006214 3300035724 Bacteria 6498
331 Ga0373933_0075898 3300035724 Bacteria 2052
332 Ga0373933_0409834 3300035724 Bacteria 884
333 Ga0373933_0575080 3300035724 Bacteria 739
334 Ga0373933_0727155 3300035724 Unclassified 653
335 Ga0373947_0155773 3300035725 Bacteria 1474
336 Ga0373937_0000296 3300036401 Bacteria 47231
337 Ga0373937_0032062 3300036401 Bacteria 4764
338 Ga0373937_0385314 3300036401 Bacteria 1329
339 Ga0373937_0434103 3300036401 Bacteria 1247
340 Ga0373937_0844848 3300036401 Bacteria 864
341 Ga0373925_0013522 3300037068 Bacteria 5908
342 Ga0373925_0379662 3300037068 Bacteria 1150
343 Ga0373925_1079820 3300037068 Bacteria 660
344 Ga0439453_0006922 3300041408 Bacteria 1782
345 Ga0439461_0071105 3300041410 Bacteria 806
346 Ga0451807_0742293 3300041486 Unclassified 1205
347 Ga0439443_058564 3300042003 Bacteria 686
348 Ga0439462_0082568 3300042015 Bacteria 878
349 Ga0450913_008476 3300042117 Bacteria 793
350 Ga0439446_0157122 3300042156 Unclassified 750
351 Ga0439434_0000699 3300042435 Bacteria 9669
352 Ga0439435_0000372 3300042436 Bacteria 6869
353 Ga0439435_0049574 3300042436 Bacteria 1198
354 Ga0439435_0252263 3300042436 Unclassified 594
355 Ga0439444_0000647 3300042437 Bacteria 4039
356 Ga0439460_0029786 3300042461 Bacteria 1548
357 Ga0439460_0183724 3300042461 Bacteria 707
358 Ga0451577_0751193 3300042876 Unclassified 882
359 Ga0451576_0030027 3300045051 Bacteria 5812
360 Ga0451576_0069099 3300045051 Bacteria 3675
361 Ga0451576_0208014 3300045051 Unclassified 2043
362 Ga0451576_1311891 3300045051 Bacteria 754
363 Ga0495592_0004252 3300046454 Bacteria 10458
364 Ga0495603_0002444 3300046455 Bacteria 10930
365 Ga0495603_0881481 3300046455 Unclassified 509
366 Ga0495591_110935 3300046458 Unclassified 674
367 Ga0495629_0731440 3300046459 Bacteria 656
368 Ga0495641_0027076 3300046461 Bacteria 2791
369 Ga0495651_0620163 3300046462 Unclassified 680
370 Ga0495653_0070250 3300046463 Bacteria 2621
371 Ga0495653_0327433 3300046463 Bacteria 991
372 Ga0495580_0017020 3300046472 Bacteria 5446
373 Ga0495580_0077545 3300046472 Bacteria 2317
374 Ga0495582_0227378 3300046473 Bacteria 1068
375 Ga0495639_0514304 3300046475 Unclassified 612
376 Ga0495662_0001176 3300046476 Bacteria 12910
377 Ga0495662_0032731 3300046476 Bacteria 2512
378 Ga0495664_0060746 3300046477 Bacteria 2251
379 Ga0495664_0070684 3300046477 Bacteria 2084
380 Ga0495594_0018580 3300046499 Bacteria 3685
381 Ga0495594_0151832 3300046499 Bacteria 1315
382 Ga0495608_0023681 3300046511 Bacteria 4205
383 Ga0495608_0155916 3300046511 Bacteria 1453
384 Ga0495608_0743275 3300046511 Bacteria 582
385 Ga0495618_0027948 3300046514 Bacteria 3514
386 Ga0495628_0000277 3300046516 Bacteria 45973
387 Ga0495628_0002586 3300046516 Bacteria 16269
388 Ga0495628_0024989 3300046516 Bacteria 4884
389 Ga0495628_0139715 3300046516 Bacteria 1849
390 Ga0495630_0039576 3300046517 Bacteria 3524
391 Ga0495630_0102123 3300046517 Bacteria 2169
392 Ga0495630_0197142 3300046517 Bacteria 1536
393 Ga0495630_0243593 3300046517 Bacteria 1374
394 Ga0495666_0013392 3300046526 Bacteria 4090
395 Ga0495666_0052283 3300046526 Bacteria 1961
396 Ga0495666_0100180 3300046526 Bacteria 1365
397 Ga0495642_0186324 3300046528 Unclassified 904
398 Ga0495652_0001564 3300046529 Bacteria 25037
399 Ga0495652_0468900 3300046529 Unclassified 878
400 Ga0495652_0891320 3300046529 Bacteria 587
401 Ga0495665_0105038 3300046531 Bacteria 1482
402 Ga0495640_0052241 3300046533 Bacteria 2807
403 Ga0495640_0088962 3300046533 Bacteria 2040
404 Ga0495586_0002520 3300046535 Bacteria 9923
405 Ga0495587_0006598 3300046536 Bacteria 7555
406 Ga0495598_0009375 3300046537 Bacteria 2312
407 Ga0495598_0034224 3300046537 Bacteria 1447
408 Ga0495621_0147823 3300046539 Bacteria 923
409 Ga0495645_0000603 3300046543 Bacteria 24774
410 Ga0495622_0129488 3300046557 Bacteria 1150
411 Ga0495667_0018478 3300046559 Bacteria 4710
412 Ga0495667_0029410 3300046559 Bacteria 3699
413 Ga0495667_0057132 3300046559 Bacteria 2566
414 Ga0495667_0310148 3300046559 Bacteria 999
415 Ga0495667_0318879 3300046559 Bacteria 983
416 Ga0495667_0497956 3300046559 Bacteria 763
417 Ga0495656_0138122 3300046615 Bacteria 1166
418 Ga0495634_0054095 3300046642 Bacteria 2687
419 Ga0495634_0220282 3300046642 Bacteria 1171
420 Ga0495635_0023171 3300046663 Bacteria 4327
421 Ga0495635_0033793 3300046663 Bacteria 3547
422 Ga0495659_0012193 3300046664 Bacteria 2780
423 Ga0495659_0237132 3300046664 Unclassified 757
424 Ga0495657_0070948 3300046675 Bacteria 2276
425 Ga0495599_0005555 3300046678 Bacteria 7561
426 Ga0495599_0106490 3300046678 Bacteria 1747
427 Ga0495599_0307209 3300046678 Bacteria 956
428 Ga0495599_0715167 3300046678 Unclassified 576
429 Ga0495623_0157499 3300046679 Bacteria 1337
430 Ga0495647_0000090 3300046681 Bacteria 22381
431 Ga0495647_0012405 3300046681 Bacteria 2933
432 Ga0495647_0074014 3300046681 Bacteria 1369
433 Ga0495658_0011617 3300046683 Bacteria 4435
434 Ga0495658_0026527 3300046683 Bacteria 3106
435 Ga0495669_0491334 3300046684 Bacteria 597
436 Ga0495613_0055700 3300046689 Bacteria 2904
437 Ga0495613_0252058 3300046689 Bacteria 1231
438 Ga0495624_0448340 3300046690 Bacteria 773
439 Ga0495670_0404305 3300046691 Unclassified 738
440 Ga0495589_0553247 3300046794 Bacteria 525
441 Ga0495600_0014499 3300046809 Bacteria 4967
442 Ga0495600_0020078 3300046809 Bacteria 4273
443 Ga0495600_0230663 3300046809 Bacteria 1182
444 Ga0495600_0446563 3300046809 Bacteria 800
445 Ga0495581_0041692 3300047315 Bacteria 2657
446 Ga0495581_0117021 3300047315 Bacteria 1550
447 Ga0495604_0029726 3300047317 Bacteria 4347
448 Ga0495604_0114670 3300047317 Bacteria 1959
449 Ga0495604_0339480 3300047317 Bacteria 1000
450 Ga0495604_0407459 3300047317 Bacteria 894
451 Ga0495636_0086086 3300047318 Bacteria 1359
452 Ga0495674_0098987 3300047319 Bacteria 2483
453 Ga0495674_0127324 3300047319 Bacteria 2147
454 Ga0495674_0279034 3300047319 Bacteria 1369
455 Ga0495680_0041528 3300047322 Bacteria 3657
456 Ga0495680_0194836 3300047322 Bacteria 1456
457 Ga0495680_0691492 3300047322 Unclassified 674
458 Ga0495675_0437311 3300047444 Bacteria 758
459 Ga0496106_0082510 3300048909 Bacteria 2471
460 Ga0501031_0036298 3300049568 Bacteria 3215
461 Ga0501032_0042182 3300049569 Bacteria 3096
462 Ga0501033_0009326 3300049570 Bacteria 7558
463 Ga0501033_1019585 3300049570 Unclassified 553
464 Ga0501034_0505560 3300049571 Unclassified 1122
465 Ga0501036_0001399 3300049572 Bacteria 18546
466 Ga0501036_0239992 3300049572 Bacteria 1520
467 Ga0501036_0502568 3300049572 Bacteria 1009
468 Ga0501036_1714523 3300049572 Bacteria 506
469 Ga0501037_0135029 3300049573 Bacteria 1767
470 Ga0501038_0001280 3300049574 Bacteria 22839
471 Ga0501038_0213867 3300049574 Bacteria 1541
472 Ga0501038_0424688 3300049574 Bacteria 1025
473 Ga0501039_0009114 3300049575 Bacteria 7562
474 Ga0501039_0023237 3300049575 Bacteria 4759
475 Ga0501039_0049645 3300049575 Bacteria 3244
476 Ga0501039_0536729 3300049575 Bacteria 918
477 Ga0501040_0002472 3300049576 Bacteria 11897
478 Ga0501040_0013157 3300049576 Bacteria 5442
479 Ga0501040_0017999 3300049576 Bacteria 4691
480 Ga0501040_0021498 3300049576 Bacteria 4310
481 Ga0501040_0310157 3300049576 Unclassified 1128
482 Ga0501041_0009642 3300049577 Bacteria 5692
483 Ga0501041_0041037 3300049577 Bacteria 2810
484 Ga0501041_0364569 3300049577 Bacteria 914
485 Ga0501042_0013058 3300049578 Bacteria 5646
486 Ga0501042_0035062 3300049578 Bacteria 3560
487 Ga0501042_0119810 3300049578 Bacteria 1895
488 Ga0501043_0066244 3300049579 Bacteria 2836
489 Ga0501043_0176624 3300049579 Bacteria 1665
490 Ga0501046_0000393 3300049580 Bacteria 43715
491 Ga0501046_0218408 3300049580 Bacteria 1413
492 Ga0501046_0730319 3300049580 Bacteria 696
493 Ga0501048_0022699 3300049582 Bacteria 4587
494 Ga0501048_0032107 3300049582 Bacteria 3796
495 Ga0501048_0076733 3300049582 Bacteria 2358
496 Ga0501048_0234448 3300049582 Bacteria 1302
497 Ga0501070_0471644 3300049586 Bacteria 1010
498 Ga0501071_0105846 3300049587 Bacteria 2077
499 Ga0501071_0299784 3300049587 Bacteria 1218
500 Ga0501071_0753292 3300049587 Bacteria 750
501 Ga0501071_1193866 3300049587 Bacteria 588
502 Ga0501072_0009110 3300049588 Bacteria 7537
503 Ga0501072_0020833 3300049588 Bacteria 5082
504 Ga0501072_0072251 3300049588 Bacteria 2726
505 Ga0501072_0101047 3300049588 Bacteria 2292
506 Ga0501074_0133824 3300049590 Bacteria 1773
507 Ga0501074_0563248 3300049590 Bacteria 806
508 Ga0501075_0002673 3300049591 Bacteria 11912
509 Ga0501075_0302690 3300049591 Bacteria 1218
510 Ga0501076_0010505 3300049592 Bacteria 6870
511 Ga0501076_0025401 3300049592 Bacteria 4583
512 Ga0501076_0743036 3300049592 Bacteria 810
513 Ga0501077_0029677 3300049593 Bacteria 3477
514 Ga0501077_0107268 3300049593 Bacteria 1770
515 Ga0501249_195163 3300049679 Bacteria 529
516 Ga0501079_0001171 3300049741 Bacteria 18352
517 Ga0501079_0209560 3300049741 Bacteria 1522
518 Ga0501079_0267574 3300049741 Bacteria 1336
519 Ga0501079_0271618 3300049741 Bacteria 1325
520 Ga0501080_0068629 3300049742 Bacteria 3298
521 Ga0501080_0992379 3300049742 Bacteria 729
522 Ga0501081_0032206 3300049743 Bacteria 3555
523 Ga0501081_0058221 3300049743 Bacteria 2673
524 Ga0501081_0873911 3300049743 Bacteria 677
525 Ga0501083_0074798 3300049744 Bacteria 2250
526 Ga0501083_0091947 3300049744 Bacteria 2003
527 Ga0501035_0042409 3300049822 Bacteria 4104
528 Ga0501035_0597628 3300049822 Bacteria 899
529 Ga0501035_0667749 3300049822 Bacteria 841
530 Ga0501044_0099355 3300049823 Bacteria 2929
531 Ga0501045_0002025 3300049824 Bacteria 13704
532 Ga0501045_0019854 3300049824 Bacteria 4797
533 Ga0501045_0194143 3300049824 Bacteria 1513
534 Ga0501045_0530706 3300049824 Bacteria 873
535 nmdc:mga03n38_1846_c1 3300050490 Bacteria 6317
536 nmdc:mga00v17_81125_c1 3300050491 Bacteria 2026
537 nmdc:mga0yw44_34531_c1 3300050492 Bacteria 2964
538 nmdc:mga0yw44_55457_c1 3300050492 Bacteria 2412
539 nmdc:mga0k408_260271_c1 3300050493 Bacteria 1036
540 nmdc:mga06z11_472375_c1 3300050494 Bacteria 759
541 nmdc:mga06z11_7459_c1 3300050494 Bacteria 4501
542 nmdc:mga07m45_141205_c1 3300050496 Bacteria 1395
543 nmdc:mga05p37_1113688_c1 3300050507 Unclassified 825
544 nmdc:mga05p37_21952_c1 3300050507 Bacteria 7734
545 nmdc:mga05p37_318610_c1 3300050507 Bacteria 1841
546 nmdc:mga05p37_388465_c1 3300050507 Bacteria 1633
547 nmdc:mga05p37_633870_c1 3300050507 Bacteria 1200
548 nmdc:mga09592_10611_c1 3300050508 Bacteria 7502
549 nmdc:mga09592_108030_c1 3300050508 Bacteria 2386
550 nmdc:mga09592_27752_c1 3300050508 Bacteria 4699
551 nmdc:mga09592_938820_c1 3300050508 Bacteria 726
552 nmdc:mga0qj67_24541_c1 3300050509 Bacteria 4649
553 nmdc:mga0qj67_370101_c1 3300050509 Bacteria 1158
554 nmdc:mga0qj67_414337_c1 3300050509 Bacteria 1087
555 nmdc:mga0qj67_55690_c1 3300050509 Bacteria 3133
556 nmdc:mga0qj67_6657_c1 3300050509 Bacteria 8489
557 nmdc:mga06r32_230812_c1 3300050510 Bacteria 1839
558 nmdc:mga06r32_68994_c1 3300050510 Bacteria 3416
559 nmdc:mga06r32_860591_c1 3300050510 Bacteria 865
560 nmdc:mga08y16_152868_c1 3300050511 Bacteria 2399
561 nmdc:mga08y16_174608_c1 3300050511 Bacteria 2231
562 nmdc:mga08y16_280217_c1 3300050511 Bacteria 1720
563 nmdc:mga0n895_1192625_c1 3300050512 Bacteria 735
564 nmdc:mga0n895_1313725_c1 3300050512 Bacteria 694
565 nmdc:mga0n895_29550_c1 3300050512 Bacteria 5229
566 nmdc:mga0n895_56755_c1 3300050512 Bacteria 3859
567 nmdc:mga0n895_57140_c1 3300050512 Bacteria 3846
568 nmdc:mga0rr50_3216_c1 3300050513 Bacteria 9354
569 nmdc:mga0rr50_445537_c1 3300050513 Bacteria 1097
570 nmdc:mga08x19_1137390_c1 3300050514 Bacteria 554
571 nmdc:mga08x19_180424_c1 3300050514 Bacteria 1441
572 nmdc:mga08x19_2801_c1 3300050514 Bacteria 10514
573 nmdc:mga08x19_65142_c1 3300050514 Bacteria 2366
574 nmdc:mga0a205_1704_c1 3300050515 Bacteria 18985
575 nmdc:mga0a205_832569_c1 3300050515 Bacteria 770
576 nmdc:mga0sz30_2673_c1 3300050516 Bacteria 6354
577 Ga0495601_0008392 3300053077 Bacteria 6101
578 Ga0495601_0108472 3300053077 Bacteria 1796
579 Ga0500646_0001822 3300053090 Bacteria 5600
580 Ga0500583_0006293 3300053092 Bacteria 4070
581 Ga0500650_0044576 3300053098 Bacteria 2053
582 Ga0500642_0156765 3300053130 Bacteria 1068
583 Ga0500655_037245 3300053133 Bacteria 948
584 Ga0500568_0010679 3300053139 Bacteria 4290
585 Ga0500604_0001465 3300053151 Bacteria 6584
586 Ga0500616_0051819 3300053153 Bacteria 2161
587 Ga0500637_0132651 3300053178 Bacteria 1444
588 Ga0500637_0455121 3300053178 Unclassified 648
589 Ga0501084_0044434 3300054114 Bacteria 3719
590 Ga0501084_0103787 3300054114 Bacteria 2388
591 Ga0501084_0199944 3300054114 Bacteria 1686
592 Ga0501084_0639581 3300054114 Bacteria 898
593 Ga0590071_046164 3300059421 Bacteria 1052
594 Ga0590075_102932 3300059424 Bacteria 744
595 Ga0590077_079669 3300059426 Unclassified 753
596 Ga0501082_0004197 3300060353 Bacteria 12591
597 Ga0501082_0124632 3300060353 Bacteria 2234
598 Ga0501082_0559745 3300060353 Bacteria 1000
599 Ga0530510_0000048 3300061734 Bacteria 56268
600 Ga0530510_0256251 3300061734 Unclassified 1304
601 Ga0530510_0391158 3300061734 Bacteria 1047
602 Ga0075364_10184117
603 rootH1_10088835
604 Ga0065704_10319741
605 Ga0065707_10009155
606 Ga0065707_10082232
607 Ga0065707_10371970
608 Ga0065707_10409303
609 Ga0070676_10761227
610 Ga0070690_100000758
611 Ga0068869_100001795
612 Ga0068869_100548541
613 Ga0070680_100007592
614 Ga0070680_100037926
615 Ga0070680_100085878
616 Ga0070680_100097740
617 Ga0070680_100417110
618 Ga0070682_100013702
619 Ga0068868_100079514
620 Ga0070689_100002598
621 Ga0070691_10000694
622 Ga0070691_10460501
623 Ga0070687_100004636
624 Ga0070687_100967817
625 Ga0070692_10033818
626 Ga0070692_10059124
627 Ga0070692_10086826
628 Ga0070692_10256659
629 Ga0070668_100210069
630 Ga0070669_100016378
631 Ga0070675_100758420
632 Ga0070671_100119537
633 Ga0070673_100209987
634 Ga0070659_100738722
635 Ga0070703_10013476
636 Ga0070709_11127310
637 Ga0070710_10228841
638 Ga0070701_10013975
639 Ga0070701_10266274
640 Ga0070705_100002078
641 Ga0070705_100093233
642 Ga0070705_100100159
643 Ga0070700_100004325
644 Ga0070700_100032094
645 Ga0070694_100001894
646 Ga0070694_100047123
647 Ga0070694_100775536
648 Ga0070708_100261177
649 Ga0070708_100575355
650 Ga0070662_100586258
651 Ga0070681_10052319
652 Ga0070681_10136044
653 Ga0070681_10181547
654 Ga0068867_100015782
655 Ga0068867_100041922
656 Ga0070685_10697709
657 Ga0070706_100015848
658 Ga0070707_100624195
659 Ga0070707_101262865
660 Ga0070699_101202169
661 Ga0070679_100119601
662 Ga0070697_100093798
663 Ga0070672_101065538
664 Ga0070686_100002471
665 Ga0070686_100341231
666 Ga0070686_100485886
667 Ga0070695_100011895
668 Ga0070695_100024349
669 Ga0070695_100088633
670 Ga0070696_100002305
671 Ga0070696_100003044
672 Ga0070696_100124988
673 Ga0070696_100517454
674 Ga0070696_100874867
675 Ga0070693_100001266
676 Ga0070704_100001415
677 Ga0070704_100003882
678 Ga0070704_100083470
679 Ga0070704_100330364
680 Ga0068855_100130724
681 Ga0068854_100003215
682 Ga0068856_100057230
683 Ga0068856_100332975
684 Ga0070702_100003013
685 Ga0070702_100053803
686 Ga0068859_100006424
687 Ga0068864_100022813
688 Ga0068864_100133899
689 Ga0068866_10000959
690 Ga0068861_100001299
691 Ga0068861_100007783
692 Ga0068870_10082660
693 Ga0068870_10316557
694 Ga0068863_100212179
695 Ga0068858_100016904
696 Ga0068858_100068943
697 Ga0068860_100005275
698 Ga0068860_100138748
699 Ga0068862_100002444
700 Ga0068862_100013706
701 Ga0075365_10233676
702 Ga0075368_10001303
703 Ga0075363_100506527
704 Ga0070716_100014162
705 Ga0075362_10040734
706 Ga0075367_10464687
707 Ga0075369_10016704
708 Ga0075366_10182455
709 Ga0097621_100046343
710 Ga0097621_101775996
711 Ga0075370_10234561
712 Ga0068871_100006330
713 Ga0075428_100283528
714 Ga0075430_100003868
715 Ga0075430_100012666
716 Ga0075430_100085285
717 Ga0075430_100364827
718 Ga0075430_100392484
719 Ga0075431_100111424
720 Ga0075431_100324314
721 Ga0075431_100393769
722 Ga0075433_10001178
723 Ga0075433_11708840
724 Ga0075434_100001217
725 Ga0075434_100043127
726 Ga0075434_100058412
727 Ga0075429_100024299
728 Ga0075429_100041289
729 Ga0075429_100726925
730 Ga0068865_100004151
731 Ga0068865_100025375
732 Ga0068865_100214227
733 Ga0068865_100608897
734 Ga0075436_100003082
735 Ga0075436_100092449
736 Ga0075436_100111063
737 Ga0097620_100006424
738 Ga0075435_100000549
739 Ga0075435_100085734
740 Ga0075435_100682185
741 Ga0099794_10048646
742 Ga0099794_10183148
743 Ga0099794_10274802
744 Ga0105250_10112422
745 Ga0105240_11224848
746 Ga0111539_10101460
747 Ga0111539_10114085
748 Ga0111539_10263046
749 Ga0111539_10803101
750 Ga0105245_10000259
751 Ga0114129_10037691
752 Ga0114129_10040019
753 Ga0114129_10176701
754 Ga0114129_10313807
755 Ga0105243_10004311
756 Ga0105243_10018108
757 Ga0105243_10892893
758 Ga0105241_10004693
759 Ga0105242_10003634
760 Ga0105242_10306357
761 Ga0105248_12355630
762 Ga0105249_10003563
763 Ga0105249_10226609
764 Ga0099796_10093121
765 Ga0105239_10215711
766 Ga0157324_1002980
767 Ga0157374_11552957
768 Ga0157378_10007333
769 Ga0157378_10493731
770 Ga0163162_10264619
771 Ga0163162_12085151
772 Ga0157372_10515575
773 Ga0157375_10781894
774 Ga0157380_10038348
775 Ga0157380_10123508
776 Ga0157377_10547902
777 Ga0157379_10041206
778 Ga0157376_10007668
779 Ga0209026_1033713
780 Ga0207682_10021773
781 Ga0207692_10190815
782 Ga0207642_10031590
783 Ga0207680_10194518
784 Ga0207647_10131694
785 Ga0207685_10099986
786 Ga0207699_10954071
787 Ga0207645_10286135
788 Ga0207643_10102359
789 Ga0207643_10174851
790 Ga0207643_10410319
791 Ga0207643_10470683
792 Ga0207684_10064542
793 Ga0207654_10058334
794 Ga0207707_10092135
795 Ga0207707_10137158
796 Ga0207707_10337913
797 Ga0207660_10005344
798 Ga0207660_10045341
799 Ga0207660_10182597
800 Ga0207660_10304596
801 Ga0207662_10000106
802 Ga0207652_10286523
803 Ga0207652_10969156
804 Ga0207646_10959579
805 Ga0207681_10009830
806 Ga0207681_10825332
807 Ga0207659_10688041
808 Ga0207687_10015020
809 Ga0207706_10554161
810 Ga0207686_10005506
811 Ga0207709_10002789
812 Ga0207709_10007942
813 Ga0207704_10002100
814 Ga0207704_10011298
815 Ga0207704_10616357
816 Ga0207665_10003906
817 Ga0207691_10522099
818 Ga0207691_10724954
819 Ga0207711_10136950
820 Ga0207689_10004637
821 Ga0207689_10235626
822 Ga0207689_10586771
823 Ga0207661_10196334
824 Ga0207667_10034552
825 Ga0207651_10072810
826 Ga0207651_10637514
827 Ga0207712_10006365
828 Ga0207668_10082548
829 Ga0207640_10004437
830 Ga0207677_10001868
831 Ga0207677_10917334
832 Ga0207703_10003689
833 Ga0207703_10144624
834 Ga0207708_10022592
835 Ga0207708_10052811
836 Ga0207708_10167570
837 Ga0207702_10062564
838 Ga0207702_10116735
839 Ga0207641_10140600
840 Ga0207641_10653003
841 Ga0207648_10005290
842 Ga0207648_10017552
843 Ga0207676_10149328
844 Ga0207676_10524059
845 Ga0207674_11660834
846 Ga0207674_11889609
847 Ga0207675_100042171
848 Ga0207675_100526518
849 Ga0207675_100600700
850 Ga0207683_10396918
851 Ga0207683_11824423
852 Ga0207698_10373333
853 Ga0209967_1026859
854 Ga0209981_1003360
855 Ga0209981_1063394
856 Ga0209996_1007617
857 Ga0209995_1032863
858 Ga0209179_1017864
859 Ga0209968_1082852
860 Ga0209999_1002174
861 Ga0209999_1002308
862 Ga0209999_1012605
863 Ga0209983_1023366
864 Ga0209813_10013065
865 Ga0209974_10118031
866 Ga0207428_10012800
867 Ga0207428_10059671
868 Ga0207428_10249007
869 Ga0268265_10003603
870 Ga0268265_10014636
871 Ga0268264_10005206
872 Ga0268264_10474800
873 Ga0307511_10000216
874 Ga0307408_100079285
875 Ga0307408_100162281
876 Ga0307408_100263785
877 Ga0307408_101840812
878 Ga0307413_10303510
879 Ga0307407_10104892
880 Ga0307407_10887496
881 Ga0307407_11416623
882 Ga0307412_10396696
883 Ga0307412_11317651
884 Ga0307416_100254813
885 Ga0307416_100430600
886 Ga0307416_101531215
887 Ga0307411_10576298
888 Ga0307411_10826823
889 Ga0307415_101503719
890 Ga0373948_0025453
891 Ga0373958_0013830
892 Ga0373938_0013443
893 Ga0373926_0001421
894 Ga0373934_0032818
895 Ga0373934_0114542
896 Ga0373934_0122652
897 Ga0373940_0010890
898 Ga0373944_0090768
899 Ga0373949_0001404
900 Ga0373952_0005269
901 Ga0373923_0051585
902 Ga0373932_0007892
903 Ga0373936_0046139
904 Ga0373936_0074251
905 Ga0373939_0072390
906 Ga0373941_0095534
907 Ga0373954_0000025
908 Ga0373954_0000275
909 Ga0373954_0011793
910 Ga0373954_0096112
911 Ga0373954_0357802
912 Ga0373956_0011601
913 Ga0373956_0057710
914 Ga0373956_0097631
915 Ga0373956_0105152
916 Ga0373956_0138066
917 Ga0373957_0086921
918 Ga0373960_0008342
919 Ga0373960_0014723
920 Ga0373946_0008966
921 Ga0373946_0018642
922 Ga0373955_0011840
923 Ga0373955_0238175
924 Ga0373942_0043850
925 Ga0373961_0157211
926 Ga0373962_0026842
927 Ga0373931_0001493
928 Ga0373931_0027947
929 Ga0373935_0015015
930 Ga0373935_0018116
931 Ga0373933_0006214
932 Ga0373933_0075898
933 Ga0373933_0409834
934 Ga0373933_0575080
935 Ga0373933_0727155
936 Ga0373947_0155773
937 Ga0373937_0000296
938 Ga0373937_0032062
939 Ga0373937_0385314
940 Ga0373937_0434103
941 Ga0373937_0844848
942 Ga0373925_0013522
943 Ga0373925_0379662
944 Ga0373925_1079820
945 Ga0439453_0006922
946 Ga0439461_0071105
947 Ga0451807_0742293
948 Ga0439443_058564
949 Ga0439462_0082568
950 Ga0450913_008476
951 Ga0439446_0157122
952 Ga0439434_0000699
953 Ga0439435_0000372
954 Ga0439435_0049574
955 Ga0439435_0252263
956 Ga0439444_0000647
957 Ga0439460_0029786
958 Ga0439460_0183724
959 Ga0451577_0751193
960 Ga0451576_0030027
961 Ga0451576_0069099
962 Ga0451576_0208014
963 Ga0451576_1311891
964 Ga0495592_0004252
965 Ga0495603_0002444
966 Ga0495603_0881481
967 Ga0495591_110935
968 Ga0495629_0731440
969 Ga0495641_0027076
970 Ga0495651_0620163
971 Ga0495653_0070250
972 Ga0495653_0327433
973 Ga0495580_0017020
974 Ga0495580_0077545
975 Ga0495582_0227378
976 Ga0495639_0514304
977 Ga0495662_0001176
978 Ga0495662_0032731
979 Ga0495664_0060746
980 Ga0495664_0070684
981 Ga0495594_0018580
982 Ga0495594_0151832
983 Ga0495608_0023681
984 Ga0495608_0155916
985 Ga0495608_0743275
986 Ga0495618_0027948
987 Ga0495628_0000277
988 Ga0495628_0002586
989 Ga0495628_0024989
990 Ga0495628_0139715
991 Ga0495630_0039576
992 Ga0495630_0102123
993 Ga0495630_0197142
994 Ga0495630_0243593
995 Ga0495666_0013392
996 Ga0495666_0052283
997 Ga0495666_0100180
998 Ga0495642_0186324
999 Ga0495652_0001564
1000 Ga0495652_0468900
1001 Ga0495652_0891320
1002 Ga0495665_0105038
1003 Ga0495640_0052241
1004 Ga0495640_0088962
1005 Ga0495586_0002520
1006 Ga0495587_0006598
1007 Ga0495598_0009375
1008 Ga0495598_0034224
1009 Ga0495621_0147823
1010 Ga0495645_0000603
1011 Ga0495622_0129488
1012 Ga0495667_0018478
1013 Ga0495667_0029410
1014 Ga0495667_0057132
1015 Ga0495667_0310148
1016 Ga0495667_0318879
1017 Ga0495667_0497956
1018 Ga0495656_0138122
1019 Ga0495634_0054095
1020 Ga0495634_0220282
1021 Ga0495635_0023171
1022 Ga0495635_0033793
1023 Ga0495659_0012193
1024 Ga0495659_0237132
1025 Ga0495657_0070948
1026 Ga0495599_0005555
1027 Ga0495599_0106490
1028 Ga0495599_0307209
1029 Ga0495599_0715167
1030 Ga0495623_0157499
1031 Ga0495647_0000090
1032 Ga0495647_0012405
1033 Ga0495647_0074014
1034 Ga0495658_0011617
1035 Ga0495658_0026527
1036 Ga0495669_0491334
1037 Ga0495613_0055700
1038 Ga0495613_0252058
1039 Ga0495624_0448340
1040 Ga0495670_0404305
1041 Ga0495589_0553247
1042 Ga0495600_0014499
1043 Ga0495600_0020078
1044 Ga0495600_0230663
1045 Ga0495600_0446563
1046 Ga0495581_0041692
1047 Ga0495581_0117021
1048 Ga0495604_0029726
1049 Ga0495604_0114670
1050 Ga0495604_0339480
1051 Ga0495604_0407459
1052 Ga0495636_0086086
1053 Ga0495674_0098987
1054 Ga0495674_0127324
1055 Ga0495674_0279034
1056 Ga0495680_0041528
1057 Ga0495680_0194836
1058 Ga0495680_0691492
1059 Ga0495675_0437311
1060 Ga0496106_0082510
1061 Ga0501031_0036298
1062 Ga0501032_0042182
1063 Ga0501033_0009326
1064 Ga0501033_1019585
1065 Ga0501034_0505560
1066 Ga0501036_0001399
1067 Ga0501036_0239992
1068 Ga0501036_0502568
1069 Ga0501036_1714523
1070 Ga0501037_0135029
1071 Ga0501038_0001280
1072 Ga0501038_0213867
1073 Ga0501038_0424688
1074 Ga0501039_0009114
1075 Ga0501039_0023237
1076 Ga0501039_0049645
1077 Ga0501039_0536729
1078 Ga0501040_0002472
1079 Ga0501040_0013157
1080 Ga0501040_0017999
1081 Ga0501040_0021498
1082 Ga0501040_0310157
1083 Ga0501041_0009642
1084 Ga0501041_0041037
1085 Ga0501041_0364569
1086 Ga0501042_0013058
1087 Ga0501042_0035062
1088 Ga0501042_0119810
1089 Ga0501043_0066244
1090 Ga0501043_0176624
1091 Ga0501046_0000393
1092 Ga0501046_0218408
1093 Ga0501046_0730319
1094 Ga0501048_0022699
1095 Ga0501048_0032107
1096 Ga0501048_0076733
1097 Ga0501048_0234448
1098 Ga0501070_0471644
1099 Ga0501071_0105846
1100 Ga0501071_0299784
1101 Ga0501071_0753292
1102 Ga0501071_1193866
1103 Ga0501072_0009110
1104 Ga0501072_0020833
1105 Ga0501072_0072251
1106 Ga0501072_0101047
1107 Ga0501074_0133824
1108 Ga0501074_0563248
1109 Ga0501075_0002673
1110 Ga0501075_0302690
1111 Ga0501076_0010505
1112 Ga0501076_0025401
1113 Ga0501076_0743036
1114 Ga0501077_0029677
1115 Ga0501077_0107268
1116 Ga0501249_195163
1117 Ga0501079_0001171
1118 Ga0501079_0209560
1119 Ga0501079_0267574
1120 Ga0501079_0271618
1121 Ga0501080_0068629
1122 Ga0501080_0992379
1123 Ga0501081_0032206
1124 Ga0501081_0058221
1125 Ga0501081_0873911
1126 Ga0501083_0074798
1127 Ga0501083_0091947
1128 Ga0501035_0042409
1129 Ga0501035_0597628
1130 Ga0501035_0667749
1131 Ga0501044_0099355
1132 Ga0501045_0002025
1133 Ga0501045_0019854
1134 Ga0501045_0194143
1135 Ga0501045_0530706
1136 nmdc:mga03n38_1846_c1
1137 nmdc:mga00v17_81125_c1
1138 nmdc:mga0yw44_34531_c1
1139 nmdc:mga0yw44_55457_c1
1140 nmdc:mga0k408_260271_c1
1141 nmdc:mga06z11_472375_c1
1142 nmdc:mga06z11_7459_c1
1143 nmdc:mga07m45_141205_c1
1144 nmdc:mga05p37_1113688_c1
1145 nmdc:mga05p37_21952_c1
1146 nmdc:mga05p37_318610_c1
1147 nmdc:mga05p37_388465_c1
1148 nmdc:mga05p37_633870_c1
1149 nmdc:mga09592_10611_c1
1150 nmdc:mga09592_108030_c1
1151 nmdc:mga09592_27752_c1
1152 nmdc:mga09592_938820_c1
1153 nmdc:mga0qj67_24541_c1
1154 nmdc:mga0qj67_370101_c1
1155 nmdc:mga0qj67_414337_c1
1156 nmdc:mga0qj67_55690_c1
1157 nmdc:mga0qj67_6657_c1
1158 nmdc:mga06r32_230812_c1
1159 nmdc:mga06r32_68994_c1
1160 nmdc:mga06r32_860591_c1
1161 nmdc:mga08y16_152868_c1
1162 nmdc:mga08y16_174608_c1
1163 nmdc:mga08y16_280217_c1
1164 nmdc:mga0n895_1192625_c1
1165 nmdc:mga0n895_1313725_c1
1166 nmdc:mga0n895_29550_c1
1167 nmdc:mga0n895_56755_c1
1168 nmdc:mga0n895_57140_c1
1169 nmdc:mga0rr50_3216_c1
1170 nmdc:mga0rr50_445537_c1
1171 nmdc:mga08x19_1137390_c1
1172 nmdc:mga08x19_180424_c1
1173 nmdc:mga08x19_2801_c1
1174 nmdc:mga08x19_65142_c1
1175 nmdc:mga0a205_1704_c1
1176 nmdc:mga0a205_832569_c1
1177 nmdc:mga0sz30_2673_c1
1178 Ga0495601_0008392
1179 Ga0495601_0108472
1180 Ga0500646_0001822
1181 Ga0500583_0006293
1182 Ga0500650_0044576
1183 Ga0500642_0156765
1184 Ga0500655_037245
1185 Ga0500568_0010679
1186 Ga0500604_0001465
1187 Ga0500616_0051819
1188 Ga0500637_0132651
1189 Ga0500637_0455121
1190 Ga0501084_0044434
1191 Ga0501084_0103787
1192 Ga0501084_0199944
1193 Ga0501084_0639581
1194 Ga0590071_046164
1195 Ga0590075_102932
1196 Ga0590077_079669
1197 Ga0501082_0004197
1198 Ga0501082_0124632
1199 Ga0501082_0559745
1200 Ga0530510_0000048
1201 Ga0530510_0256251
1202 Ga0530510_0391158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

132

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.8044 1 135
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.8039 2 134
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.7813 1 135
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.7757 1 135
3ey7-assembly1.cif.gz_B structure from the mobile metagenome of v. cholerae. integron cassette protein vch_cass1 0.7746 1 134
ID Description Score Start End Superfamily
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.831 83 135 3.30.720.110
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.804 2 134 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7962 7 135 3.10.180.10
3oajB02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7957 78 134 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.794 3 134 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A537G1I0-F1-model_v4 VOC domain-containing protein 0.973 11 153
AF-A0A537G1I0-F1-model_v4 VOC domain-containing protein 0.9534 11 153
AF-A0A3N5X473-F1-model_v4 VOC domain-containing protein 0.9533 1 149
AF-A0A3D2BRN7-F1-model_v4 VOC domain-containing protein 0.95 1 151
AF-A0A7Y4M4Y4-F1-model_v4 VOC domain-containing protein 0.9491 79 135

Map