F468049
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 601 | 268 | 535 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300006880|Ga0075429_100160624|Ga0075429_1001606242 |
| Length | 309 |
| Sequence | LKPLLPQHGRYDFVPLPERKDYSWPGGKRLAFLLTTNVEWFAFGAGLGHDPAKAGEPQTHRNYAWRDYGNRIGVWRLLELFDELKLPAAHNTNSLVYDYAPQVMAAIRKRGDEVVAHGRTNAENLRGLWQPDEERLLKEVTETIARHEGRPPAGWMGTGAYETAHTLDLLKELGYRYVMDWPMDDQPVWLRTRAGPLLSLPYPIELNDSQVIVHRRQGAAEFCDMVVDQFDEMVGQCERHPLVMNVSVHTYVFGQPFRLRRLRRALQHCMQHPLAPRVWWTRPREVAEHCERLAPGIVPGSPLLSGKTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 157 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 172 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 248 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 249 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 260 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 261 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 262 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 263 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 264 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 265 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.5 |
| Nodule | 0 |
| Rhizoplane | 1 |
| Rhizosphere | 96.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10027380 | 3300003203 | Bacteria | 2187 |
| 2 | Ga0065712_10112361 | 3300005290 | Bacteria | 1801 |
| 3 | Ga0065712_10171761 | 3300005290 | Bacteria | 1240 |
| 4 | Ga0070676_10054557 | 3300005328 | Bacteria | 2356 |
| 5 | Ga0070683_100042288 | 3300005329 | Bacteria | 4196 |
| 6 | Ga0070683_100259914 | 3300005329 | Bacteria | 1651 |
| 7 | Ga0070690_100000569 | 3300005330 | Bacteria | 18589 |
| 8 | Ga0070690_100015303 | 3300005330 | Bacteria | 4573 |
| 9 | Ga0070690_100024340 | 3300005330 | Bacteria | 3722 |
| 10 | Ga0070690_100051358 | 3300005330 | Bacteria | 2632 |
| 11 | Ga0070690_100106878 | 3300005330 | Bacteria | 1862 |
| 12 | Ga0070677_10033068 | 3300005333 | Unclassified | 1988 |
| 13 | Ga0070677_10070892 | 3300005333 | Bacteria | 1466 |
| 14 | Ga0068869_100000727 | 3300005334 | Bacteria | 18759 |
| 15 | Ga0068869_100098099 | 3300005334 | Bacteria | 2213 |
| 16 | Ga0068869_100110789 | 3300005334 | Bacteria | 2088 |
| 17 | Ga0070666_10019897 | 3300005335 | Bacteria | 4336 |
| 18 | Ga0070680_100001166 | 3300005336 | Bacteria | 18880 |
| 19 | Ga0070680_100055213 | 3300005336 | Bacteria | 3246 |
| 20 | Ga0070680_100075327 | 3300005336 | Bacteria | 2778 |
| 21 | Ga0070680_100209513 | 3300005336 | Bacteria | 1644 |
| 22 | Ga0070682_100026721 | 3300005337 | Bacteria | 3458 |
| 23 | Ga0070682_100050434 | 3300005337 | Bacteria | 2598 |
| 24 | Ga0068868_100000716 | 3300005338 | Bacteria | 22378 |
| 25 | Ga0068868_100103275 | 3300005338 | Bacteria | 2309 |
| 26 | Ga0068868_100192749 | 3300005338 | Bacteria | 1695 |
| 27 | Ga0068868_100238149 | 3300005338 | Bacteria | 1528 |
| 28 | Ga0070689_100000798 | 3300005340 | Bacteria | 19377 |
| 29 | Ga0070689_100034383 | 3300005340 | Bacteria | 3867 |
| 30 | Ga0070689_100227338 | 3300005340 | Bacteria | 1533 |
| 31 | Ga0070691_10000223 | 3300005341 | Bacteria | 19212 |
| 32 | Ga0070687_100003027 | 3300005343 | Bacteria | 6461 |
| 33 | Ga0070687_100127964 | 3300005343 | Bacteria | 1463 |
| 34 | Ga0070661_100249383 | 3300005344 | Unclassified | 1369 |
| 35 | Ga0070692_10003091 | 3300005345 | Bacteria | 6657 |
| 36 | Ga0070692_10138357 | 3300005345 | Bacteria | 1375 |
| 37 | Ga0070668_100071747 | 3300005347 | Bacteria | 2698 |
| 38 | Ga0070669_100014122 | 3300005353 | Bacteria | 5682 |
| 39 | Ga0070669_100148772 | 3300005353 | Bacteria | 1811 |
| 40 | Ga0070669_100178419 | 3300005353 | Bacteria | 1660 |
| 41 | Ga0070675_100020836 | 3300005354 | Bacteria | 5233 |
| 42 | Ga0070671_100012340 | 3300005355 | Bacteria | 6880 |
| 43 | Ga0070671_100337533 | 3300005355 | Bacteria | 1285 |
| 44 | Ga0070674_100034607 | 3300005356 | Bacteria | 3375 |
| 45 | Ga0070673_100203434 | 3300005364 | Unclassified | 1706 |
| 46 | Ga0070688_100075935 | 3300005365 | Bacteria | 2161 |
| 47 | Ga0070688_100124647 | 3300005365 | Bacteria | 1730 |
| 48 | Ga0070667_100321398 | 3300005367 | Unclassified | 1396 |
| 49 | Ga0070703_10008430 | 3300005406 | Bacteria | 2898 |
| 50 | Ga0070714_100592491 | 3300005435 | Bacteria | 1064 |
| 51 | Ga0070701_10002181 | 3300005438 | Bacteria | 7459 |
| 52 | Ga0070705_100000565 | 3300005440 | Bacteria | 21451 |
| 53 | Ga0070705_100008174 | 3300005440 | Bacteria | 5174 |
| 54 | Ga0070705_100102990 | 3300005440 | Bacteria | 1807 |
| 55 | Ga0070700_100000265 | 3300005441 | Bacteria | 27920 |
| 56 | Ga0070700_100283158 | 3300005441 | Bacteria | 1203 |
| 57 | Ga0070700_100295320 | 3300005441 | Bacteria | 1180 |
| 58 | Ga0070694_100000584 | 3300005444 | Bacteria | 20131 |
| 59 | Ga0070694_100005795 | 3300005444 | Bacteria | 7495 |
| 60 | Ga0070694_100008158 | 3300005444 | Bacteria | 6394 |
| 61 | Ga0070694_100015352 | 3300005444 | Bacteria | 4809 |
| 62 | Ga0070694_100027884 | 3300005444 | Bacteria | 3671 |
| 63 | Ga0070694_100062976 | 3300005444 | Bacteria | 2535 |
| 64 | Ga0070708_100085748 | 3300005445 | Bacteria | 2859 |
| 65 | Ga0070708_100139193 | 3300005445 | Bacteria | 2250 |
| 66 | Ga0070678_100204434 | 3300005456 | Bacteria | 1632 |
| 67 | Ga0070678_100284528 | 3300005456 | Bacteria | 1399 |
| 68 | Ga0070681_10007341 | 3300005458 | Bacteria | 10768 |
| 69 | Ga0070681_10017899 | 3300005458 | Bacteria | 7082 |
| 70 | Ga0070681_10050204 | 3300005458 | Bacteria | 4163 |
| 71 | Ga0068867_100006495 | 3300005459 | Bacteria | 8260 |
| 72 | Ga0068867_100252721 | 3300005459 | Bacteria | 1434 |
| 73 | Ga0070706_100094706 | 3300005467 | Bacteria | 2771 |
| 74 | Ga0070707_100030431 | 3300005468 | Bacteria | 5140 |
| 75 | Ga0070707_100032470 | 3300005468 | Bacteria | 4975 |
| 76 | Ga0070699_100055168 | 3300005518 | Bacteria | 3441 |
| 77 | Ga0070699_100065005 | 3300005518 | Bacteria | 3165 |
| 78 | Ga0070679_100004913 | 3300005530 | Bacteria | 12333 |
| 79 | Ga0070679_100045732 | 3300005530 | Bacteria | 4362 |
| 80 | Ga0070684_100088585 | 3300005535 | Bacteria | 2750 |
| 81 | Ga0070697_100004116 | 3300005536 | Bacteria | 11145 |
| 82 | Ga0070697_100138959 | 3300005536 | Bacteria | 2042 |
| 83 | Ga0070697_100179151 | 3300005536 | Unclassified | 1796 |
| 84 | Ga0070697_100423611 | 3300005536 | Bacteria | 1157 |
| 85 | Ga0068853_100121010 | 3300005539 | Bacteria | 2335 |
| 86 | Ga0068853_100301215 | 3300005539 | Unclassified | 1482 |
| 87 | Ga0070686_100002546 | 3300005544 | Bacteria | 10047 |
| 88 | Ga0070695_100004011 | 3300005545 | Bacteria | 8606 |
| 89 | Ga0070695_100020688 | 3300005545 | Bacteria | 4019 |
| 90 | Ga0070695_100041853 | 3300005545 | Bacteria | 2905 |
| 91 | Ga0070695_100056782 | 3300005545 | Bacteria | 2527 |
| 92 | Ga0070695_100064538 | 3300005545 | Bacteria | 2383 |
| 93 | Ga0070695_100158500 | 3300005545 | Bacteria | 1586 |
| 94 | Ga0070696_100000689 | 3300005546 | Bacteria | 21599 |
| 95 | Ga0070696_100003145 | 3300005546 | Bacteria | 10989 |
| 96 | Ga0070696_100003505 | 3300005546 | Bacteria | 10431 |
| 97 | Ga0070696_100056110 | 3300005546 | Bacteria | 2747 |
| 98 | Ga0070696_100136829 | 3300005546 | Bacteria | 1786 |
| 99 | Ga0070696_100256437 | 3300005546 | Bacteria | 1324 |
| 100 | Ga0070696_100325644 | 3300005546 | Bacteria | 1184 |
| 101 | Ga0070693_100000145 | 3300005547 | Bacteria | 32140 |
| 102 | Ga0070693_100189004 | 3300005547 | Unclassified | 1331 |
| 103 | Ga0070665_100491272 | 3300005548 | Bacteria | 1238 |
| 104 | Ga0070704_100003704 | 3300005549 | Bacteria | 8802 |
| 105 | Ga0068855_100012503 | 3300005563 | Bacteria | 10246 |
| 106 | Ga0070664_100081490 | 3300005564 | Unclassified | 2789 |
| 107 | Ga0068857_100249863 | 3300005577 | Bacteria | 1626 |
| 108 | Ga0068854_100001523 | 3300005578 | Bacteria | 14057 |
| 109 | Ga0068854_100007979 | 3300005578 | Bacteria | 6780 |
| 110 | Ga0068856_100026262 | 3300005614 | Bacteria | 5679 |
| 111 | Ga0068856_100072061 | 3300005614 | Bacteria | 3421 |
| 112 | Ga0070702_100000200 | 3300005615 | Bacteria | 19548 |
| 113 | Ga0070702_100128441 | 3300005615 | Unclassified | 1597 |
| 114 | Ga0070702_100245956 | 3300005615 | Bacteria | 1210 |
| 115 | Ga0068852_100034260 | 3300005616 | Bacteria | 4222 |
| 116 | Ga0068852_100244240 | 3300005616 | Bacteria | 1717 |
| 117 | Ga0068852_100523772 | 3300005616 | Bacteria | 1183 |
| 118 | Ga0068859_100008918 | 3300005617 | Bacteria | 10129 |
| 119 | Ga0068859_100451914 | 3300005617 | Bacteria | 1381 |
| 120 | Ga0068866_10000312 | 3300005718 | Bacteria | 23103 |
| 121 | Ga0068861_100003520 | 3300005719 | Bacteria | 10408 |
| 122 | Ga0068861_100012712 | 3300005719 | Bacteria | 5874 |
| 123 | Ga0068870_10007393 | 3300005840 | Bacteria | 4893 |
| 124 | Ga0068870_10065883 | 3300005840 | Bacteria | 1961 |
| 125 | Ga0068870_10213603 | 3300005840 | Bacteria | 1177 |
| 126 | Ga0068863_100078710 | 3300005841 | Bacteria | 3122 |
| 127 | Ga0068863_100241642 | 3300005841 | Bacteria | 1743 |
| 128 | Ga0068858_100022350 | 3300005842 | Bacteria | 5904 |
| 129 | Ga0068858_100040094 | 3300005842 | Bacteria | 4342 |
| 130 | Ga0068858_100382101 | 3300005842 | Bacteria | 1351 |
| 131 | Ga0068860_100011647 | 3300005843 | Bacteria | 8673 |
| 132 | Ga0068860_100059911 | 3300005843 | Bacteria | 3618 |
| 133 | Ga0068862_100014677 | 3300005844 | Bacteria | 6507 |
| 134 | Ga0068862_100044129 | 3300005844 | Bacteria | 3803 |
| 135 | Ga0068862_100149671 | 3300005844 | Bacteria | 2077 |
| 136 | Ga0081539_10004639 | 3300005985 | Bacteria | 14959 |
| 137 | Ga0075363_100069621 | 3300006048 | Unclassified | 1909 |
| 138 | Ga0075364_10110589 | 3300006051 | Unclassified | 1833 |
| 139 | Ga0075362_10018242 | 3300006177 | Bacteria | 2900 |
| 140 | Ga0097621_100001046 | 3300006237 | Bacteria | 19426 |
| 141 | Ga0097621_100006938 | 3300006237 | Bacteria | 8063 |
| 142 | Ga0097621_100055613 | 3300006237 | Bacteria | 3232 |
| 143 | Ga0097621_100171278 | 3300006237 | Bacteria | 1871 |
| 144 | Ga0075370_10050366 | 3300006353 | Bacteria | 2362 |
| 145 | Ga0068871_100000265 | 3300006358 | Bacteria | 36023 |
| 146 | Ga0068871_100003199 | 3300006358 | Bacteria | 11236 |
| 147 | Ga0068871_100006079 | 3300006358 | Bacteria | 8496 |
| 148 | Ga0075428_100016392 | 3300006844 | Bacteria | 8188 |
| 149 | Ga0075428_100223785 | 3300006844 | Bacteria | 2032 |
| 150 | Ga0075428_100243616 | 3300006844 | Bacteria | 1939 |
| 151 | Ga0075428_100272128 | 3300006844 | Bacteria | 1822 |
| 152 | Ga0075430_100002769 | 3300006846 | Bacteria | 14650 |
| 153 | Ga0075430_100006542 | 3300006846 | Bacteria | 9828 |
| 154 | Ga0075430_100119121 | 3300006846 | Bacteria | 2200 |
| 155 | Ga0075431_100005545 | 3300006847 | Bacteria | 12458 |
| 156 | Ga0075431_100021784 | 3300006847 | Bacteria | 6552 |
| 157 | Ga0075431_100059936 | 3300006847 | Bacteria | 3928 |
| 158 | Ga0075431_100133137 | 3300006847 | Bacteria | 2564 |
| 159 | Ga0075431_100211314 | 3300006847 | Bacteria | 1982 |
| 160 | Ga0075431_100610129 | 3300006847 | Unclassified | 1074 |
| 161 | Ga0075433_10000585 | 3300006852 | Bacteria | 24157 |
| 162 | Ga0075434_100000221 | 3300006871 | Bacteria | 38986 |
| 163 | Ga0075434_100157400 | 3300006871 | Unclassified | 2291 |
| 164 | Ga0075429_100001446 | 3300006880 | Bacteria | 19502 |
| 165 | Ga0075429_100025305 | 3300006880 | Bacteria | 5151 |
| 166 | Ga0075429_100084949 | 3300006880 | Bacteria | 2759 |
| 167 | Ga0075429_100160624 | 3300006880 | Bacteria | 1968 |
| 168 | Ga0068865_100000608 | 3300006881 | Bacteria | 20073 |
| 169 | Ga0068865_100014208 | 3300006881 | Bacteria | 5054 |
| 170 | Ga0075436_100000262 | 3300006914 | Bacteria | 32984 |
| 171 | Ga0075436_100001062 | 3300006914 | Bacteria | 18522 |
| 172 | Ga0075436_100018581 | 3300006914 | Bacteria | 4758 |
| 173 | Ga0075436_100029416 | 3300006914 | Bacteria | 3778 |
| 174 | Ga0075436_100079549 | 3300006914 | Bacteria | 2271 |
| 175 | Ga0075436_100083728 | 3300006914 | Bacteria | 2213 |
| 176 | Ga0075436_100092661 | 3300006914 | Bacteria | 2101 |
| 177 | Ga0097620_100008919 | 3300006931 | Bacteria | 10129 |
| 178 | Ga0097620_100451935 | 3300006931 | Bacteria | 1381 |
| 179 | Ga0075435_100001563 | 3300007076 | Bacteria | 14769 |
| 180 | Ga0075435_100133190 | 3300007076 | Bacteria | 2080 |
| 181 | Ga0075435_100387349 | 3300007076 | Unclassified | 1201 |
| 182 | Ga0099794_10013995 | 3300007265 | Bacteria | 3504 |
| 183 | Ga0099794_10099175 | 3300007265 | Bacteria | 1453 |
| 184 | Ga0111539_10012682 | 3300009094 | Bacteria | 10557 |
| 185 | Ga0111539_10035511 | 3300009094 | Bacteria | 6034 |
| 186 | Ga0111539_10102637 | 3300009094 | Bacteria | 3357 |
| 187 | Ga0111539_10114889 | 3300009094 | Bacteria | 3157 |
| 188 | Ga0111539_10206496 | 3300009094 | Bacteria | 2289 |
| 189 | Ga0111539_10304019 | 3300009094 | Bacteria | 1856 |
| 190 | Ga0111539_10406765 | 3300009094 | Bacteria | 1585 |
| 191 | Ga0111539_10574232 | 3300009094 | Bacteria | 1313 |
| 192 | Ga0111539_10591072 | 3300009094 | Bacteria | 1293 |
| 193 | Ga0105245_10007488 | 3300009098 | Bacteria | 9565 |
| 194 | Ga0114129_10014716 | 3300009147 | Bacteria | 11145 |
| 195 | Ga0114129_10117651 | 3300009147 | Bacteria | 3661 |
| 196 | Ga0114129_10267819 | 3300009147 | Bacteria | 2287 |
| 197 | Ga0105243_10004754 | 3300009148 | Bacteria | 10674 |
| 198 | Ga0105243_10009731 | 3300009148 | Bacteria | 7322 |
| 199 | Ga0105241_10015458 | 3300009174 | Bacteria | 5591 |
| 200 | Ga0105242_10000646 | 3300009176 | Bacteria | 27269 |
| 201 | Ga0105249_10011456 | 3300009553 | Bacteria | 7788 |
| 202 | Ga0105249_10262794 | 3300009553 | Bacteria | 1716 |
| 203 | Ga0105246_10069838 | 3300011119 | Bacteria | 2468 |
| 204 | Ga0105246_10076027 | 3300011119 | Bacteria | 2378 |
| 205 | Ga0105246_10538435 | 3300011119 | Bacteria | 998 |
| 206 | Ga0157374_10205469 | 3300013296 | Bacteria | 1930 |
| 207 | Ga0157378_10002299 | 3300013297 | Bacteria | 16986 |
| 208 | Ga0157378_10003345 | 3300013297 | Bacteria | 14263 |
| 209 | Ga0163162_10058122 | 3300013306 | Bacteria | 3896 |
| 210 | Ga0163162_10365175 | 3300013306 | Bacteria | 1576 |
| 211 | Ga0157375_10029222 | 3300013308 | Bacteria | 5181 |
| 212 | Ga0157375_10075450 | 3300013308 | Bacteria | 3396 |
| 213 | Ga0157375_10573278 | 3300013308 | Bacteria | 1289 |
| 214 | Ga0163163_10543395 | 3300014325 | Bacteria | 1224 |
| 215 | Ga0157380_10077505 | 3300014326 | Bacteria | 2709 |
| 216 | Ga0157380_10156053 | 3300014326 | Bacteria | 1978 |
| 217 | Ga0157377_10062209 | 3300014745 | Bacteria | 2135 |
| 218 | Ga0157379_10110606 | 3300014968 | Bacteria | 2467 |
| 219 | Ga0157376_10003492 | 3300014969 | Bacteria | 10836 |
| 220 | Ga0157376_10023911 | 3300014969 | Bacteria | 4791 |
| 221 | Ga0157376_10396030 | 3300014969 | Bacteria | 1334 |
| 222 | Ga0157376_10608592 | 3300014969 | Bacteria | 1088 |
| 223 | Ga0207697_10004195 | 3300025315 | Bacteria | 6930 |
| 224 | Ga0207653_10016885 | 3300025885 | Bacteria | 2295 |
| 225 | Ga0207682_10003415 | 3300025893 | Bacteria | 6909 |
| 226 | Ga0207682_10005427 | 3300025893 | Bacteria | 5189 |
| 227 | Ga0207682_10031294 | 3300025893 | Bacteria | 2135 |
| 228 | Ga0207642_10000981 | 3300025899 | Bacteria | 8904 |
| 229 | Ga0207642_10080219 | 3300025899 | Bacteria | 1582 |
| 230 | Ga0207688_10008300 | 3300025901 | Bacteria | 5646 |
| 231 | Ga0207680_10009205 | 3300025903 | Bacteria | 4884 |
| 232 | Ga0207680_10140942 | 3300025903 | Bacteria | 1598 |
| 233 | Ga0207645_10006949 | 3300025907 | Bacteria | 8060 |
| 234 | Ga0207645_10098736 | 3300025907 | Bacteria | 1883 |
| 235 | Ga0207643_10010297 | 3300025908 | Bacteria | 5031 |
| 236 | Ga0207643_10014651 | 3300025908 | Bacteria | 4262 |
| 237 | Ga0207643_10028804 | 3300025908 | Bacteria | 3086 |
| 238 | Ga0207684_10031595 | 3300025910 | Bacteria | 4503 |
| 239 | Ga0207684_10092168 | 3300025910 | Unclassified | 2582 |
| 240 | Ga0207684_10256637 | 3300025910 | Bacteria | 1508 |
| 241 | Ga0207654_10021198 | 3300025911 | Bacteria | 3452 |
| 242 | Ga0207707_10055304 | 3300025912 | Unclassified | 3452 |
| 243 | Ga0207707_10167462 | 3300025912 | Unclassified | 1920 |
| 244 | Ga0207707_10325691 | 3300025912 | Bacteria | 1326 |
| 245 | Ga0207660_10001221 | 3300025917 | Bacteria | 17201 |
| 246 | Ga0207660_10029306 | 3300025917 | Bacteria | 3774 |
| 247 | Ga0207660_10130001 | 3300025917 | Bacteria | 1916 |
| 248 | Ga0207660_10213231 | 3300025917 | Bacteria | 1513 |
| 249 | Ga0207662_10002183 | 3300025918 | Bacteria | 9758 |
| 250 | Ga0207652_10057958 | 3300025921 | Bacteria | 3336 |
| 251 | Ga0207646_10297725 | 3300025922 | Bacteria | 1458 |
| 252 | Ga0207681_10002576 | 3300025923 | Bacteria | 11497 |
| 253 | Ga0207650_10017951 | 3300025925 | Bacteria | 4958 |
| 254 | Ga0207659_10018543 | 3300025926 | Bacteria | 4564 |
| 255 | Ga0207659_10038266 | 3300025926 | Bacteria | 3335 |
| 256 | Ga0207659_10040969 | 3300025926 | Bacteria | 3242 |
| 257 | Ga0207687_10003360 | 3300025927 | Bacteria | 10811 |
| 258 | Ga0207687_10008829 | 3300025927 | Bacteria | 6587 |
| 259 | Ga0207664_10481737 | 3300025929 | Bacteria | 1110 |
| 260 | Ga0207644_10000583 | 3300025931 | Bacteria | 23344 |
| 261 | Ga0207644_10272606 | 3300025931 | Bacteria | 1356 |
| 262 | Ga0207706_10035583 | 3300025933 | Bacteria | 4426 |
| 263 | Ga0207686_10001709 | 3300025934 | Bacteria | 12226 |
| 264 | Ga0207709_10002039 | 3300025935 | Bacteria | 13087 |
| 265 | Ga0207670_10005788 | 3300025936 | Bacteria | 6823 |
| 266 | Ga0207670_10026604 | 3300025936 | Bacteria | 3647 |
| 267 | Ga0207670_10073521 | 3300025936 | Bacteria | 2371 |
| 268 | Ga0207670_10080609 | 3300025936 | Bacteria | 2276 |
| 269 | Ga0207704_10000577 | 3300025938 | Bacteria | 16325 |
| 270 | Ga0207704_10201817 | 3300025938 | Bacteria | 1456 |
| 271 | Ga0207665_10064185 | 3300025939 | Bacteria | 2495 |
| 272 | Ga0207665_10099998 | 3300025939 | Bacteria | 2023 |
| 273 | Ga0207691_10000948 | 3300025940 | Bacteria | 28719 |
| 274 | Ga0207691_10144747 | 3300025940 | Bacteria | 2093 |
| 275 | Ga0207711_10105660 | 3300025941 | Bacteria | 2497 |
| 276 | Ga0207689_10001695 | 3300025942 | Bacteria | 20948 |
| 277 | Ga0207689_10004523 | 3300025942 | Bacteria | 12591 |
| 278 | Ga0207689_10018441 | 3300025942 | Bacteria | 5890 |
| 279 | Ga0207689_10047407 | 3300025942 | Bacteria | 3548 |
| 280 | Ga0207689_10048356 | 3300025942 | Bacteria | 3508 |
| 281 | Ga0207661_10283418 | 3300025944 | Unclassified | 1481 |
| 282 | Ga0207667_10016185 | 3300025949 | Bacteria | 8431 |
| 283 | Ga0207651_10073229 | 3300025960 | Unclassified | 2435 |
| 284 | Ga0207651_10260283 | 3300025960 | Bacteria | 1424 |
| 285 | Ga0207651_10273517 | 3300025960 | Bacteria | 1392 |
| 286 | Ga0207712_10026104 | 3300025961 | Bacteria | 3889 |
| 287 | Ga0207640_10007759 | 3300025981 | Bacteria | 5926 |
| 288 | Ga0207677_10002281 | 3300026023 | Bacteria | 10074 |
| 289 | Ga0207677_10328826 | 3300026023 | Bacteria | 1273 |
| 290 | Ga0207703_10006142 | 3300026035 | Bacteria | 9612 |
| 291 | Ga0207703_10028893 | 3300026035 | Bacteria | 4376 |
| 292 | Ga0207639_10060460 | 3300026041 | Bacteria | 2923 |
| 293 | Ga0207639_10133954 | 3300026041 | Bacteria | 2055 |
| 294 | Ga0207639_10172612 | 3300026041 | Unclassified | 1832 |
| 295 | Ga0207708_10000723 | 3300026075 | Bacteria | 24861 |
| 296 | Ga0207708_10011989 | 3300026075 | Bacteria | 6459 |
| 297 | Ga0207708_10012792 | 3300026075 | Bacteria | 6259 |
| 298 | Ga0207708_10098180 | 3300026075 | Bacteria | 2264 |
| 299 | Ga0207708_10355592 | 3300026075 | Bacteria | 1203 |
| 300 | Ga0207708_10391022 | 3300026075 | Bacteria | 1148 |
| 301 | Ga0207702_10040706 | 3300026078 | Bacteria | 3895 |
| 302 | Ga0207641_10210469 | 3300026088 | Bacteria | 1798 |
| 303 | Ga0207648_10001968 | 3300026089 | Bacteria | 22433 |
| 304 | Ga0207648_10008599 | 3300026089 | Bacteria | 9873 |
| 305 | Ga0207648_10024176 | 3300026089 | Bacteria | 5428 |
| 306 | Ga0207648_10159375 | 3300026089 | Bacteria | 1993 |
| 307 | Ga0207676_10332815 | 3300026095 | Bacteria | 1398 |
| 308 | Ga0207674_10038517 | 3300026116 | Bacteria | 4960 |
| 309 | Ga0207675_100002725 | 3300026118 | Bacteria | 17414 |
| 310 | Ga0207675_100018330 | 3300026118 | Bacteria | 6527 |
| 311 | Ga0207675_100025078 | 3300026118 | Bacteria | 5549 |
| 312 | Ga0207675_100491091 | 3300026118 | Bacteria | 1221 |
| 313 | Ga0207683_10000313 | 3300026121 | Bacteria | 44050 |
| 314 | Ga0207683_10072035 | 3300026121 | Bacteria | 3056 |
| 315 | Ga0207683_10115120 | 3300026121 | Bacteria | 2410 |
| 316 | Ga0207683_10202488 | 3300026121 | Bacteria | 1805 |
| 317 | Ga0207683_10355560 | 3300026121 | Bacteria | 1345 |
| 318 | Ga0207698_10007556 | 3300026142 | Bacteria | 6815 |
| 319 | Ga0207698_10307396 | 3300026142 | Bacteria | 1479 |
| 320 | Ga0209969_1000257 | 3300027360 | Bacteria | 7078 |
| 321 | Ga0209996_1011813 | 3300027395 | Bacteria | 1169 |
| 322 | Ga0209995_1009346 | 3300027471 | Bacteria | 1584 |
| 323 | Ga0209995_1010382 | 3300027471 | Bacteria | 1510 |
| 324 | Ga0209999_1024424 | 3300027543 | Bacteria | 1115 |
| 325 | Ga0209588_1054579 | 3300027671 | Bacteria | 1292 |
| 326 | Ga0209971_1006911 | 3300027682 | Bacteria | 2691 |
| 327 | Ga0209974_10006565 | 3300027876 | Bacteria | 4055 |
| 328 | Ga0207428_10002376 | 3300027907 | Bacteria | 18802 |
| 329 | Ga0207428_10012481 | 3300027907 | Bacteria | 7462 |
| 330 | Ga0207428_10038351 | 3300027907 | Bacteria | 3895 |
| 331 | Ga0207428_10300676 | 3300027907 | Bacteria | 1187 |
| 332 | Ga0268265_10001655 | 3300028380 | Bacteria | 18241 |
| 333 | Ga0268265_10003024 | 3300028380 | Bacteria | 12268 |
| 334 | Ga0268265_10081790 | 3300028380 | Bacteria | 2551 |
| 335 | Ga0268265_10179199 | 3300028380 | Bacteria | 1819 |
| 336 | Ga0268265_10250309 | 3300028380 | Bacteria | 1569 |
| 337 | Ga0268265_10259498 | 3300028380 | Bacteria | 1544 |
| 338 | Ga0268264_10006262 | 3300028381 | Bacteria | 10039 |
| 339 | Ga0265318_10098547 | 3300028577 | Bacteria | 1076 |
| 340 | Ga0307515_10197509 | 3300028794 | Bacteria | 1899 |
| 341 | Ga0307511_10000708 | 3300030521 | Bacteria | 35517 |
| 342 | Ga0307408_100005606 | 3300031548 | Bacteria | 8390 |
| 343 | Ga0307408_100024448 | 3300031548 | Bacteria | 4126 |
| 344 | Ga0307408_100155943 | 3300031548 | Bacteria | 1808 |
| 345 | Ga0307408_100210475 | 3300031548 | Bacteria | 1580 |
| 346 | Ga0307408_100210641 | 3300031548 | Unclassified | 1579 |
| 347 | Ga0265314_10085483 | 3300031711 | Bacteria | 2068 |
| 348 | Ga0307405_10014840 | 3300031731 | Bacteria | 4202 |
| 349 | Ga0307405_10183956 | 3300031731 | Bacteria | 1503 |
| 350 | Ga0307413_10168746 | 3300031824 | Bacteria | 1546 |
| 351 | Ga0307410_10002526 | 3300031852 | Bacteria | 8847 |
| 352 | Ga0307410_10016677 | 3300031852 | Bacteria | 4389 |
| 353 | Ga0307410_10084494 | 3300031852 | Bacteria | 2238 |
| 354 | Ga0307406_10001695 | 3300031901 | Bacteria | 12103 |
| 355 | Ga0307407_10006223 | 3300031903 | Bacteria | 5275 |
| 356 | Ga0307412_10093104 | 3300031911 | Bacteria | 2113 |
| 357 | Ga0307409_100047017 | 3300031995 | Bacteria | 3271 |
| 358 | Ga0307416_100003872 | 3300032002 | Bacteria | 8910 |
| 359 | Ga0307416_100042677 | 3300032002 | Bacteria | 3543 |
| 360 | Ga0307416_100071962 | 3300032002 | Bacteria | 2875 |
| 361 | Ga0307416_100099492 | 3300032002 | Bacteria | 2525 |
| 362 | Ga0307416_100335862 | 3300032002 | Bacteria | 1521 |
| 363 | Ga0307411_10102916 | 3300032005 | Bacteria | 2025 |
| 364 | Ga0307411_10401099 | 3300032005 | Bacteria | 1134 |
| 365 | Ga0373930_0033458 | 3300034816 | Bacteria | 1067 |
| 366 | Ga0373950_0030012 | 3300034818 | Bacteria | 1003 |
| 367 | Ga0373926_0001197 | 3300035083 | Bacteria | 7765 |
| 368 | Ga0373928_0019485 | 3300035084 | Bacteria | 1416 |
| 369 | Ga0373949_0006365 | 3300035090 | Bacteria | 2598 |
| 370 | Ga0373952_0025807 | 3300035092 | Bacteria | 1272 |
| 371 | Ga0373952_0028312 | 3300035092 | Bacteria | 1228 |
| 372 | Ga0373932_0008856 | 3300035112 | Bacteria | 2409 |
| 373 | Ga0373936_0144638 | 3300035113 | Bacteria | 1028 |
| 374 | Ga0373945_0002628 | 3300035116 | Bacteria | 5627 |
| 375 | Ga0373946_0001086 | 3300035171 | Bacteria | 9377 |
| 376 | Ga0373961_0008126 | 3300035241 | Bacteria | 2550 |
| 377 | Ga0373931_0006583 | 3300035691 | Bacteria | 5435 |
| 378 | Ga0373931_0039864 | 3300035691 | Bacteria | 2461 |
| 379 | Ga0373935_0070343 | 3300035692 | Bacteria | 2255 |
| 380 | Ga0373927_0030989 | 3300035695 | Bacteria | 3488 |
| 381 | Ga0373925_0021528 | 3300037068 | Bacteria | 4698 |
| 382 | Ga0451577_0008898 | 3300042876 | Bacteria | 9720 |
| 383 | Ga0451577_0057302 | 3300042876 | Bacteria | 3474 |
| 384 | Ga0451577_0311875 | 3300042876 | Bacteria | 1426 |
| 385 | Ga0466964_0080392 | 3300044706 | Bacteria | 1398 |
| 386 | Ga0453684_0273586 | 3300044712 | Bacteria | 1929 |
| 387 | Ga0451576_0026374 | 3300045051 | Bacteria | 6251 |
| 388 | Ga0451576_0063476 | 3300045051 | Bacteria | 3850 |
| 389 | Ga0451576_0149596 | 3300045051 | Bacteria | 2435 |
| 390 | Ga0451576_0188049 | 3300045051 | Bacteria | 2156 |
| 391 | Ga0451576_0205305 | 3300045051 | Bacteria | 2057 |
| 392 | Ga0451576_0469638 | 3300045051 | Bacteria | 1321 |
| 393 | Ga0466967_0008630 | 3300045976 | Bacteria | 7492 |
| 394 | Ga0495592_0218138 | 3300046454 | Bacteria | 1277 |
| 395 | Ga0495603_0015377 | 3300046455 | Bacteria | 4630 |
| 396 | Ga0495629_0055613 | 3300046459 | Bacteria | 2767 |
| 397 | Ga0495580_0008572 | 3300046472 | Bacteria | 8112 |
| 398 | Ga0495582_0021379 | 3300046473 | Bacteria | 3541 |
| 399 | Ga0495662_0022332 | 3300046476 | Bacteria | 3056 |
| 400 | Ga0495594_0066301 | 3300046499 | Bacteria | 2003 |
| 401 | Ga0495618_0122579 | 3300046514 | Bacteria | 1665 |
| 402 | Ga0495628_0066781 | 3300046516 | Bacteria | 2811 |
| 403 | Ga0495630_0026993 | 3300046517 | Bacteria | 4256 |
| 404 | Ga0495666_0011053 | 3300046526 | Bacteria | 4504 |
| 405 | Ga0495642_0007460 | 3300046528 | Bacteria | 4192 |
| 406 | Ga0495642_0022793 | 3300046528 | Bacteria | 2469 |
| 407 | Ga0495665_0015964 | 3300046531 | Bacteria | 4046 |
| 408 | Ga0495586_0010979 | 3300046535 | Bacteria | 4811 |
| 409 | Ga0495598_0004202 | 3300046537 | Bacteria | 3106 |
| 410 | Ga0495598_0067107 | 3300046537 | Bacteria | 1121 |
| 411 | Ga0495659_0043079 | 3300046664 | Bacteria | 1618 |
| 412 | Ga0495588_0006001 | 3300046674 | Bacteria | 5450 |
| 413 | Ga0495658_0005601 | 3300046683 | Bacteria | 6172 |
| 414 | Ga0495669_0032906 | 3300046684 | Bacteria | 2281 |
| 415 | Ga0495669_0051626 | 3300046684 | Bacteria | 1846 |
| 416 | Ga0495670_0032545 | 3300046691 | Bacteria | 2594 |
| 417 | Ga0495581_0101163 | 3300047315 | Bacteria | 1674 |
| 418 | Ga0495676_0016910 | 3300047321 | Bacteria | 6458 |
| 419 | Ga0495614_0112752 | 3300048089 | Bacteria | 1195 |
| 420 | Ga0496104_0199888 | 3300048907 | Bacteria | 1911 |
| 421 | Ga0496106_0170045 | 3300048909 | Bacteria | 1727 |
| 422 | Ga0496107_0098053 | 3300048910 | Bacteria | 2147 |
| 423 | Ga0496110_0130873 | 3300048913 | Bacteria | 2266 |
| 424 | Ga0496110_0478313 | 3300048913 | Bacteria | 1135 |
| 425 | Ga0496115_0367035 | 3300048918 | Bacteria | 1172 |
| 426 | Ga0501292_011490 | 3300049515 | Unclassified | 1341 |
| 427 | Ga0501031_0099438 | 3300049568 | Bacteria | 1898 |
| 428 | Ga0501032_0046821 | 3300049569 | Bacteria | 2922 |
| 429 | Ga0501033_0004209 | 3300049570 | Bacteria | 11581 |
| 430 | Ga0501033_0084106 | 3300049570 | Bacteria | 2332 |
| 431 | Ga0501034_0016205 | 3300049571 | Bacteria | 7646 |
| 432 | Ga0501036_0002503 | 3300049572 | Bacteria | 14414 |
| 433 | Ga0501036_0091684 | 3300049572 | Bacteria | 2567 |
| 434 | Ga0501036_0236955 | 3300049572 | Unclassified | 1531 |
| 435 | Ga0501037_0085020 | 3300049573 | Bacteria | 2290 |
| 436 | Ga0501038_0006655 | 3300049574 | Bacteria | 10683 |
| 437 | Ga0501039_0005669 | 3300049575 | Bacteria | 9453 |
| 438 | Ga0501039_0057373 | 3300049575 | Bacteria | 3015 |
| 439 | Ga0501040_0001508 | 3300049576 | Bacteria | 14780 |
| 440 | Ga0501041_0000398 | 3300049577 | Bacteria | 21891 |
| 441 | Ga0501042_0001320 | 3300049578 | Bacteria | 14461 |
| 442 | Ga0501042_0070336 | 3300049578 | Bacteria | 2503 |
| 443 | Ga0501042_0328063 | 3300049578 | Bacteria | 1106 |
| 444 | Ga0501043_0006920 | 3300049579 | Bacteria | 9046 |
| 445 | Ga0501043_0291833 | 3300049579 | Bacteria | 1248 |
| 446 | Ga0501046_0000393 | 3300049580 | Bacteria | 43715 |
| 447 | Ga0501046_0033459 | 3300049580 | Bacteria | 4153 |
| 448 | Ga0501048_0000181 | 3300049582 | Bacteria | 39855 |
| 449 | Ga0501048_0094342 | 3300049582 | Bacteria | 2111 |
| 450 | Ga0501048_0094801 | 3300049582 | Bacteria | 2105 |
| 451 | Ga0501067_0030352 | 3300049583 | Bacteria | 2998 |
| 452 | Ga0501068_0003002 | 3300049584 | Bacteria | 8994 |
| 453 | Ga0501069_0029677 | 3300049585 | Unclassified | 3002 |
| 454 | Ga0501072_0001849 | 3300049588 | Bacteria | 15752 |
| 455 | Ga0501072_0009997 | 3300049588 | Bacteria | 7215 |
| 456 | Ga0501072_0216442 | 3300049588 | Bacteria | 1527 |
| 457 | Ga0501072_0320455 | 3300049588 | Bacteria | 1232 |
| 458 | Ga0501073_0188266 | 3300049589 | Bacteria | 1428 |
| 459 | Ga0501074_0033418 | 3300049590 | Bacteria | 3727 |
| 460 | Ga0501075_0000242 | 3300049591 | Bacteria | 29265 |
| 461 | Ga0501075_0004582 | 3300049591 | Bacteria | 9370 |
| 462 | Ga0501076_0001073 | 3300049592 | Bacteria | 17968 |
| 463 | Ga0501076_0165838 | 3300049592 | Bacteria | 1800 |
| 464 | Ga0501077_0002349 | 3300049593 | Bacteria | 11401 |
| 465 | Ga0501077_0072244 | 3300049593 | Bacteria | 2186 |
| 466 | Ga0501077_0121031 | 3300049593 | Bacteria | 1659 |
| 467 | Ga0501079_0002630 | 3300049741 | Bacteria | 13065 |
| 468 | Ga0501079_0017772 | 3300049741 | Bacteria | 5434 |
| 469 | Ga0501079_0236362 | 3300049741 | Bacteria | 1428 |
| 470 | Ga0501080_0002206 | 3300049742 | Bacteria | 16926 |
| 471 | Ga0501080_0046509 | 3300049742 | Bacteria | 4040 |
| 472 | Ga0501081_0000938 | 3300049743 | Bacteria | 17301 |
| 473 | Ga0501081_0004554 | 3300049743 | Bacteria | 8901 |
| 474 | Ga0501081_0081512 | 3300049743 | Bacteria | 2266 |
| 475 | Ga0501035_0003028 | 3300049822 | Bacteria | 16113 |
| 476 | Ga0501035_0025821 | 3300049822 | Bacteria | 5383 |
| 477 | Ga0501044_0000255 | 3300049823 | Bacteria | 67530 |
| 478 | Ga0501044_0073394 | 3300049823 | Bacteria | 3478 |
| 479 | Ga0501045_0010531 | 3300049824 | Bacteria | 6475 |
| 480 | Ga0501045_0030952 | 3300049824 | Bacteria | 3875 |
| 481 | Ga0501045_0069481 | 3300049824 | Bacteria | 2589 |
| 482 | Ga0501045_0263879 | 3300049824 | Bacteria | 1282 |
| 483 | nmdc:mga0k408_88057_c1 | 3300050493 | Unclassified | 1824 |
| 484 | nmdc:mga04h51_6567_c1 | 3300050495 | Bacteria | 3023 |
| 485 | nmdc:mga07m45_74350_c1 | 3300050496 | Bacteria | 1936 |
| 486 | nmdc:mga05p37_117796_c1 | 3300050507 | Bacteria | 3263 |
| 487 | nmdc:mga05p37_24008_c1 | 3300050507 | Bacteria | 7406 |
| 488 | nmdc:mga05p37_274434_c1 | 3300050507 | Bacteria | 2013 |
| 489 | nmdc:mga09592_19475_c1 | 3300050508 | Bacteria | 5572 |
| 490 | nmdc:mga09592_251016_c1 | 3300050508 | Bacteria | 1534 |
| 491 | nmdc:mga09592_2982_c1 | 3300050508 | Bacteria | 13724 |
| 492 | nmdc:mga0qj67_226236_c1 | 3300050509 | Bacteria | 1518 |
| 493 | nmdc:mga0qj67_337046_c1 | 3300050509 | Unclassified | 1220 |
| 494 | nmdc:mga0qj67_36587_c1 | 3300050509 | Bacteria | 3842 |
| 495 | nmdc:mga0qj67_91441_c1 | 3300050509 | Bacteria | 2446 |
| 496 | nmdc:mga06r32_97914_c1 | 3300050510 | Bacteria | 2875 |
| 497 | nmdc:mga08y16_127092_c1 | 3300050511 | Bacteria | 2652 |
| 498 | nmdc:mga08y16_16853_c1 | 3300050511 | Bacteria | 7691 |
| 499 | nmdc:mga08y16_48515_c1 | 3300050511 | Bacteria | 4444 |
| 500 | nmdc:mga08y16_545705_c1 | 3300050511 | Bacteria | 1174 |
| 501 | nmdc:mga08y16_57930_c1 | 3300050511 | Bacteria | 4048 |
| 502 | nmdc:mga08y16_68383_c1 | 3300050511 | Bacteria | 3703 |
| 503 | nmdc:mga08y16_76545_c1 | 3300050511 | Bacteria | 3488 |
| 504 | nmdc:mga08y16_82303_c1 | 3300050511 | Bacteria | 3356 |
| 505 | nmdc:mga0n895_116567_c1 | 3300050512 | Bacteria | 2690 |
| 506 | nmdc:mga0n895_129562_c1 | 3300050512 | Unclassified | 2547 |
| 507 | nmdc:mga0n895_1538_c1 | 3300050512 | Bacteria | 17331 |
| 508 | nmdc:mga0n895_169620_c1 | 3300050512 | Bacteria | 2214 |
| 509 | nmdc:mga0n895_3919_c1 | 3300050512 | Bacteria | 12090 |
| 510 | nmdc:mga0n895_9771_c1 | 3300050512 | Bacteria | 8421 |
| 511 | nmdc:mga0rr50_26358_c1 | 3300050513 | Bacteria | 4054 |
| 512 | nmdc:mga0rr50_681_c1 | 3300050513 | Bacteria | 18200 |
| 513 | nmdc:mga08x19_225242_c1 | 3300050514 | Bacteria | 1289 |
| 514 | nmdc:mga08x19_23420_c1 | 3300050514 | Bacteria | 3831 |
| 515 | nmdc:mga08x19_453_c1 | 3300050514 | Bacteria | 27975 |
| 516 | nmdc:mga08x19_6130_c1 | 3300050514 | Bacteria | 7110 |
| 517 | nmdc:mga08x19_70977_c1 | 3300050514 | Bacteria | 2270 |
| 518 | nmdc:mga08x19_8906_c1 | 3300050514 | Bacteria | 5988 |
| 519 | nmdc:mga0a205_106_c1 | 3300050515 | Bacteria | 48183 |
| 520 | nmdc:mga0a205_166610_c1 | 3300050515 | Bacteria | 2099 |
| 521 | nmdc:mga0a205_21674_c1 | 3300050515 | Bacteria | 4207 |
| 522 | nmdc:mga0sz30_5279_c1 | 3300050516 | Bacteria | 4731 |
| 523 | nmdc:mga0sz30_56176_c1 | 3300050516 | Unclassified | 1676 |
| 524 | Ga0500583_0021436 | 3300053092 | Bacteria | 2687 |
| 525 | Ga0500650_0037707 | 3300053098 | Bacteria | 2222 |
| 526 | Ga0500568_0102426 | 3300053139 | Bacteria | 1073 |
| 527 | Ga0500604_0002914 | 3300053151 | Bacteria | 4628 |
| 528 | Ga0500616_0052178 | 3300053153 | Bacteria | 2152 |
| 529 | Ga0500634_0055328 | 3300053161 | Bacteria | 2122 |
| 530 | Ga0501084_0002815 | 3300054114 | Bacteria | 14041 |
| 531 | Ga0501084_0087785 | 3300054114 | Bacteria | 2611 |
| 532 | Ga0501082_0000358 | 3300060353 | Bacteria | 40322 |
| 533 | Ga0501082_0012656 | 3300060353 | Bacteria | 7252 |
| 534 | Ga0530510_0002277 | 3300061734 | Bacteria | 13168 |
| 535 | Ga0530510_0091644 | 3300061734 | Bacteria | 2218 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028577 | Ga0265318_10098547 | Ga0265318_100985471 | 262 |
| 2 | 3300050509 | nmdc:mga0qj67_337046_c1 | nmdc:mga0qj67_337046_c1_81_872 | 262 |
| 3 | 3300005336 | Ga0070680_100075327 | Ga0070680_1000753272 | 280 |
| 4 | 3300005345 | Ga0070692_10138357 | Ga0070692_101383572 | 280 |
| 5 | 3300005440 | Ga0070705_100102990 | Ga0070705_1001029902 | 280 |
| 6 | 3300005444 | Ga0070694_100005795 | Ga0070694_1000057953 | 280 |
| 7 | 3300025917 | Ga0207660_10213231 | Ga0207660_102132312 | 281 |
| 8 | 3300005546 | Ga0070696_100056110 | Ga0070696_1000561103 | 283 |
| 9 | 3300007076 | Ga0075435_100133190 | Ga0075435_1001331902 | 287 |
| 10 | 3300007265 | Ga0099794_10099175 | Ga0099794_100991752 | 287 |
| 11 | 3300050512 | nmdc:mga0n895_116567_c1 | nmdc:mga0n895_116567_c1_1021_1884 | 287 |
| 12 | 3300050513 | nmdc:mga0rr50_26358_c1 | nmdc:mga0rr50_26358_c1_553_1416 | 287 |
| 13 | 3300050515 | nmdc:mga0a205_21674_c1 | nmdc:mga0a205_21674_c1_956_1819 | 287 |
| 14 | 3300005518 | Ga0070699_100055168 | Ga0070699_1000551682 | 288 |
| 15 | 3300005536 | Ga0070697_100423611 | Ga0070697_1004236111 | 288 |
| 16 | 3300006914 | Ga0075436_100000262 | Ga0075436_10000026228 | 288 |
| 17 | 3300006914 | Ga0075436_100079549 | Ga0075436_1000795491 | 288 |
| 18 | 3300025939 | Ga0207665_10064185 | Ga0207665_100641851 | 288 |
| 19 | 3300050514 | nmdc:mga08x19_453_c1 | nmdc:mga08x19_453_c1_7881_8747 | 288 |
| 20 | 3300050514 | nmdc:mga08x19_70977_c1 | nmdc:mga08x19_70977_c1_1223_2089 | 288 |
| 21 | 3300050515 | nmdc:mga0a205_166610_c1 | nmdc:mga0a205_166610_c1_339_1205 | 288 |
| 22 | 3300005338 | Ga0068868_100238149 | Ga0068868_1002381492 | 289 |
| 23 | 3300005334 | Ga0068869_100098099 | Ga0068869_1000980993 | 291 |
| 24 | 3300005354 | Ga0070675_100020836 | Ga0070675_1000208362 | 291 |
| 25 | 3300005441 | Ga0070700_100295320 | Ga0070700_1002953202 | 291 |
| 26 | 3300005546 | Ga0070696_100325644 | Ga0070696_1003256442 | 291 |
| 27 | 3300006846 | Ga0075430_100119121 | Ga0075430_1001191212 | 291 |
| 28 | 3300025926 | Ga0207659_10018543 | Ga0207659_100185432 | 291 |
| 29 | 3300025942 | Ga0207689_10048356 | Ga0207689_100483563 | 291 |
| 30 | 3300025960 | Ga0207651_10273517 | Ga0207651_102735172 | 291 |
| 31 | 3300026075 | Ga0207708_10391022 | Ga0207708_103910221 | 291 |
| 32 | 3300026089 | Ga0207648_10159375 | Ga0207648_101593752 | 291 |
| 33 | 3300026121 | Ga0207683_10115120 | Ga0207683_101151203 | 291 |
| 34 | 3300028380 | Ga0268265_10259498 | Ga0268265_102594982 | 291 |
| 35 | 3300031548 | Ga0307408_100155943 | Ga0307408_1001559432 | 291 |
| 36 | 3300032002 | Ga0307416_100071962 | Ga0307416_1000719623 | 291 |
| 37 | 3300046528 | Ga0495642_0022793 | Ga0495642_0022793_1406_2281 | 291 |
| 38 | 3300050509 | nmdc:mga0qj67_226236_c1 | nmdc:mga0qj67_226236_c1_570_1445 | 291 |
| 39 | 3300005546 | Ga0070696_100003505 | Ga0070696_1000035052 | 293 |
| 40 | 3300005330 | Ga0070690_100000569 | Ga0070690_1000005695 | 294 |
| 41 | 3300005330 | Ga0070690_100051358 | Ga0070690_1000513583 | 294 |
| 42 | 3300005334 | Ga0068869_100000727 | Ga0068869_1000007274 | 294 |
| 43 | 3300005336 | Ga0070680_100001166 | Ga0070680_10000116610 | 294 |
| 44 | 3300005337 | Ga0070682_100050434 | Ga0070682_1000504341 | 294 |
| 45 | 3300005338 | Ga0068868_100000716 | Ga0068868_10000071616 | 294 |
| 46 | 3300005340 | Ga0070689_100000798 | Ga0070689_1000007985 | 294 |
| 47 | 3300005340 | Ga0070689_100034383 | Ga0070689_1000343834 | 294 |
| 48 | 3300005341 | Ga0070691_10000223 | Ga0070691_100002235 | 294 |
| 49 | 3300005343 | Ga0070687_100003027 | Ga0070687_1000030273 | 294 |
| 50 | 3300005345 | Ga0070692_10003091 | Ga0070692_100030913 | 294 |
| 51 | 3300005438 | Ga0070701_10002181 | Ga0070701_100021814 | 294 |
| 52 | 3300005440 | Ga0070705_100000565 | Ga0070705_10000056519 | 294 |
| 53 | 3300005441 | Ga0070700_100000265 | Ga0070700_10000026513 | 294 |
| 54 | 3300005444 | Ga0070694_100000584 | Ga0070694_10000058413 | 294 |
| 55 | 3300005459 | Ga0068867_100006495 | Ga0068867_1000064955 | 294 |
| 56 | 3300005530 | Ga0070679_100004913 | Ga0070679_10000491310 | 294 |
| 57 | 3300005539 | Ga0068853_100121010 | Ga0068853_1001210103 | 294 |
| 58 | 3300005544 | Ga0070686_100002546 | Ga0070686_1000025466 | 294 |
| 59 | 3300005545 | Ga0070695_100004011 | Ga0070695_1000040115 | 294 |
| 60 | 3300005545 | Ga0070695_100064538 | Ga0070695_1000645382 | 294 |
| 61 | 3300005546 | Ga0070696_100000689 | Ga0070696_10000068910 | 294 |
| 62 | 3300005547 | Ga0070693_100000145 | Ga0070693_10000014513 | 294 |
| 63 | 3300005549 | Ga0070704_100003704 | Ga0070704_1000037045 | 294 |
| 64 | 3300005563 | Ga0068855_100012503 | Ga0068855_1000125035 | 294 |
| 65 | 3300005578 | Ga0068854_100007979 | Ga0068854_1000079794 | 294 |
| 66 | 3300005614 | Ga0068856_100072061 | Ga0068856_1000720614 | 294 |
| 67 | 3300005615 | Ga0070702_100000200 | Ga0070702_10000020014 | 294 |
| 68 | 3300005616 | Ga0068852_100523772 | Ga0068852_1005237722 | 294 |
| 69 | 3300005617 | Ga0068859_100008918 | Ga0068859_1000089187 | 294 |
| 70 | 3300005617 | Ga0068859_100451914 | Ga0068859_1004519142 | 294 |
| 71 | 3300005718 | Ga0068866_10000312 | Ga0068866_1000031210 | 294 |
| 72 | 3300005719 | Ga0068861_100003520 | Ga0068861_1000035206 | 294 |
| 73 | 3300005840 | Ga0068870_10007393 | Ga0068870_100073933 | 294 |
| 74 | 3300005842 | Ga0068858_100040094 | Ga0068858_1000400942 | 294 |
| 75 | 3300005843 | Ga0068860_100011647 | Ga0068860_1000116474 | 294 |
| 76 | 3300005844 | Ga0068862_100014677 | Ga0068862_1000146774 | 294 |
| 77 | 3300006237 | Ga0097621_100001046 | Ga0097621_10000104614 | 294 |
| 78 | 3300006358 | Ga0068871_100000265 | Ga0068871_10000026514 | 294 |
| 79 | 3300006844 | Ga0075428_100016392 | Ga0075428_1000163926 | 294 |
| 80 | 3300006846 | Ga0075430_100006542 | Ga0075430_10000654210 | 294 |
| 81 | 3300006847 | Ga0075431_100059936 | Ga0075431_1000599363 | 294 |
| 82 | 3300006847 | Ga0075431_100211314 | Ga0075431_1002113142 | 294 |
| 83 | 3300006852 | Ga0075433_10000585 | Ga0075433_100005854 | 294 |
| 84 | 3300006871 | Ga0075434_100000221 | Ga0075434_10000022113 | 294 |
| 85 | 3300006880 | Ga0075429_100025305 | Ga0075429_1000253054 | 294 |
| 86 | 3300006881 | Ga0068865_100000608 | Ga0068865_1000006085 | 294 |
| 87 | 3300006914 | Ga0075436_100001062 | Ga0075436_1000010625 | 294 |
| 88 | 3300006931 | Ga0097620_100008919 | Ga0097620_1000089197 | 294 |
| 89 | 3300006931 | Ga0097620_100451935 | Ga0097620_1004519352 | 294 |
| 90 | 3300007076 | Ga0075435_100001563 | Ga0075435_1000015636 | 294 |
| 91 | 3300009094 | Ga0111539_10035511 | Ga0111539_100355114 | 294 |
| 92 | 3300009094 | Ga0111539_10102637 | Ga0111539_101026373 | 294 |
| 93 | 3300009098 | Ga0105245_10007488 | Ga0105245_100074884 | 294 |
| 94 | 3300009148 | Ga0105243_10004754 | Ga0105243_100047546 | 294 |
| 95 | 3300009176 | Ga0105242_10000646 | Ga0105242_1000064614 | 294 |
| 96 | 3300009553 | Ga0105249_10011456 | Ga0105249_100114565 | 294 |
| 97 | 3300011119 | Ga0105246_10069838 | Ga0105246_100698382 | 294 |
| 98 | 3300013297 | Ga0157378_10002299 | Ga0157378_1000229914 | 294 |
| 99 | 3300013306 | Ga0163162_10365175 | Ga0163162_103651752 | 294 |
| 100 | 3300014968 | Ga0157379_10110606 | Ga0157379_101106062 | 294 |
| 101 | 3300025899 | Ga0207642_10000981 | Ga0207642_100009816 | 294 |
| 102 | 3300025908 | Ga0207643_10014651 | Ga0207643_100146514 | 294 |
| 103 | 3300025912 | Ga0207707_10325691 | Ga0207707_103256912 | 294 |
| 104 | 3300025918 | Ga0207662_10002183 | Ga0207662_100021835 | 294 |
| 105 | 3300025921 | Ga0207652_10057958 | Ga0207652_100579582 | 294 |
| 106 | 3300025927 | Ga0207687_10008829 | Ga0207687_100088294 | 294 |
| 107 | 3300025934 | Ga0207686_10001709 | Ga0207686_100017095 | 294 |
| 108 | 3300025935 | Ga0207709_10002039 | Ga0207709_100020395 | 294 |
| 109 | 3300025936 | Ga0207670_10005788 | Ga0207670_100057883 | 294 |
| 110 | 3300025936 | Ga0207670_10080609 | Ga0207670_100806093 | 294 |
| 111 | 3300025938 | Ga0207704_10000577 | Ga0207704_100005774 | 294 |
| 112 | 3300025939 | Ga0207665_10099998 | Ga0207665_100999982 | 294 |
| 113 | 3300025942 | Ga0207689_10001695 | Ga0207689_1000169519 | 294 |
| 114 | 3300025942 | Ga0207689_10018441 | Ga0207689_100184415 | 294 |
| 115 | 3300025949 | Ga0207667_10016185 | Ga0207667_100161855 | 294 |
| 116 | 3300025981 | Ga0207640_10007759 | Ga0207640_100077595 | 294 |
| 117 | 3300026023 | Ga0207677_10002281 | Ga0207677_100022813 | 294 |
| 118 | 3300026035 | Ga0207703_10006142 | Ga0207703_100061428 | 294 |
| 119 | 3300026035 | Ga0207703_10028893 | Ga0207703_100288933 | 294 |
| 120 | 3300026041 | Ga0207639_10060460 | Ga0207639_100604602 | 294 |
| 121 | 3300026089 | Ga0207648_10001968 | Ga0207648_1000196820 | 294 |
| 122 | 3300026118 | Ga0207675_100002725 | Ga0207675_10000272514 | 294 |
| 123 | 3300027907 | Ga0207428_10012481 | Ga0207428_100124816 | 294 |
| 124 | 3300027907 | Ga0207428_10038351 | Ga0207428_100383512 | 294 |
| 125 | 3300028380 | Ga0268265_10003024 | Ga0268265_100030246 | 294 |
| 126 | 3300028380 | Ga0268265_10250309 | Ga0268265_102503092 | 294 |
| 127 | 3300028381 | Ga0268264_10006262 | Ga0268264_100062627 | 294 |
| 128 | 3300032002 | Ga0307416_100335862 | Ga0307416_1003358621 | 294 |
| 129 | 3300035090 | Ga0373949_0006365 | Ga0373949_0006365_787_1671 | 294 |
| 130 | 3300035112 | Ga0373932_0008856 | Ga0373932_0008856_849_1733 | 294 |
| 131 | 3300035241 | Ga0373961_0008126 | Ga0373961_0008126_107_991 | 294 |
| 132 | 3300035691 | Ga0373931_0006583 | Ga0373931_0006583_1838_2722 | 294 |
| 133 | 3300042876 | Ga0451577_0008898 | Ga0451577_0008898_1493_2377 | 294 |
| 134 | 3300044712 | Ga0453684_0273586 | Ga0453684_0273586_545_1429 | 294 |
| 135 | 3300045051 | Ga0451576_0026374 | Ga0451576_0026374_1823_2707 | 294 |
| 136 | 3300045051 | Ga0451576_0188049 | Ga0451576_0188049_167_1051 | 294 |
| 137 | 3300045051 | Ga0451576_0205305 | Ga0451576_0205305_342_1226 | 294 |
| 138 | 3300046537 | Ga0495598_0004202 | Ga0495598_0004202_1650_2534 | 294 |
| 139 | 3300046664 | Ga0495659_0043079 | Ga0495659_0043079_596_1480 | 294 |
| 140 | 3300046691 | Ga0495670_0032545 | Ga0495670_0032545_1174_2058 | 294 |
| 141 | 3300049588 | Ga0501072_0320455 | Ga0501072_0320455_245_1129 | 294 |
| 142 | 3300050508 | nmdc:mga09592_2982_c1 | nmdc:mga09592_2982_c1_11870_12754 | 294 |
| 143 | 3300050509 | nmdc:mga0qj67_91441_c1 | nmdc:mga0qj67_91441_c1_44_928 | 294 |
| 144 | 3300050511 | nmdc:mga08y16_127092_c1 | nmdc:mga08y16_127092_c1_739_1623 | 294 |
| 145 | 3300050511 | nmdc:mga08y16_57930_c1 | nmdc:mga08y16_57930_c1_264_1148 | 294 |
| 146 | 3300050512 | nmdc:mga0n895_1538_c1 | nmdc:mga0n895_1538_c1_1231_2115 | 294 |
| 147 | 3300050513 | nmdc:mga0rr50_681_c1 | nmdc:mga0rr50_681_c1_4979_5863 | 294 |
| 148 | 3300050514 | nmdc:mga08x19_8906_c1 | nmdc:mga08x19_8906_c1_2132_3016 | 294 |
| 149 | 3300050515 | nmdc:mga0a205_106_c1 | nmdc:mga0a205_106_c1_13342_14226 | 294 |
| 150 | 3300009147 | Ga0114129_10267819 | Ga0114129_102678192 | 295 |
| 151 | 3300046535 | Ga0495586_0010979 | Ga0495586_0010979_507_1397 | 295 |
| 152 | 3300050507 | nmdc:mga05p37_274434_c1 | nmdc:mga05p37_274434_c1_638_1525 | 295 |
| 153 | 3300005440 | Ga0070705_100008174 | Ga0070705_1000081742 | 296 |
| 154 | 3300005444 | Ga0070694_100008158 | Ga0070694_1000081584 | 296 |
| 155 | 3300005536 | Ga0070697_100004116 | Ga0070697_1000041166 | 296 |
| 156 | 3300005545 | Ga0070695_100056782 | Ga0070695_1000567821 | 296 |
| 157 | 3300005546 | Ga0070696_100003145 | Ga0070696_1000031456 | 296 |
| 158 | 3300006914 | Ga0075436_100018581 | Ga0075436_1000185814 | 296 |
| 159 | 3300013308 | Ga0157375_10573278 | Ga0157375_105732782 | 296 |
| 160 | 3300027395 | Ga0209996_1011813 | Ga0209996_10118131 | 296 |
| 161 | 3300049578 | Ga0501042_0328063 | Ga0501042_0328063_160_1050 | 296 |
| 162 | 3300050514 | nmdc:mga08x19_23420_c1 | nmdc:mga08x19_23420_c1_1708_2604 | 296 |
| 163 | 3300050514 | nmdc:mga08x19_6130_c1 | nmdc:mga08x19_6130_c1_3293_4183 | 296 |
| 164 | 3300005444 | Ga0070694_100062976 | Ga0070694_1000629762 | 297 |
| 165 | 3300045051 | Ga0451576_0063476 | Ga0451576_0063476_169_1062 | 297 |
| 166 | 3300005290 | Ga0065712_10112361 | Ga0065712_101123612 | 298 |
| 167 | 3300005364 | Ga0070673_100203434 | Ga0070673_1002034342 | 298 |
| 168 | 3300006847 | Ga0075431_100005545 | Ga0075431_1000055456 | 298 |
| 169 | 3300006847 | Ga0075431_100610129 | Ga0075431_1006101291 | 298 |
| 170 | 3300006880 | Ga0075429_100084949 | Ga0075429_1000849492 | 298 |
| 171 | 3300009094 | Ga0111539_10114889 | Ga0111539_101148892 | 298 |
| 172 | 3300009094 | Ga0111539_10206496 | Ga0111539_102064962 | 298 |
| 173 | 3300009094 | Ga0111539_10574232 | Ga0111539_105742321 | 298 |
| 174 | 3300027360 | Ga0209969_1000257 | Ga0209969_10002572 | 298 |
| 175 | 3300027471 | Ga0209995_1009346 | Ga0209995_10093462 | 298 |
| 176 | 3300027682 | Ga0209971_1006911 | Ga0209971_10069112 | 298 |
| 177 | 3300027876 | Ga0209974_10006565 | Ga0209974_100065655 | 298 |
| 178 | 3300027907 | Ga0207428_10300676 | Ga0207428_103006761 | 298 |
| 179 | 3300028380 | Ga0268265_10081790 | Ga0268265_100817905 | 298 |
| 180 | 3300031548 | Ga0307408_100210641 | Ga0307408_1002106412 | 298 |
| 181 | 3300031731 | Ga0307405_10183956 | Ga0307405_101839562 | 298 |
| 182 | 3300032005 | Ga0307411_10102916 | Ga0307411_101029162 | 298 |
| 183 | 3300035113 | Ga0373936_0144638 | Ga0373936_0144638_81_977 | 298 |
| 184 | 3300045051 | Ga0451576_0469638 | Ga0451576_0469638_252_1151 | 298 |
| 185 | 3300046454 | Ga0495592_0218138 | Ga0495592_0218138_154_1050 | 298 |
| 186 | 3300046459 | Ga0495629_0055613 | Ga0495629_0055613_1809_2705 | 298 |
| 187 | 3300046476 | Ga0495662_0022332 | Ga0495662_0022332_1446_2342 | 298 |
| 188 | 3300046514 | Ga0495618_0122579 | Ga0495618_0122579_488_1384 | 298 |
| 189 | 3300046516 | Ga0495628_0066781 | Ga0495628_0066781_532_1428 | 298 |
| 190 | 3300046517 | Ga0495630_0026993 | Ga0495630_0026993_481_1377 | 298 |
| 191 | 3300048910 | Ga0496107_0098053 | Ga0496107_0098053_317_1219 | 298 |
| 192 | 3300048913 | Ga0496110_0478313 | Ga0496110_0478313_178_1080 | 298 |
| 193 | 3300049515 | Ga0501292_011490 | Ga0501292_011490_230_1129 | 298 |
| 194 | 3300049570 | Ga0501033_0084106 | Ga0501033_0084106_1321_2217 | 298 |
| 195 | 3300049571 | Ga0501034_0016205 | Ga0501034_0016205_1731_2627 | 298 |
| 196 | 3300049572 | Ga0501036_0236955 | Ga0501036_0236955_104_1006 | 298 |
| 197 | 3300049823 | Ga0501044_0000255 | Ga0501044_0000255_42531_43427 | 298 |
| 198 | 3300050508 | nmdc:mga09592_19475_c1 | nmdc:mga09592_19475_c1_3893_4795 | 298 |
| 199 | 3300050510 | nmdc:mga06r32_97914_c1 | nmdc:mga06r32_97914_c1_1697_2599 | 298 |
| 200 | 3300050511 | nmdc:mga08y16_48515_c1 | nmdc:mga08y16_48515_c1_2712_3608 | 298 |
| 201 | 3300050511 | nmdc:mga08y16_545705_c1 | nmdc:mga08y16_545705_c1_229_1125 | 298 |
| 202 | 3300050511 | nmdc:mga08y16_68383_c1 | nmdc:mga08y16_68383_c1_28_930 | 298 |
| 203 | 3300005328 | Ga0070676_10054557 | Ga0070676_100545573 | 299 |
| 204 | 3300005333 | Ga0070677_10070892 | Ga0070677_100708922 | 299 |
| 205 | 3300005336 | Ga0070680_100209513 | Ga0070680_1002095132 | 299 |
| 206 | 3300005340 | Ga0070689_100227338 | Ga0070689_1002273383 | 299 |
| 207 | 3300005354 | Ga0070675_100020836 | Ga0070675_1000208365 | 299 |
| 208 | 3300005444 | Ga0070694_100005795 | Ga0070694_1000057956 | 299 |
| 209 | 3300005456 | Ga0070678_100284528 | Ga0070678_1002845282 | 299 |
| 210 | 3300005458 | Ga0070681_10050204 | Ga0070681_100502042 | 299 |
| 211 | 3300005546 | Ga0070696_100136829 | Ga0070696_1001368292 | 299 |
| 212 | 3300005577 | Ga0068857_100249863 | Ga0068857_1002498632 | 299 |
| 213 | 3300005840 | Ga0068870_10065883 | Ga0068870_100658832 | 299 |
| 214 | 3300005844 | Ga0068862_100044129 | Ga0068862_1000441294 | 299 |
| 215 | 3300009094 | Ga0111539_10591072 | Ga0111539_105910722 | 299 |
| 216 | 3300011119 | Ga0105246_10538435 | Ga0105246_105384351 | 299 |
| 217 | 3300025893 | Ga0207682_10031294 | Ga0207682_100312942 | 299 |
| 218 | 3300025907 | Ga0207645_10098736 | Ga0207645_100987363 | 299 |
| 219 | 3300025908 | Ga0207643_10010297 | Ga0207643_100102975 | 299 |
| 220 | 3300025926 | Ga0207659_10040969 | Ga0207659_100409692 | 299 |
| 221 | 3300025936 | Ga0207670_10073521 | Ga0207670_100735215 | 299 |
| 222 | 3300025942 | Ga0207689_10047407 | Ga0207689_100474076 | 299 |
| 223 | 3300025960 | Ga0207651_10260283 | Ga0207651_102602832 | 299 |
| 224 | 3300026121 | Ga0207683_10072035 | Ga0207683_100720354 | 299 |
| 225 | 3300031548 | Ga0307408_100210475 | Ga0307408_1002104752 | 299 |
| 226 | 3300032005 | Ga0307411_10401099 | Ga0307411_104010991 | 299 |
| 227 | 3300049741 | Ga0501079_0236362 | Ga0501079_0236362_403_1302 | 299 |
| 228 | 3300005330 | Ga0070690_100015303 | Ga0070690_1000153033 | 300 |
| 229 | 3300005336 | Ga0070680_100055213 | Ga0070680_1000552133 | 300 |
| 230 | 3300005343 | Ga0070687_100127964 | Ga0070687_1001279641 | 300 |
| 231 | 3300005347 | Ga0070668_100071747 | Ga0070668_1000717474 | 300 |
| 232 | 3300005353 | Ga0070669_100014122 | Ga0070669_1000141224 | 300 |
| 233 | 3300005353 | Ga0070669_100148772 | Ga0070669_1001487722 | 300 |
| 234 | 3300005356 | Ga0070674_100034607 | Ga0070674_1000346073 | 300 |
| 235 | 3300005365 | Ga0070688_100075935 | Ga0070688_1000759352 | 300 |
| 236 | 3300005441 | Ga0070700_100283158 | Ga0070700_1002831582 | 300 |
| 237 | 3300005445 | Ga0070708_100085748 | Ga0070708_1000857481 | 300 |
| 238 | 3300005458 | Ga0070681_10007341 | Ga0070681_1000734111 | 300 |
| 239 | 3300005459 | Ga0068867_100252721 | Ga0068867_1002527212 | 300 |
| 240 | 3300005468 | Ga0070707_100030431 | Ga0070707_1000304312 | 300 |
| 241 | 3300005536 | Ga0070697_100179151 | Ga0070697_1001791512 | 300 |
| 242 | 3300005545 | Ga0070695_100020688 | Ga0070695_1000206882 | 300 |
| 243 | 3300005546 | Ga0070696_100256437 | Ga0070696_1002564372 | 300 |
| 244 | 3300005547 | Ga0070693_100189004 | Ga0070693_1001890042 | 300 |
| 245 | 3300005548 | Ga0070665_100491272 | Ga0070665_1004912721 | 300 |
| 246 | 3300005616 | Ga0068852_100244240 | Ga0068852_1002442402 | 300 |
| 247 | 3300005719 | Ga0068861_100012712 | Ga0068861_1000127124 | 300 |
| 248 | 3300005840 | Ga0068870_10213603 | Ga0068870_102136031 | 300 |
| 249 | 3300005841 | Ga0068863_100078710 | Ga0068863_1000787101 | 300 |
| 250 | 3300005842 | Ga0068858_100382101 | Ga0068858_1003821012 | 300 |
| 251 | 3300005843 | Ga0068860_100059911 | Ga0068860_1000599113 | 300 |
| 252 | 3300006844 | Ga0075428_100223785 | Ga0075428_1002237852 | 300 |
| 253 | 3300006844 | Ga0075428_100243616 | Ga0075428_1002436162 | 300 |
| 254 | 3300006844 | Ga0075428_100272128 | Ga0075428_1002721283 | 300 |
| 255 | 3300006846 | Ga0075430_100002769 | Ga0075430_10000276914 | 300 |
| 256 | 3300006847 | Ga0075431_100021784 | Ga0075431_1000217842 | 300 |
| 257 | 3300006847 | Ga0075431_100133137 | Ga0075431_1001331372 | 300 |
| 258 | 3300006871 | Ga0075434_100157400 | Ga0075434_1001574002 | 300 |
| 259 | 3300006881 | Ga0068865_100014208 | Ga0068865_1000142086 | 300 |
| 260 | 3300006914 | Ga0075436_100092661 | Ga0075436_1000926612 | 300 |
| 261 | 3300009094 | Ga0111539_10304019 | Ga0111539_103040192 | 300 |
| 262 | 3300009147 | Ga0114129_10117651 | Ga0114129_101176512 | 300 |
| 263 | 3300009148 | Ga0105243_10009731 | Ga0105243_100097313 | 300 |
| 264 | 3300009553 | Ga0105249_10262794 | Ga0105249_102627941 | 300 |
| 265 | 3300011119 | Ga0105246_10076027 | Ga0105246_100760272 | 300 |
| 266 | 3300014326 | Ga0157380_10156053 | Ga0157380_101560532 | 300 |
| 267 | 3300014969 | Ga0157376_10396030 | Ga0157376_103960302 | 300 |
| 268 | 3300025315 | Ga0207697_10004195 | Ga0207697_100041957 | 300 |
| 269 | 3300025893 | Ga0207682_10003415 | Ga0207682_100034154 | 300 |
| 270 | 3300025899 | Ga0207642_10080219 | Ga0207642_100802192 | 300 |
| 271 | 3300025903 | Ga0207680_10140942 | Ga0207680_101409421 | 300 |
| 272 | 3300025907 | Ga0207645_10006949 | Ga0207645_100069496 | 300 |
| 273 | 3300025910 | Ga0207684_10092168 | Ga0207684_100921682 | 300 |
| 274 | 3300025912 | Ga0207707_10167462 | Ga0207707_101674621 | 300 |
| 275 | 3300025917 | Ga0207660_10029306 | Ga0207660_100293063 | 300 |
| 276 | 3300025917 | Ga0207660_10130001 | Ga0207660_101300012 | 300 |
| 277 | 3300025923 | Ga0207681_10002576 | Ga0207681_1000257610 | 300 |
| 278 | 3300025938 | Ga0207704_10201817 | Ga0207704_102018171 | 300 |
| 279 | 3300025940 | Ga0207691_10144747 | Ga0207691_101447472 | 300 |
| 280 | 3300025942 | Ga0207689_10004523 | Ga0207689_100045235 | 300 |
| 281 | 3300026075 | Ga0207708_10012792 | Ga0207708_100127926 | 300 |
| 282 | 3300026075 | Ga0207708_10355592 | Ga0207708_103555922 | 300 |
| 283 | 3300026089 | Ga0207648_10008599 | Ga0207648_100085992 | 300 |
| 284 | 3300026089 | Ga0207648_10024176 | Ga0207648_100241764 | 300 |
| 285 | 3300026118 | Ga0207675_100018330 | Ga0207675_1000183307 | 300 |
| 286 | 3300026118 | Ga0207675_100025078 | Ga0207675_1000250785 | 300 |
| 287 | 3300026121 | Ga0207683_10202488 | Ga0207683_102024882 | 300 |
| 288 | 3300027471 | Ga0209995_1010382 | Ga0209995_10103822 | 300 |
| 289 | 3300028380 | Ga0268265_10001655 | Ga0268265_100016553 | 300 |
| 290 | 3300031711 | Ga0265314_10085483 | Ga0265314_100854831 | 300 |
| 291 | 3300042876 | Ga0451577_0057302 | Ga0451577_0057302_1055_1960 | 300 |
| 292 | 3300046537 | Ga0495598_0067107 | Ga0495598_0067107_127_1035 | 300 |
| 293 | 3300046684 | Ga0495669_0032906 | Ga0495669_0032906_255_1163 | 300 |
| 294 | 3300050507 | nmdc:mga05p37_117796_c1 | nmdc:mga05p37_117796_c1_2000_2902 | 300 |
| 295 | 3300050508 | nmdc:mga09592_251016_c1 | nmdc:mga09592_251016_c1_97_1002 | 300 |
| 296 | 3300050509 | nmdc:mga0qj67_36587_c1 | nmdc:mga0qj67_36587_c1_511_1416 | 300 |
| 297 | 3300050511 | nmdc:mga08y16_76545_c1 | nmdc:mga08y16_76545_c1_2347_3252 | 300 |
| 298 | 3300050512 | nmdc:mga0n895_129562_c1 | nmdc:mga0n895_129562_c1_1136_2044 | 300 |
| 299 | 3300053161 | Ga0500634_0055328 | Ga0500634_0055328_77_982 | 300 |
| 300 | 3300005290 | Ga0065712_10171761 | Ga0065712_101717611 | 301 |
| 301 | 3300005329 | Ga0070683_100259914 | Ga0070683_1002599141 | 301 |
| 302 | 3300005330 | Ga0070690_100106878 | Ga0070690_1001068782 | 301 |
| 303 | 3300005333 | Ga0070677_10033068 | Ga0070677_100330682 | 301 |
| 304 | 3300005335 | Ga0070666_10019897 | Ga0070666_100198974 | 301 |
| 305 | 3300005338 | Ga0068868_100103275 | Ga0068868_1001032752 | 301 |
| 306 | 3300005338 | Ga0068868_100192749 | Ga0068868_1001927492 | 301 |
| 307 | 3300005344 | Ga0070661_100249383 | Ga0070661_1002493831 | 301 |
| 308 | 3300005355 | Ga0070671_100012340 | Ga0070671_1000123403 | 301 |
| 309 | 3300005367 | Ga0070667_100321398 | Ga0070667_1003213982 | 301 |
| 310 | 3300005445 | Ga0070708_100139193 | Ga0070708_1001391932 | 301 |
| 311 | 3300005456 | Ga0070678_100204434 | Ga0070678_1002044342 | 301 |
| 312 | 3300005458 | Ga0070681_10017899 | Ga0070681_100178995 | 301 |
| 313 | 3300005468 | Ga0070707_100032470 | Ga0070707_1000324703 | 301 |
| 314 | 3300005530 | Ga0070679_100045732 | Ga0070679_1000457324 | 301 |
| 315 | 3300005535 | Ga0070684_100088585 | Ga0070684_1000885853 | 301 |
| 316 | 3300005539 | Ga0068853_100301215 | Ga0068853_1003012152 | 301 |
| 317 | 3300005545 | Ga0070695_100041853 | Ga0070695_1000418532 | 301 |
| 318 | 3300005546 | Ga0070696_100003505 | Ga0070696_1000035055 | 301 |
| 319 | 3300005564 | Ga0070664_100081490 | Ga0070664_1000814903 | 301 |
| 320 | 3300005578 | Ga0068854_100001523 | Ga0068854_1000015233 | 301 |
| 321 | 3300005615 | Ga0070702_100128441 | Ga0070702_1001284412 | 301 |
| 322 | 3300005615 | Ga0070702_100245956 | Ga0070702_1002459561 | 301 |
| 323 | 3300005616 | Ga0068852_100034260 | Ga0068852_1000342602 | 301 |
| 324 | 3300006237 | Ga0097621_100055613 | Ga0097621_1000556132 | 301 |
| 325 | 3300006237 | Ga0097621_100171278 | Ga0097621_1001712782 | 301 |
| 326 | 3300006358 | Ga0068871_100006079 | Ga0068871_1000060799 | 301 |
| 327 | 3300007076 | Ga0075435_100387349 | Ga0075435_1003873492 | 301 |
| 328 | 3300013296 | Ga0157374_10205469 | Ga0157374_102054692 | 301 |
| 329 | 3300013297 | Ga0157378_10003345 | Ga0157378_100033459 | 301 |
| 330 | 3300013306 | Ga0163162_10058122 | Ga0163162_100581222 | 301 |
| 331 | 3300013308 | Ga0157375_10029222 | Ga0157375_100292225 | 301 |
| 332 | 3300014325 | Ga0163163_10543395 | Ga0163163_105433951 | 301 |
| 333 | 3300014745 | Ga0157377_10062209 | Ga0157377_100622092 | 301 |
| 334 | 3300014969 | Ga0157376_10023911 | Ga0157376_100239112 | 301 |
| 335 | 3300014969 | Ga0157376_10608592 | Ga0157376_106085922 | 301 |
| 336 | 3300025893 | Ga0207682_10005427 | Ga0207682_100054273 | 301 |
| 337 | 3300025901 | Ga0207688_10008300 | Ga0207688_100083002 | 301 |
| 338 | 3300025903 | Ga0207680_10009205 | Ga0207680_100092054 | 301 |
| 339 | 3300025908 | Ga0207643_10028804 | Ga0207643_100288042 | 301 |
| 340 | 3300025910 | Ga0207684_10031595 | Ga0207684_100315952 | 301 |
| 341 | 3300025912 | Ga0207707_10055304 | Ga0207707_100553043 | 301 |
| 342 | 3300025922 | Ga0207646_10297725 | Ga0207646_102977252 | 301 |
| 343 | 3300025925 | Ga0207650_10017951 | Ga0207650_100179512 | 301 |
| 344 | 3300025931 | Ga0207644_10000583 | Ga0207644_100005832 | 301 |
| 345 | 3300025940 | Ga0207691_10000948 | Ga0207691_100009485 | 301 |
| 346 | 3300025941 | Ga0207711_10105660 | Ga0207711_101056602 | 301 |
| 347 | 3300025944 | Ga0207661_10283418 | Ga0207661_102834181 | 301 |
| 348 | 3300025960 | Ga0207651_10073229 | Ga0207651_100732292 | 301 |
| 349 | 3300026041 | Ga0207639_10172612 | Ga0207639_101726122 | 301 |
| 350 | 3300026075 | Ga0207708_10011989 | Ga0207708_100119895 | 301 |
| 351 | 3300026116 | Ga0207674_10038517 | Ga0207674_100385174 | 301 |
| 352 | 3300026121 | Ga0207683_10000313 | Ga0207683_100003132 | 301 |
| 353 | 3300026121 | Ga0207683_10355560 | Ga0207683_103555602 | 301 |
| 354 | 3300026142 | Ga0207698_10007556 | Ga0207698_100075564 | 301 |
| 355 | 3300031548 | Ga0307408_100024448 | Ga0307408_1000244482 | 301 |
| 356 | 3300032002 | Ga0307416_100042677 | Ga0307416_1000426772 | 301 |
| 357 | 3300046528 | Ga0495642_0007460 | Ga0495642_0007460_1949_2860 | 301 |
| 358 | 3300048089 | Ga0495614_0112752 | Ga0495614_0112752_162_1067 | 301 |
| 359 | 3300048907 | Ga0496104_0199888 | Ga0496104_0199888_108_1019 | 301 |
| 360 | 3300048913 | Ga0496110_0130873 | Ga0496110_0130873_422_1333 | 301 |
| 361 | 3300048918 | Ga0496115_0367035 | Ga0496115_0367035_21_932 | 301 |
| 362 | 3300049568 | Ga0501031_0099438 | Ga0501031_0099438_373_1278 | 301 |
| 363 | 3300049569 | Ga0501032_0046821 | Ga0501032_0046821_420_1325 | 301 |
| 364 | 3300049570 | Ga0501033_0004209 | Ga0501033_0004209_9822_10727 | 301 |
| 365 | 3300049572 | Ga0501036_0002503 | Ga0501036_0002503_939_1844 | 301 |
| 366 | 3300049572 | Ga0501036_0091684 | Ga0501036_0091684_983_1891 | 301 |
| 367 | 3300049573 | Ga0501037_0085020 | Ga0501037_0085020_667_1572 | 301 |
| 368 | 3300049574 | Ga0501038_0006655 | Ga0501038_0006655_9281_10186 | 301 |
| 369 | 3300049575 | Ga0501039_0005669 | Ga0501039_0005669_7844_8749 | 301 |
| 370 | 3300049575 | Ga0501039_0057373 | Ga0501039_0057373_661_1569 | 301 |
| 371 | 3300049576 | Ga0501040_0001508 | Ga0501040_0001508_535_1440 | 301 |
| 372 | 3300049577 | Ga0501041_0000398 | Ga0501041_0000398_12244_13149 | 301 |
| 373 | 3300049578 | Ga0501042_0001320 | Ga0501042_0001320_12697_13602 | 301 |
| 374 | 3300049578 | Ga0501042_0070336 | Ga0501042_0070336_861_1772 | 301 |
| 375 | 3300049579 | Ga0501043_0006920 | Ga0501043_0006920_5419_6324 | 301 |
| 376 | 3300049579 | Ga0501043_0291833 | Ga0501043_0291833_113_1024 | 301 |
| 377 | 3300049580 | Ga0501046_0000393 | Ga0501046_0000393_38845_39750 | 301 |
| 378 | 3300049580 | Ga0501046_0033459 | Ga0501046_0033459_940_1851 | 301 |
| 379 | 3300049582 | Ga0501048_0000181 | Ga0501048_0000181_11813_12718 | 301 |
| 380 | 3300049582 | Ga0501048_0094801 | Ga0501048_0094801_814_1725 | 301 |
| 381 | 3300049584 | Ga0501068_0003002 | Ga0501068_0003002_659_1564 | 301 |
| 382 | 3300049588 | Ga0501072_0001849 | Ga0501072_0001849_13374_14279 | 301 |
| 383 | 3300049588 | Ga0501072_0009997 | Ga0501072_0009997_4877_5785 | 301 |
| 384 | 3300049588 | Ga0501072_0216442 | Ga0501072_0216442_366_1277 | 301 |
| 385 | 3300049589 | Ga0501073_0188266 | Ga0501073_0188266_379_1290 | 301 |
| 386 | 3300049590 | Ga0501074_0033418 | Ga0501074_0033418_1023_1928 | 301 |
| 387 | 3300049591 | Ga0501075_0000242 | Ga0501075_0000242_22257_23162 | 301 |
| 388 | 3300049591 | Ga0501075_0004582 | Ga0501075_0004582_5839_6750 | 301 |
| 389 | 3300049592 | Ga0501076_0001073 | Ga0501076_0001073_12649_13554 | 301 |
| 390 | 3300049592 | Ga0501076_0165838 | Ga0501076_0165838_831_1739 | 301 |
| 391 | 3300049593 | Ga0501077_0002349 | Ga0501077_0002349_1650_2555 | 301 |
| 392 | 3300049593 | Ga0501077_0072244 | Ga0501077_0072244_453_1364 | 301 |
| 393 | 3300049593 | Ga0501077_0121031 | Ga0501077_0121031_613_1521 | 301 |
| 394 | 3300049741 | Ga0501079_0002630 | Ga0501079_0002630_11594_12499 | 301 |
| 395 | 3300049741 | Ga0501079_0017772 | Ga0501079_0017772_3220_4131 | 301 |
| 396 | 3300049742 | Ga0501080_0002206 | Ga0501080_0002206_7315_8220 | 301 |
| 397 | 3300049742 | Ga0501080_0046509 | Ga0501080_0046509_577_1488 | 301 |
| 398 | 3300049743 | Ga0501081_0000938 | Ga0501081_0000938_12303_13208 | 301 |
| 399 | 3300049743 | Ga0501081_0004554 | Ga0501081_0004554_2352_3263 | 301 |
| 400 | 3300049743 | Ga0501081_0081512 | Ga0501081_0081512_602_1510 | 301 |
| 401 | 3300049822 | Ga0501035_0003028 | Ga0501035_0003028_7440_8345 | 301 |
| 402 | 3300049822 | Ga0501035_0025821 | Ga0501035_0025821_3760_4671 | 301 |
| 403 | 3300049823 | Ga0501044_0073394 | Ga0501044_0073394_975_1880 | 301 |
| 404 | 3300049824 | Ga0501045_0010531 | Ga0501045_0010531_5368_6276 | 301 |
| 405 | 3300049824 | Ga0501045_0030952 | Ga0501045_0030952_1372_2283 | 301 |
| 406 | 3300049824 | Ga0501045_0069481 | Ga0501045_0069481_1474_2379 | 301 |
| 407 | 3300050511 | nmdc:mga08y16_16853_c1 | nmdc:mga08y16_16853_c1_3426_4337 | 301 |
| 408 | 3300050512 | nmdc:mga0n895_169620_c1 | nmdc:mga0n895_169620_c1_275_1186 | 301 |
| 409 | 3300050514 | nmdc:mga08x19_225242_c1 | nmdc:mga08x19_225242_c1_88_993 | 301 |
| 410 | 3300054114 | Ga0501084_0002815 | Ga0501084_0002815_5166_6071 | 301 |
| 411 | 3300060353 | Ga0501082_0000358 | Ga0501082_0000358_27969_28874 | 301 |
| 412 | 3300060353 | Ga0501082_0012656 | Ga0501082_0012656_3818_4726 | 301 |
| 413 | 3300061734 | Ga0530510_0002277 | Ga0530510_0002277_10180_11085 | 301 |
| 414 | 3300061734 | Ga0530510_0091644 | Ga0530510_0091644_1096_2007 | 301 |
| 415 | 3300005329 | Ga0070683_100042288 | Ga0070683_1000422885 | 302 |
| 416 | 3300005330 | Ga0070690_100024340 | Ga0070690_1000243403 | 302 |
| 417 | 3300005334 | Ga0068869_100110789 | Ga0068869_1001107892 | 302 |
| 418 | 3300005435 | Ga0070714_100592491 | Ga0070714_1005924911 | 302 |
| 419 | 3300005444 | Ga0070694_100015352 | Ga0070694_1000153521 | 302 |
| 420 | 3300005444 | Ga0070694_100027884 | Ga0070694_1000278842 | 302 |
| 421 | 3300005467 | Ga0070706_100094706 | Ga0070706_1000947063 | 302 |
| 422 | 3300005518 | Ga0070699_100065005 | Ga0070699_1000650051 | 302 |
| 423 | 3300005536 | Ga0070697_100004116 | Ga0070697_1000041169 | 302 |
| 424 | 3300005545 | Ga0070695_100158500 | Ga0070695_1001585002 | 302 |
| 425 | 3300005546 | Ga0070696_100003145 | Ga0070696_1000031459 | 302 |
| 426 | 3300006048 | Ga0075363_100069621 | Ga0075363_1000696212 | 302 |
| 427 | 3300006051 | Ga0075364_10110589 | Ga0075364_101105892 | 302 |
| 428 | 3300006177 | Ga0075362_10018242 | Ga0075362_100182423 | 302 |
| 429 | 3300006237 | Ga0097621_100006938 | Ga0097621_1000069386 | 302 |
| 430 | 3300006353 | Ga0075370_10050366 | Ga0075370_100503662 | 302 |
| 431 | 3300006358 | Ga0068871_100003199 | Ga0068871_10000319912 | 302 |
| 432 | 3300006914 | Ga0075436_100029416 | Ga0075436_1000294162 | 302 |
| 433 | 3300006914 | Ga0075436_100083728 | Ga0075436_1000837282 | 302 |
| 434 | 3300007265 | Ga0099794_10013995 | Ga0099794_100139952 | 302 |
| 435 | 3300009094 | Ga0111539_10012682 | Ga0111539_100126826 | 302 |
| 436 | 3300025910 | Ga0207684_10256637 | Ga0207684_102566372 | 302 |
| 437 | 3300025929 | Ga0207664_10481737 | Ga0207664_104817372 | 302 |
| 438 | 3300025933 | Ga0207706_10035583 | Ga0207706_100355834 | 302 |
| 439 | 3300026075 | Ga0207708_10098180 | Ga0207708_100981803 | 302 |
| 440 | 3300026095 | Ga0207676_10332815 | Ga0207676_103328152 | 302 |
| 441 | 3300027543 | Ga0209999_1024424 | Ga0209999_10244241 | 302 |
| 442 | 3300027671 | Ga0209588_1054579 | Ga0209588_10545791 | 302 |
| 443 | 3300028794 | Ga0307515_10197509 | Ga0307515_101975091 | 302 |
| 444 | 3300030521 | Ga0307511_10000708 | Ga0307511_1000070825 | 302 |
| 445 | 3300031548 | Ga0307408_100005606 | Ga0307408_1000056062 | 302 |
| 446 | 3300031731 | Ga0307405_10014840 | Ga0307405_100148404 | 302 |
| 447 | 3300031824 | Ga0307413_10168746 | Ga0307413_101687462 | 302 |
| 448 | 3300031852 | Ga0307410_10002526 | Ga0307410_100025267 | 302 |
| 449 | 3300031852 | Ga0307410_10016677 | Ga0307410_100166774 | 302 |
| 450 | 3300031852 | Ga0307410_10084494 | Ga0307410_100844942 | 302 |
| 451 | 3300031901 | Ga0307406_10001695 | Ga0307406_100016954 | 302 |
| 452 | 3300031903 | Ga0307407_10006223 | Ga0307407_100062233 | 302 |
| 453 | 3300031911 | Ga0307412_10093104 | Ga0307412_100931042 | 302 |
| 454 | 3300031995 | Ga0307409_100047017 | Ga0307409_1000470173 | 302 |
| 455 | 3300032002 | Ga0307416_100003872 | Ga0307416_1000038722 | 302 |
| 456 | 3300032002 | Ga0307416_100099492 | Ga0307416_1000994922 | 302 |
| 457 | 3300034816 | Ga0373930_0033458 | Ga0373930_0033458_75_992 | 302 |
| 458 | 3300035083 | Ga0373926_0001197 | Ga0373926_0001197_3902_4813 | 302 |
| 459 | 3300035084 | Ga0373928_0019485 | Ga0373928_0019485_28_939 | 302 |
| 460 | 3300035092 | Ga0373952_0025807 | Ga0373952_0025807_237_1145 | 302 |
| 461 | 3300035116 | Ga0373945_0002628 | Ga0373945_0002628_4657_5568 | 302 |
| 462 | 3300035171 | Ga0373946_0001086 | Ga0373946_0001086_7908_8819 | 302 |
| 463 | 3300035692 | Ga0373935_0070343 | Ga0373935_0070343_414_1325 | 302 |
| 464 | 3300035695 | Ga0373927_0030989 | Ga0373927_0030989_2543_3454 | 302 |
| 465 | 3300037068 | Ga0373925_0021528 | Ga0373925_0021528_1336_2247 | 302 |
| 466 | 3300046455 | Ga0495603_0015377 | Ga0495603_0015377_696_1607 | 302 |
| 467 | 3300046472 | Ga0495580_0008572 | Ga0495580_0008572_6917_7828 | 302 |
| 468 | 3300046473 | Ga0495582_0021379 | Ga0495582_0021379_2100_3011 | 302 |
| 469 | 3300046499 | Ga0495594_0066301 | Ga0495594_0066301_599_1510 | 302 |
| 470 | 3300046526 | Ga0495666_0011053 | Ga0495666_0011053_3572_4483 | 302 |
| 471 | 3300046531 | Ga0495665_0015964 | Ga0495665_0015964_3110_4021 | 302 |
| 472 | 3300046674 | Ga0495588_0006001 | Ga0495588_0006001_4096_5007 | 302 |
| 473 | 3300046683 | Ga0495658_0005601 | Ga0495658_0005601_1351_2262 | 302 |
| 474 | 3300047315 | Ga0495581_0101163 | Ga0495581_0101163_336_1247 | 302 |
| 475 | 3300047321 | Ga0495676_0016910 | Ga0495676_0016910_1787_2698 | 302 |
| 476 | 3300049583 | Ga0501067_0030352 | Ga0501067_0030352_1789_2697 | 302 |
| 477 | 3300049585 | Ga0501069_0029677 | Ga0501069_0029677_441_1352 | 302 |
| 478 | 3300050493 | nmdc:mga0k408_88057_c1 | nmdc:mga0k408_88057_c1_140_1048 | 302 |
| 479 | 3300050495 | nmdc:mga04h51_6567_c1 | nmdc:mga04h51_6567_c1_1733_2641 | 302 |
| 480 | 3300050496 | nmdc:mga07m45_74350_c1 | nmdc:mga07m45_74350_c1_78_986 | 302 |
| 481 | 3300050512 | nmdc:mga0n895_3919_c1 | nmdc:mga0n895_3919_c1_11161_12069 | 302 |
| 482 | 3300050514 | nmdc:mga08x19_6130_c1 | nmdc:mga08x19_6130_c1_6103_7014 | 302 |
| 483 | 3300050516 | nmdc:mga0sz30_5279_c1 | nmdc:mga0sz30_5279_c1_3355_4263 | 302 |
| 484 | 3300050516 | nmdc:mga0sz30_56176_c1 | nmdc:mga0sz30_56176_c1_208_1116 | 302 |
| 485 | 3300053092 | Ga0500583_0021436 | Ga0500583_0021436_586_1494 | 302 |
| 486 | 3300053098 | Ga0500650_0037707 | Ga0500650_0037707_665_1573 | 302 |
| 487 | 3300053139 | Ga0500568_0102426 | Ga0500568_0102426_135_1043 | 302 |
| 488 | 3300053151 | Ga0500604_0002914 | Ga0500604_0002914_2291_3199 | 302 |
| 489 | 3300005330 | Ga0070690_100000569 | Ga0070690_1000005692 | 303 |
| 490 | 3300005334 | Ga0068869_100000727 | Ga0068869_1000007277 | 303 |
| 491 | 3300005336 | Ga0070680_100001166 | Ga0070680_1000011667 | 303 |
| 492 | 3300005337 | Ga0070682_100026721 | Ga0070682_1000267212 | 303 |
| 493 | 3300005338 | Ga0068868_100000716 | Ga0068868_10000071619 | 303 |
| 494 | 3300005340 | Ga0070689_100000798 | Ga0070689_1000007982 | 303 |
| 495 | 3300005341 | Ga0070691_10000223 | Ga0070691_100002232 | 303 |
| 496 | 3300005343 | Ga0070687_100003027 | Ga0070687_1000030276 | 303 |
| 497 | 3300005345 | Ga0070692_10003091 | Ga0070692_100030916 | 303 |
| 498 | 3300005353 | Ga0070669_100178419 | Ga0070669_1001784192 | 303 |
| 499 | 3300005355 | Ga0070671_100337533 | Ga0070671_1003375332 | 303 |
| 500 | 3300005365 | Ga0070688_100124647 | Ga0070688_1001246472 | 303 |
| 501 | 3300005406 | Ga0070703_10008430 | Ga0070703_100084302 | 303 |
| 502 | 3300005438 | Ga0070701_10002181 | Ga0070701_100021817 | 303 |
| 503 | 3300005440 | Ga0070705_100000565 | Ga0070705_10000056516 | 303 |
| 504 | 3300005441 | Ga0070700_100000265 | Ga0070700_10000026510 | 303 |
| 505 | 3300005444 | Ga0070694_100000584 | Ga0070694_10000058416 | 303 |
| 506 | 3300005459 | Ga0068867_100006495 | Ga0068867_1000064952 | 303 |
| 507 | 3300005530 | Ga0070679_100004913 | Ga0070679_1000049137 | 303 |
| 508 | 3300005536 | Ga0070697_100138959 | Ga0070697_1001389591 | 303 |
| 509 | 3300005544 | Ga0070686_100002546 | Ga0070686_1000025463 | 303 |
| 510 | 3300005545 | Ga0070695_100004011 | Ga0070695_1000040112 | 303 |
| 511 | 3300005546 | Ga0070696_100000689 | Ga0070696_1000006897 | 303 |
| 512 | 3300005547 | Ga0070693_100000145 | Ga0070693_10000014516 | 303 |
| 513 | 3300005549 | Ga0070704_100003704 | Ga0070704_1000037042 | 303 |
| 514 | 3300005563 | Ga0068855_100012503 | Ga0068855_1000125032 | 303 |
| 515 | 3300005578 | Ga0068854_100007979 | Ga0068854_1000079797 | 303 |
| 516 | 3300005614 | Ga0068856_100026262 | Ga0068856_1000262622 | 303 |
| 517 | 3300005615 | Ga0070702_100000200 | Ga0070702_10000020017 | 303 |
| 518 | 3300005617 | Ga0068859_100008918 | Ga0068859_1000089184 | 303 |
| 519 | 3300005718 | Ga0068866_10000312 | Ga0068866_1000031213 | 303 |
| 520 | 3300005719 | Ga0068861_100003520 | Ga0068861_1000035209 | 303 |
| 521 | 3300005841 | Ga0068863_100241642 | Ga0068863_1002416422 | 303 |
| 522 | 3300005842 | Ga0068858_100022350 | Ga0068858_1000223503 | 303 |
| 523 | 3300005843 | Ga0068860_100011647 | Ga0068860_1000116477 | 303 |
| 524 | 3300005844 | Ga0068862_100149671 | Ga0068862_1001496712 | 303 |
| 525 | 3300006237 | Ga0097621_100001046 | Ga0097621_10000104617 | 303 |
| 526 | 3300006358 | Ga0068871_100000265 | Ga0068871_10000026517 | 303 |
| 527 | 3300006852 | Ga0075433_10000585 | Ga0075433_100005857 | 303 |
| 528 | 3300006871 | Ga0075434_100000221 | Ga0075434_10000022116 | 303 |
| 529 | 3300006880 | Ga0075429_100001446 | Ga0075429_1000014462 | 303 |
| 530 | 3300006880 | Ga0075429_100160624 | Ga0075429_1001606242 | 303 |
| 531 | 3300006881 | Ga0068865_100000608 | Ga0068865_1000006082 | 303 |
| 532 | 3300006914 | Ga0075436_100001062 | Ga0075436_1000010622 | 303 |
| 533 | 3300006931 | Ga0097620_100008919 | Ga0097620_1000089194 | 303 |
| 534 | 3300007076 | Ga0075435_100001563 | Ga0075435_1000015633 | 303 |
| 535 | 3300009094 | Ga0111539_10406765 | Ga0111539_104067652 | 303 |
| 536 | 3300009098 | Ga0105245_10007488 | Ga0105245_100074887 | 303 |
| 537 | 3300009147 | Ga0114129_10014716 | Ga0114129_100147169 | 303 |
| 538 | 3300009148 | Ga0105243_10004754 | Ga0105243_100047549 | 303 |
| 539 | 3300009174 | Ga0105241_10015458 | Ga0105241_100154582 | 303 |
| 540 | 3300009176 | Ga0105242_10000646 | Ga0105242_1000064617 | 303 |
| 541 | 3300009553 | Ga0105249_10011456 | Ga0105249_100114562 | 303 |
| 542 | 3300013297 | Ga0157378_10002299 | Ga0157378_1000229911 | 303 |
| 543 | 3300013308 | Ga0157375_10075450 | Ga0157375_100754502 | 303 |
| 544 | 3300014326 | Ga0157380_10077505 | Ga0157380_100775052 | 303 |
| 545 | 3300014969 | Ga0157376_10003492 | Ga0157376_100034922 | 303 |
| 546 | 3300025885 | Ga0207653_10016885 | Ga0207653_100168852 | 303 |
| 547 | 3300025899 | Ga0207642_10000981 | Ga0207642_100009819 | 303 |
| 548 | 3300025911 | Ga0207654_10021198 | Ga0207654_100211982 | 303 |
| 549 | 3300025917 | Ga0207660_10001221 | Ga0207660_1000122116 | 303 |
| 550 | 3300025918 | Ga0207662_10002183 | Ga0207662_100021832 | 303 |
| 551 | 3300025926 | Ga0207659_10038266 | Ga0207659_100382662 | 303 |
| 552 | 3300025927 | Ga0207687_10003360 | Ga0207687_100033601 | 303 |
| 553 | 3300025931 | Ga0207644_10272606 | Ga0207644_102726062 | 303 |
| 554 | 3300025934 | Ga0207686_10001709 | Ga0207686_100017092 | 303 |
| 555 | 3300025935 | Ga0207709_10002039 | Ga0207709_100020392 | 303 |
| 556 | 3300025936 | Ga0207670_10005788 | Ga0207670_100057886 | 303 |
| 557 | 3300025936 | Ga0207670_10026604 | Ga0207670_100266042 | 303 |
| 558 | 3300025938 | Ga0207704_10000577 | Ga0207704_100005777 | 303 |
| 559 | 3300025942 | Ga0207689_10001695 | Ga0207689_1000169516 | 303 |
| 560 | 3300025942 | Ga0207689_10018441 | Ga0207689_100184412 | 303 |
| 561 | 3300025949 | Ga0207667_10016185 | Ga0207667_100161852 | 303 |
| 562 | 3300025961 | Ga0207712_10026104 | Ga0207712_100261042 | 303 |
| 563 | 3300025981 | Ga0207640_10007759 | Ga0207640_100077592 | 303 |
| 564 | 3300026023 | Ga0207677_10002281 | Ga0207677_100022816 | 303 |
| 565 | 3300026023 | Ga0207677_10328826 | Ga0207677_103288262 | 303 |
| 566 | 3300026035 | Ga0207703_10006142 | Ga0207703_100061425 | 303 |
| 567 | 3300026041 | Ga0207639_10133954 | Ga0207639_101339542 | 303 |
| 568 | 3300026075 | Ga0207708_10000723 | Ga0207708_1000072324 | 303 |
| 569 | 3300026078 | Ga0207702_10040706 | Ga0207702_100407062 | 303 |
| 570 | 3300026088 | Ga0207641_10210469 | Ga0207641_102104692 | 303 |
| 571 | 3300026089 | Ga0207648_10001968 | Ga0207648_1000196817 | 303 |
| 572 | 3300026118 | Ga0207675_100002725 | Ga0207675_10000272511 | 303 |
| 573 | 3300026118 | Ga0207675_100491091 | Ga0207675_1004910912 | 303 |
| 574 | 3300026142 | Ga0207698_10307396 | Ga0207698_103073962 | 303 |
| 575 | 3300027907 | Ga0207428_10002376 | Ga0207428_1000237617 | 303 |
| 576 | 3300028380 | Ga0268265_10003024 | Ga0268265_100030249 | 303 |
| 577 | 3300028380 | Ga0268265_10179199 | Ga0268265_101791992 | 303 |
| 578 | 3300028381 | Ga0268264_10006262 | Ga0268264_100062624 | 303 |
| 579 | 3300034818 | Ga0373950_0030012 | Ga0373950_0030012_46_960 | 303 |
| 580 | 3300035092 | Ga0373952_0028312 | Ga0373952_0028312_270_1184 | 303 |
| 581 | 3300035691 | Ga0373931_0039864 | Ga0373931_0039864_1323_2237 | 303 |
| 582 | 3300042876 | Ga0451577_0008898 | Ga0451577_0008898_4312_5226 | 303 |
| 583 | 3300045051 | Ga0451576_0026374 | Ga0451576_0026374_4642_5556 | 303 |
| 584 | 3300048909 | Ga0496106_0170045 | Ga0496106_0170045_275_1189 | 303 |
| 585 | 3300049582 | Ga0501048_0094342 | Ga0501048_0094342_851_1762 | 303 |
| 586 | 3300049824 | Ga0501045_0263879 | Ga0501045_0263879_253_1164 | 303 |
| 587 | 3300050507 | nmdc:mga05p37_24008_c1 | nmdc:mga05p37_24008_c1_4386_5300 | 303 |
| 588 | 3300050508 | nmdc:mga09592_2982_c1 | nmdc:mga09592_2982_c1_9024_9938 | 303 |
| 589 | 3300050511 | nmdc:mga08y16_82303_c1 | nmdc:mga08y16_82303_c1_1122_2036 | 303 |
| 590 | 3300050512 | nmdc:mga0n895_9771_c1 | nmdc:mga0n895_9771_c1_6768_7682 | 303 |
| 591 | 3300050513 | nmdc:mga0rr50_681_c1 | nmdc:mga0rr50_681_c1_2133_3047 | 303 |
| 592 | 3300050515 | nmdc:mga0a205_106_c1 | nmdc:mga0a205_106_c1_16158_17072 | 303 |
| 593 | 3300054114 | Ga0501084_0087785 | Ga0501084_0087785_229_1140 | 303 |
| 594 | 3300042876 | Ga0451577_0311875 | Ga0451577_0311875_418_1344 | 304 |
| 595 | 3300045051 | Ga0451576_0149596 | Ga0451576_0149596_556_1470 | 304 |
| 596 | 3300053153 | Ga0500616_0052178 | Ga0500616_0052178_738_1652 | 304 |
| 597 | 3300003203 | JGI25406J46586_10027380 | JGI25406J46586_100273802 | 305 |
| 598 | 3300005985 | Ga0081539_10004639 | Ga0081539_1000463910 | 305 |
| 599 | 3300044706 | Ga0466964_0080392 | Ga0466964_0080392_242_1171 | 305 |
| 600 | 3300045976 | Ga0466967_0008630 | Ga0466967_0008630_4863_5792 | 305 |
| 601 | 3300046684 | Ga0495669_0051626 | Ga0495669_0051626_691_1611 | 305 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cl6-assembly1.cif.gz_A | crystal structure of puue allantoinase | 0.8615 | 25 | 296 |
| 1z7a-assembly1.cif.gz_C | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8535 | 25 | 296 |
| 3s6o-assembly1.cif.gz_D | crystal structure of a polysaccharide deacetylase family protein from burkholderia pseudomallei | 0.8319 | 25 | 289 |
| 3qbu-assembly1.cif.gz_C | crystal structure of putative peptidoglycan deactelyase (hp0310) from helicobacter pylori | 0.813 | 29 | 294 |
| 3rxz-assembly1.cif.gz_B | crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis | 0.8018 | 23 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qbuB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.813 | 29 | 294 | 3.20.20.370 |
| af_O13842_2_320_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7995 | 25 | 295 | 3.20.20.370 |
| 1z7aC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7982 | 25 | 296 | 3.20.20.370 |
| 3rxzD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7962 | 16 | 305 | 3.20.20.370 |
| 2cc0B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7916 | 33 | 268 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J4Q6J7-F1-model_v4 | Polysaccharide deacetylase | 0.9595 | 168 | 292 |
GO:0005975
|
| AF-A0A7K0RV96-F1-model_v4 | deleted | 0.9572 | 153 | 290 |
|
| AF-A0A1F3ZV34-F1-model_v4 | NodB homology domain-containing protein | 0.9541 | 69 | 293 |
GO:0005975
GO:0016810 |
| AF-A0A2V7FBS8-F1-model_v4 | Polysaccharide deacetylase | 0.9516 | 97 | 294 |
GO:0005975
|
| AF-A0A536WHK6-F1-model_v4 | Polysaccharide deacetylase | 0.9457 | 63 | 296 |
GO:0005975
GO:0016810 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar