F468049

General Info

Members Datasets Scaffolds Average Seq Length
601 268 535 300

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100160624|Ga0075429_1001606242
Length 309
Sequence LKPLLPQHGRYDFVPLPERKDYSWPGGKRLAFLLTTNVEWFAFGAGLGHDPAKAGEPQTHRNYAWRDYGNRIGVWRLLELFDELKLPAAHNTNSLVYDYAPQVMAAIRKRGDEVVAHGRTNAENLRGLWQPDEERLLKEVTETIARHEGRPPAGWMGTGAYETAHTLDLLKELGYRYVMDWPMDDQPVWLRTRAGPLLSLPYPIELNDSQVIVHRRQGAAEFCDMVVDQFDEMVGQCERHPLVMNVSVHTYVFGQPFRLRRLRRALQHCMQHPLAPRVWWTRPREVAEHCERLAPGIVPGSPLLSGKTT

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
170 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
260 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
261 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 1
Rhizosphere 96.17
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10027380 3300003203 Bacteria 2187
2 Ga0065712_10112361 3300005290 Bacteria 1801
3 Ga0065712_10171761 3300005290 Bacteria 1240
4 Ga0070676_10054557 3300005328 Bacteria 2356
5 Ga0070683_100042288 3300005329 Bacteria 4196
6 Ga0070683_100259914 3300005329 Bacteria 1651
7 Ga0070690_100000569 3300005330 Bacteria 18589
8 Ga0070690_100015303 3300005330 Bacteria 4573
9 Ga0070690_100024340 3300005330 Bacteria 3722
10 Ga0070690_100051358 3300005330 Bacteria 2632
11 Ga0070690_100106878 3300005330 Bacteria 1862
12 Ga0070677_10033068 3300005333 Unclassified 1988
13 Ga0070677_10070892 3300005333 Bacteria 1466
14 Ga0068869_100000727 3300005334 Bacteria 18759
15 Ga0068869_100098099 3300005334 Bacteria 2213
16 Ga0068869_100110789 3300005334 Bacteria 2088
17 Ga0070666_10019897 3300005335 Bacteria 4336
18 Ga0070680_100001166 3300005336 Bacteria 18880
19 Ga0070680_100055213 3300005336 Bacteria 3246
20 Ga0070680_100075327 3300005336 Bacteria 2778
21 Ga0070680_100209513 3300005336 Bacteria 1644
22 Ga0070682_100026721 3300005337 Bacteria 3458
23 Ga0070682_100050434 3300005337 Bacteria 2598
24 Ga0068868_100000716 3300005338 Bacteria 22378
25 Ga0068868_100103275 3300005338 Bacteria 2309
26 Ga0068868_100192749 3300005338 Bacteria 1695
27 Ga0068868_100238149 3300005338 Bacteria 1528
28 Ga0070689_100000798 3300005340 Bacteria 19377
29 Ga0070689_100034383 3300005340 Bacteria 3867
30 Ga0070689_100227338 3300005340 Bacteria 1533
31 Ga0070691_10000223 3300005341 Bacteria 19212
32 Ga0070687_100003027 3300005343 Bacteria 6461
33 Ga0070687_100127964 3300005343 Bacteria 1463
34 Ga0070661_100249383 3300005344 Unclassified 1369
35 Ga0070692_10003091 3300005345 Bacteria 6657
36 Ga0070692_10138357 3300005345 Bacteria 1375
37 Ga0070668_100071747 3300005347 Bacteria 2698
38 Ga0070669_100014122 3300005353 Bacteria 5682
39 Ga0070669_100148772 3300005353 Bacteria 1811
40 Ga0070669_100178419 3300005353 Bacteria 1660
41 Ga0070675_100020836 3300005354 Bacteria 5233
42 Ga0070671_100012340 3300005355 Bacteria 6880
43 Ga0070671_100337533 3300005355 Bacteria 1285
44 Ga0070674_100034607 3300005356 Bacteria 3375
45 Ga0070673_100203434 3300005364 Unclassified 1706
46 Ga0070688_100075935 3300005365 Bacteria 2161
47 Ga0070688_100124647 3300005365 Bacteria 1730
48 Ga0070667_100321398 3300005367 Unclassified 1396
49 Ga0070703_10008430 3300005406 Bacteria 2898
50 Ga0070714_100592491 3300005435 Bacteria 1064
51 Ga0070701_10002181 3300005438 Bacteria 7459
52 Ga0070705_100000565 3300005440 Bacteria 21451
53 Ga0070705_100008174 3300005440 Bacteria 5174
54 Ga0070705_100102990 3300005440 Bacteria 1807
55 Ga0070700_100000265 3300005441 Bacteria 27920
56 Ga0070700_100283158 3300005441 Bacteria 1203
57 Ga0070700_100295320 3300005441 Bacteria 1180
58 Ga0070694_100000584 3300005444 Bacteria 20131
59 Ga0070694_100005795 3300005444 Bacteria 7495
60 Ga0070694_100008158 3300005444 Bacteria 6394
61 Ga0070694_100015352 3300005444 Bacteria 4809
62 Ga0070694_100027884 3300005444 Bacteria 3671
63 Ga0070694_100062976 3300005444 Bacteria 2535
64 Ga0070708_100085748 3300005445 Bacteria 2859
65 Ga0070708_100139193 3300005445 Bacteria 2250
66 Ga0070678_100204434 3300005456 Bacteria 1632
67 Ga0070678_100284528 3300005456 Bacteria 1399
68 Ga0070681_10007341 3300005458 Bacteria 10768
69 Ga0070681_10017899 3300005458 Bacteria 7082
70 Ga0070681_10050204 3300005458 Bacteria 4163
71 Ga0068867_100006495 3300005459 Bacteria 8260
72 Ga0068867_100252721 3300005459 Bacteria 1434
73 Ga0070706_100094706 3300005467 Bacteria 2771
74 Ga0070707_100030431 3300005468 Bacteria 5140
75 Ga0070707_100032470 3300005468 Bacteria 4975
76 Ga0070699_100055168 3300005518 Bacteria 3441
77 Ga0070699_100065005 3300005518 Bacteria 3165
78 Ga0070679_100004913 3300005530 Bacteria 12333
79 Ga0070679_100045732 3300005530 Bacteria 4362
80 Ga0070684_100088585 3300005535 Bacteria 2750
81 Ga0070697_100004116 3300005536 Bacteria 11145
82 Ga0070697_100138959 3300005536 Bacteria 2042
83 Ga0070697_100179151 3300005536 Unclassified 1796
84 Ga0070697_100423611 3300005536 Bacteria 1157
85 Ga0068853_100121010 3300005539 Bacteria 2335
86 Ga0068853_100301215 3300005539 Unclassified 1482
87 Ga0070686_100002546 3300005544 Bacteria 10047
88 Ga0070695_100004011 3300005545 Bacteria 8606
89 Ga0070695_100020688 3300005545 Bacteria 4019
90 Ga0070695_100041853 3300005545 Bacteria 2905
91 Ga0070695_100056782 3300005545 Bacteria 2527
92 Ga0070695_100064538 3300005545 Bacteria 2383
93 Ga0070695_100158500 3300005545 Bacteria 1586
94 Ga0070696_100000689 3300005546 Bacteria 21599
95 Ga0070696_100003145 3300005546 Bacteria 10989
96 Ga0070696_100003505 3300005546 Bacteria 10431
97 Ga0070696_100056110 3300005546 Bacteria 2747
98 Ga0070696_100136829 3300005546 Bacteria 1786
99 Ga0070696_100256437 3300005546 Bacteria 1324
100 Ga0070696_100325644 3300005546 Bacteria 1184
101 Ga0070693_100000145 3300005547 Bacteria 32140
102 Ga0070693_100189004 3300005547 Unclassified 1331
103 Ga0070665_100491272 3300005548 Bacteria 1238
104 Ga0070704_100003704 3300005549 Bacteria 8802
105 Ga0068855_100012503 3300005563 Bacteria 10246
106 Ga0070664_100081490 3300005564 Unclassified 2789
107 Ga0068857_100249863 3300005577 Bacteria 1626
108 Ga0068854_100001523 3300005578 Bacteria 14057
109 Ga0068854_100007979 3300005578 Bacteria 6780
110 Ga0068856_100026262 3300005614 Bacteria 5679
111 Ga0068856_100072061 3300005614 Bacteria 3421
112 Ga0070702_100000200 3300005615 Bacteria 19548
113 Ga0070702_100128441 3300005615 Unclassified 1597
114 Ga0070702_100245956 3300005615 Bacteria 1210
115 Ga0068852_100034260 3300005616 Bacteria 4222
116 Ga0068852_100244240 3300005616 Bacteria 1717
117 Ga0068852_100523772 3300005616 Bacteria 1183
118 Ga0068859_100008918 3300005617 Bacteria 10129
119 Ga0068859_100451914 3300005617 Bacteria 1381
120 Ga0068866_10000312 3300005718 Bacteria 23103
121 Ga0068861_100003520 3300005719 Bacteria 10408
122 Ga0068861_100012712 3300005719 Bacteria 5874
123 Ga0068870_10007393 3300005840 Bacteria 4893
124 Ga0068870_10065883 3300005840 Bacteria 1961
125 Ga0068870_10213603 3300005840 Bacteria 1177
126 Ga0068863_100078710 3300005841 Bacteria 3122
127 Ga0068863_100241642 3300005841 Bacteria 1743
128 Ga0068858_100022350 3300005842 Bacteria 5904
129 Ga0068858_100040094 3300005842 Bacteria 4342
130 Ga0068858_100382101 3300005842 Bacteria 1351
131 Ga0068860_100011647 3300005843 Bacteria 8673
132 Ga0068860_100059911 3300005843 Bacteria 3618
133 Ga0068862_100014677 3300005844 Bacteria 6507
134 Ga0068862_100044129 3300005844 Bacteria 3803
135 Ga0068862_100149671 3300005844 Bacteria 2077
136 Ga0081539_10004639 3300005985 Bacteria 14959
137 Ga0075363_100069621 3300006048 Unclassified 1909
138 Ga0075364_10110589 3300006051 Unclassified 1833
139 Ga0075362_10018242 3300006177 Bacteria 2900
140 Ga0097621_100001046 3300006237 Bacteria 19426
141 Ga0097621_100006938 3300006237 Bacteria 8063
142 Ga0097621_100055613 3300006237 Bacteria 3232
143 Ga0097621_100171278 3300006237 Bacteria 1871
144 Ga0075370_10050366 3300006353 Bacteria 2362
145 Ga0068871_100000265 3300006358 Bacteria 36023
146 Ga0068871_100003199 3300006358 Bacteria 11236
147 Ga0068871_100006079 3300006358 Bacteria 8496
148 Ga0075428_100016392 3300006844 Bacteria 8188
149 Ga0075428_100223785 3300006844 Bacteria 2032
150 Ga0075428_100243616 3300006844 Bacteria 1939
151 Ga0075428_100272128 3300006844 Bacteria 1822
152 Ga0075430_100002769 3300006846 Bacteria 14650
153 Ga0075430_100006542 3300006846 Bacteria 9828
154 Ga0075430_100119121 3300006846 Bacteria 2200
155 Ga0075431_100005545 3300006847 Bacteria 12458
156 Ga0075431_100021784 3300006847 Bacteria 6552
157 Ga0075431_100059936 3300006847 Bacteria 3928
158 Ga0075431_100133137 3300006847 Bacteria 2564
159 Ga0075431_100211314 3300006847 Bacteria 1982
160 Ga0075431_100610129 3300006847 Unclassified 1074
161 Ga0075433_10000585 3300006852 Bacteria 24157
162 Ga0075434_100000221 3300006871 Bacteria 38986
163 Ga0075434_100157400 3300006871 Unclassified 2291
164 Ga0075429_100001446 3300006880 Bacteria 19502
165 Ga0075429_100025305 3300006880 Bacteria 5151
166 Ga0075429_100084949 3300006880 Bacteria 2759
167 Ga0075429_100160624 3300006880 Bacteria 1968
168 Ga0068865_100000608 3300006881 Bacteria 20073
169 Ga0068865_100014208 3300006881 Bacteria 5054
170 Ga0075436_100000262 3300006914 Bacteria 32984
171 Ga0075436_100001062 3300006914 Bacteria 18522
172 Ga0075436_100018581 3300006914 Bacteria 4758
173 Ga0075436_100029416 3300006914 Bacteria 3778
174 Ga0075436_100079549 3300006914 Bacteria 2271
175 Ga0075436_100083728 3300006914 Bacteria 2213
176 Ga0075436_100092661 3300006914 Bacteria 2101
177 Ga0097620_100008919 3300006931 Bacteria 10129
178 Ga0097620_100451935 3300006931 Bacteria 1381
179 Ga0075435_100001563 3300007076 Bacteria 14769
180 Ga0075435_100133190 3300007076 Bacteria 2080
181 Ga0075435_100387349 3300007076 Unclassified 1201
182 Ga0099794_10013995 3300007265 Bacteria 3504
183 Ga0099794_10099175 3300007265 Bacteria 1453
184 Ga0111539_10012682 3300009094 Bacteria 10557
185 Ga0111539_10035511 3300009094 Bacteria 6034
186 Ga0111539_10102637 3300009094 Bacteria 3357
187 Ga0111539_10114889 3300009094 Bacteria 3157
188 Ga0111539_10206496 3300009094 Bacteria 2289
189 Ga0111539_10304019 3300009094 Bacteria 1856
190 Ga0111539_10406765 3300009094 Bacteria 1585
191 Ga0111539_10574232 3300009094 Bacteria 1313
192 Ga0111539_10591072 3300009094 Bacteria 1293
193 Ga0105245_10007488 3300009098 Bacteria 9565
194 Ga0114129_10014716 3300009147 Bacteria 11145
195 Ga0114129_10117651 3300009147 Bacteria 3661
196 Ga0114129_10267819 3300009147 Bacteria 2287
197 Ga0105243_10004754 3300009148 Bacteria 10674
198 Ga0105243_10009731 3300009148 Bacteria 7322
199 Ga0105241_10015458 3300009174 Bacteria 5591
200 Ga0105242_10000646 3300009176 Bacteria 27269
201 Ga0105249_10011456 3300009553 Bacteria 7788
202 Ga0105249_10262794 3300009553 Bacteria 1716
203 Ga0105246_10069838 3300011119 Bacteria 2468
204 Ga0105246_10076027 3300011119 Bacteria 2378
205 Ga0105246_10538435 3300011119 Bacteria 998
206 Ga0157374_10205469 3300013296 Bacteria 1930
207 Ga0157378_10002299 3300013297 Bacteria 16986
208 Ga0157378_10003345 3300013297 Bacteria 14263
209 Ga0163162_10058122 3300013306 Bacteria 3896
210 Ga0163162_10365175 3300013306 Bacteria 1576
211 Ga0157375_10029222 3300013308 Bacteria 5181
212 Ga0157375_10075450 3300013308 Bacteria 3396
213 Ga0157375_10573278 3300013308 Bacteria 1289
214 Ga0163163_10543395 3300014325 Bacteria 1224
215 Ga0157380_10077505 3300014326 Bacteria 2709
216 Ga0157380_10156053 3300014326 Bacteria 1978
217 Ga0157377_10062209 3300014745 Bacteria 2135
218 Ga0157379_10110606 3300014968 Bacteria 2467
219 Ga0157376_10003492 3300014969 Bacteria 10836
220 Ga0157376_10023911 3300014969 Bacteria 4791
221 Ga0157376_10396030 3300014969 Bacteria 1334
222 Ga0157376_10608592 3300014969 Bacteria 1088
223 Ga0207697_10004195 3300025315 Bacteria 6930
224 Ga0207653_10016885 3300025885 Bacteria 2295
225 Ga0207682_10003415 3300025893 Bacteria 6909
226 Ga0207682_10005427 3300025893 Bacteria 5189
227 Ga0207682_10031294 3300025893 Bacteria 2135
228 Ga0207642_10000981 3300025899 Bacteria 8904
229 Ga0207642_10080219 3300025899 Bacteria 1582
230 Ga0207688_10008300 3300025901 Bacteria 5646
231 Ga0207680_10009205 3300025903 Bacteria 4884
232 Ga0207680_10140942 3300025903 Bacteria 1598
233 Ga0207645_10006949 3300025907 Bacteria 8060
234 Ga0207645_10098736 3300025907 Bacteria 1883
235 Ga0207643_10010297 3300025908 Bacteria 5031
236 Ga0207643_10014651 3300025908 Bacteria 4262
237 Ga0207643_10028804 3300025908 Bacteria 3086
238 Ga0207684_10031595 3300025910 Bacteria 4503
239 Ga0207684_10092168 3300025910 Unclassified 2582
240 Ga0207684_10256637 3300025910 Bacteria 1508
241 Ga0207654_10021198 3300025911 Bacteria 3452
242 Ga0207707_10055304 3300025912 Unclassified 3452
243 Ga0207707_10167462 3300025912 Unclassified 1920
244 Ga0207707_10325691 3300025912 Bacteria 1326
245 Ga0207660_10001221 3300025917 Bacteria 17201
246 Ga0207660_10029306 3300025917 Bacteria 3774
247 Ga0207660_10130001 3300025917 Bacteria 1916
248 Ga0207660_10213231 3300025917 Bacteria 1513
249 Ga0207662_10002183 3300025918 Bacteria 9758
250 Ga0207652_10057958 3300025921 Bacteria 3336
251 Ga0207646_10297725 3300025922 Bacteria 1458
252 Ga0207681_10002576 3300025923 Bacteria 11497
253 Ga0207650_10017951 3300025925 Bacteria 4958
254 Ga0207659_10018543 3300025926 Bacteria 4564
255 Ga0207659_10038266 3300025926 Bacteria 3335
256 Ga0207659_10040969 3300025926 Bacteria 3242
257 Ga0207687_10003360 3300025927 Bacteria 10811
258 Ga0207687_10008829 3300025927 Bacteria 6587
259 Ga0207664_10481737 3300025929 Bacteria 1110
260 Ga0207644_10000583 3300025931 Bacteria 23344
261 Ga0207644_10272606 3300025931 Bacteria 1356
262 Ga0207706_10035583 3300025933 Bacteria 4426
263 Ga0207686_10001709 3300025934 Bacteria 12226
264 Ga0207709_10002039 3300025935 Bacteria 13087
265 Ga0207670_10005788 3300025936 Bacteria 6823
266 Ga0207670_10026604 3300025936 Bacteria 3647
267 Ga0207670_10073521 3300025936 Bacteria 2371
268 Ga0207670_10080609 3300025936 Bacteria 2276
269 Ga0207704_10000577 3300025938 Bacteria 16325
270 Ga0207704_10201817 3300025938 Bacteria 1456
271 Ga0207665_10064185 3300025939 Bacteria 2495
272 Ga0207665_10099998 3300025939 Bacteria 2023
273 Ga0207691_10000948 3300025940 Bacteria 28719
274 Ga0207691_10144747 3300025940 Bacteria 2093
275 Ga0207711_10105660 3300025941 Bacteria 2497
276 Ga0207689_10001695 3300025942 Bacteria 20948
277 Ga0207689_10004523 3300025942 Bacteria 12591
278 Ga0207689_10018441 3300025942 Bacteria 5890
279 Ga0207689_10047407 3300025942 Bacteria 3548
280 Ga0207689_10048356 3300025942 Bacteria 3508
281 Ga0207661_10283418 3300025944 Unclassified 1481
282 Ga0207667_10016185 3300025949 Bacteria 8431
283 Ga0207651_10073229 3300025960 Unclassified 2435
284 Ga0207651_10260283 3300025960 Bacteria 1424
285 Ga0207651_10273517 3300025960 Bacteria 1392
286 Ga0207712_10026104 3300025961 Bacteria 3889
287 Ga0207640_10007759 3300025981 Bacteria 5926
288 Ga0207677_10002281 3300026023 Bacteria 10074
289 Ga0207677_10328826 3300026023 Bacteria 1273
290 Ga0207703_10006142 3300026035 Bacteria 9612
291 Ga0207703_10028893 3300026035 Bacteria 4376
292 Ga0207639_10060460 3300026041 Bacteria 2923
293 Ga0207639_10133954 3300026041 Bacteria 2055
294 Ga0207639_10172612 3300026041 Unclassified 1832
295 Ga0207708_10000723 3300026075 Bacteria 24861
296 Ga0207708_10011989 3300026075 Bacteria 6459
297 Ga0207708_10012792 3300026075 Bacteria 6259
298 Ga0207708_10098180 3300026075 Bacteria 2264
299 Ga0207708_10355592 3300026075 Bacteria 1203
300 Ga0207708_10391022 3300026075 Bacteria 1148
301 Ga0207702_10040706 3300026078 Bacteria 3895
302 Ga0207641_10210469 3300026088 Bacteria 1798
303 Ga0207648_10001968 3300026089 Bacteria 22433
304 Ga0207648_10008599 3300026089 Bacteria 9873
305 Ga0207648_10024176 3300026089 Bacteria 5428
306 Ga0207648_10159375 3300026089 Bacteria 1993
307 Ga0207676_10332815 3300026095 Bacteria 1398
308 Ga0207674_10038517 3300026116 Bacteria 4960
309 Ga0207675_100002725 3300026118 Bacteria 17414
310 Ga0207675_100018330 3300026118 Bacteria 6527
311 Ga0207675_100025078 3300026118 Bacteria 5549
312 Ga0207675_100491091 3300026118 Bacteria 1221
313 Ga0207683_10000313 3300026121 Bacteria 44050
314 Ga0207683_10072035 3300026121 Bacteria 3056
315 Ga0207683_10115120 3300026121 Bacteria 2410
316 Ga0207683_10202488 3300026121 Bacteria 1805
317 Ga0207683_10355560 3300026121 Bacteria 1345
318 Ga0207698_10007556 3300026142 Bacteria 6815
319 Ga0207698_10307396 3300026142 Bacteria 1479
320 Ga0209969_1000257 3300027360 Bacteria 7078
321 Ga0209996_1011813 3300027395 Bacteria 1169
322 Ga0209995_1009346 3300027471 Bacteria 1584
323 Ga0209995_1010382 3300027471 Bacteria 1510
324 Ga0209999_1024424 3300027543 Bacteria 1115
325 Ga0209588_1054579 3300027671 Bacteria 1292
326 Ga0209971_1006911 3300027682 Bacteria 2691
327 Ga0209974_10006565 3300027876 Bacteria 4055
328 Ga0207428_10002376 3300027907 Bacteria 18802
329 Ga0207428_10012481 3300027907 Bacteria 7462
330 Ga0207428_10038351 3300027907 Bacteria 3895
331 Ga0207428_10300676 3300027907 Bacteria 1187
332 Ga0268265_10001655 3300028380 Bacteria 18241
333 Ga0268265_10003024 3300028380 Bacteria 12268
334 Ga0268265_10081790 3300028380 Bacteria 2551
335 Ga0268265_10179199 3300028380 Bacteria 1819
336 Ga0268265_10250309 3300028380 Bacteria 1569
337 Ga0268265_10259498 3300028380 Bacteria 1544
338 Ga0268264_10006262 3300028381 Bacteria 10039
339 Ga0265318_10098547 3300028577 Bacteria 1076
340 Ga0307515_10197509 3300028794 Bacteria 1899
341 Ga0307511_10000708 3300030521 Bacteria 35517
342 Ga0307408_100005606 3300031548 Bacteria 8390
343 Ga0307408_100024448 3300031548 Bacteria 4126
344 Ga0307408_100155943 3300031548 Bacteria 1808
345 Ga0307408_100210475 3300031548 Bacteria 1580
346 Ga0307408_100210641 3300031548 Unclassified 1579
347 Ga0265314_10085483 3300031711 Bacteria 2068
348 Ga0307405_10014840 3300031731 Bacteria 4202
349 Ga0307405_10183956 3300031731 Bacteria 1503
350 Ga0307413_10168746 3300031824 Bacteria 1546
351 Ga0307410_10002526 3300031852 Bacteria 8847
352 Ga0307410_10016677 3300031852 Bacteria 4389
353 Ga0307410_10084494 3300031852 Bacteria 2238
354 Ga0307406_10001695 3300031901 Bacteria 12103
355 Ga0307407_10006223 3300031903 Bacteria 5275
356 Ga0307412_10093104 3300031911 Bacteria 2113
357 Ga0307409_100047017 3300031995 Bacteria 3271
358 Ga0307416_100003872 3300032002 Bacteria 8910
359 Ga0307416_100042677 3300032002 Bacteria 3543
360 Ga0307416_100071962 3300032002 Bacteria 2875
361 Ga0307416_100099492 3300032002 Bacteria 2525
362 Ga0307416_100335862 3300032002 Bacteria 1521
363 Ga0307411_10102916 3300032005 Bacteria 2025
364 Ga0307411_10401099 3300032005 Bacteria 1134
365 Ga0373930_0033458 3300034816 Bacteria 1067
366 Ga0373950_0030012 3300034818 Bacteria 1003
367 Ga0373926_0001197 3300035083 Bacteria 7765
368 Ga0373928_0019485 3300035084 Bacteria 1416
369 Ga0373949_0006365 3300035090 Bacteria 2598
370 Ga0373952_0025807 3300035092 Bacteria 1272
371 Ga0373952_0028312 3300035092 Bacteria 1228
372 Ga0373932_0008856 3300035112 Bacteria 2409
373 Ga0373936_0144638 3300035113 Bacteria 1028
374 Ga0373945_0002628 3300035116 Bacteria 5627
375 Ga0373946_0001086 3300035171 Bacteria 9377
376 Ga0373961_0008126 3300035241 Bacteria 2550
377 Ga0373931_0006583 3300035691 Bacteria 5435
378 Ga0373931_0039864 3300035691 Bacteria 2461
379 Ga0373935_0070343 3300035692 Bacteria 2255
380 Ga0373927_0030989 3300035695 Bacteria 3488
381 Ga0373925_0021528 3300037068 Bacteria 4698
382 Ga0451577_0008898 3300042876 Bacteria 9720
383 Ga0451577_0057302 3300042876 Bacteria 3474
384 Ga0451577_0311875 3300042876 Bacteria 1426
385 Ga0466964_0080392 3300044706 Bacteria 1398
386 Ga0453684_0273586 3300044712 Bacteria 1929
387 Ga0451576_0026374 3300045051 Bacteria 6251
388 Ga0451576_0063476 3300045051 Bacteria 3850
389 Ga0451576_0149596 3300045051 Bacteria 2435
390 Ga0451576_0188049 3300045051 Bacteria 2156
391 Ga0451576_0205305 3300045051 Bacteria 2057
392 Ga0451576_0469638 3300045051 Bacteria 1321
393 Ga0466967_0008630 3300045976 Bacteria 7492
394 Ga0495592_0218138 3300046454 Bacteria 1277
395 Ga0495603_0015377 3300046455 Bacteria 4630
396 Ga0495629_0055613 3300046459 Bacteria 2767
397 Ga0495580_0008572 3300046472 Bacteria 8112
398 Ga0495582_0021379 3300046473 Bacteria 3541
399 Ga0495662_0022332 3300046476 Bacteria 3056
400 Ga0495594_0066301 3300046499 Bacteria 2003
401 Ga0495618_0122579 3300046514 Bacteria 1665
402 Ga0495628_0066781 3300046516 Bacteria 2811
403 Ga0495630_0026993 3300046517 Bacteria 4256
404 Ga0495666_0011053 3300046526 Bacteria 4504
405 Ga0495642_0007460 3300046528 Bacteria 4192
406 Ga0495642_0022793 3300046528 Bacteria 2469
407 Ga0495665_0015964 3300046531 Bacteria 4046
408 Ga0495586_0010979 3300046535 Bacteria 4811
409 Ga0495598_0004202 3300046537 Bacteria 3106
410 Ga0495598_0067107 3300046537 Bacteria 1121
411 Ga0495659_0043079 3300046664 Bacteria 1618
412 Ga0495588_0006001 3300046674 Bacteria 5450
413 Ga0495658_0005601 3300046683 Bacteria 6172
414 Ga0495669_0032906 3300046684 Bacteria 2281
415 Ga0495669_0051626 3300046684 Bacteria 1846
416 Ga0495670_0032545 3300046691 Bacteria 2594
417 Ga0495581_0101163 3300047315 Bacteria 1674
418 Ga0495676_0016910 3300047321 Bacteria 6458
419 Ga0495614_0112752 3300048089 Bacteria 1195
420 Ga0496104_0199888 3300048907 Bacteria 1911
421 Ga0496106_0170045 3300048909 Bacteria 1727
422 Ga0496107_0098053 3300048910 Bacteria 2147
423 Ga0496110_0130873 3300048913 Bacteria 2266
424 Ga0496110_0478313 3300048913 Bacteria 1135
425 Ga0496115_0367035 3300048918 Bacteria 1172
426 Ga0501292_011490 3300049515 Unclassified 1341
427 Ga0501031_0099438 3300049568 Bacteria 1898
428 Ga0501032_0046821 3300049569 Bacteria 2922
429 Ga0501033_0004209 3300049570 Bacteria 11581
430 Ga0501033_0084106 3300049570 Bacteria 2332
431 Ga0501034_0016205 3300049571 Bacteria 7646
432 Ga0501036_0002503 3300049572 Bacteria 14414
433 Ga0501036_0091684 3300049572 Bacteria 2567
434 Ga0501036_0236955 3300049572 Unclassified 1531
435 Ga0501037_0085020 3300049573 Bacteria 2290
436 Ga0501038_0006655 3300049574 Bacteria 10683
437 Ga0501039_0005669 3300049575 Bacteria 9453
438 Ga0501039_0057373 3300049575 Bacteria 3015
439 Ga0501040_0001508 3300049576 Bacteria 14780
440 Ga0501041_0000398 3300049577 Bacteria 21891
441 Ga0501042_0001320 3300049578 Bacteria 14461
442 Ga0501042_0070336 3300049578 Bacteria 2503
443 Ga0501042_0328063 3300049578 Bacteria 1106
444 Ga0501043_0006920 3300049579 Bacteria 9046
445 Ga0501043_0291833 3300049579 Bacteria 1248
446 Ga0501046_0000393 3300049580 Bacteria 43715
447 Ga0501046_0033459 3300049580 Bacteria 4153
448 Ga0501048_0000181 3300049582 Bacteria 39855
449 Ga0501048_0094342 3300049582 Bacteria 2111
450 Ga0501048_0094801 3300049582 Bacteria 2105
451 Ga0501067_0030352 3300049583 Bacteria 2998
452 Ga0501068_0003002 3300049584 Bacteria 8994
453 Ga0501069_0029677 3300049585 Unclassified 3002
454 Ga0501072_0001849 3300049588 Bacteria 15752
455 Ga0501072_0009997 3300049588 Bacteria 7215
456 Ga0501072_0216442 3300049588 Bacteria 1527
457 Ga0501072_0320455 3300049588 Bacteria 1232
458 Ga0501073_0188266 3300049589 Bacteria 1428
459 Ga0501074_0033418 3300049590 Bacteria 3727
460 Ga0501075_0000242 3300049591 Bacteria 29265
461 Ga0501075_0004582 3300049591 Bacteria 9370
462 Ga0501076_0001073 3300049592 Bacteria 17968
463 Ga0501076_0165838 3300049592 Bacteria 1800
464 Ga0501077_0002349 3300049593 Bacteria 11401
465 Ga0501077_0072244 3300049593 Bacteria 2186
466 Ga0501077_0121031 3300049593 Bacteria 1659
467 Ga0501079_0002630 3300049741 Bacteria 13065
468 Ga0501079_0017772 3300049741 Bacteria 5434
469 Ga0501079_0236362 3300049741 Bacteria 1428
470 Ga0501080_0002206 3300049742 Bacteria 16926
471 Ga0501080_0046509 3300049742 Bacteria 4040
472 Ga0501081_0000938 3300049743 Bacteria 17301
473 Ga0501081_0004554 3300049743 Bacteria 8901
474 Ga0501081_0081512 3300049743 Bacteria 2266
475 Ga0501035_0003028 3300049822 Bacteria 16113
476 Ga0501035_0025821 3300049822 Bacteria 5383
477 Ga0501044_0000255 3300049823 Bacteria 67530
478 Ga0501044_0073394 3300049823 Bacteria 3478
479 Ga0501045_0010531 3300049824 Bacteria 6475
480 Ga0501045_0030952 3300049824 Bacteria 3875
481 Ga0501045_0069481 3300049824 Bacteria 2589
482 Ga0501045_0263879 3300049824 Bacteria 1282
483 nmdc:mga0k408_88057_c1 3300050493 Unclassified 1824
484 nmdc:mga04h51_6567_c1 3300050495 Bacteria 3023
485 nmdc:mga07m45_74350_c1 3300050496 Bacteria 1936
486 nmdc:mga05p37_117796_c1 3300050507 Bacteria 3263
487 nmdc:mga05p37_24008_c1 3300050507 Bacteria 7406
488 nmdc:mga05p37_274434_c1 3300050507 Bacteria 2013
489 nmdc:mga09592_19475_c1 3300050508 Bacteria 5572
490 nmdc:mga09592_251016_c1 3300050508 Bacteria 1534
491 nmdc:mga09592_2982_c1 3300050508 Bacteria 13724
492 nmdc:mga0qj67_226236_c1 3300050509 Bacteria 1518
493 nmdc:mga0qj67_337046_c1 3300050509 Unclassified 1220
494 nmdc:mga0qj67_36587_c1 3300050509 Bacteria 3842
495 nmdc:mga0qj67_91441_c1 3300050509 Bacteria 2446
496 nmdc:mga06r32_97914_c1 3300050510 Bacteria 2875
497 nmdc:mga08y16_127092_c1 3300050511 Bacteria 2652
498 nmdc:mga08y16_16853_c1 3300050511 Bacteria 7691
499 nmdc:mga08y16_48515_c1 3300050511 Bacteria 4444
500 nmdc:mga08y16_545705_c1 3300050511 Bacteria 1174
501 nmdc:mga08y16_57930_c1 3300050511 Bacteria 4048
502 nmdc:mga08y16_68383_c1 3300050511 Bacteria 3703
503 nmdc:mga08y16_76545_c1 3300050511 Bacteria 3488
504 nmdc:mga08y16_82303_c1 3300050511 Bacteria 3356
505 nmdc:mga0n895_116567_c1 3300050512 Bacteria 2690
506 nmdc:mga0n895_129562_c1 3300050512 Unclassified 2547
507 nmdc:mga0n895_1538_c1 3300050512 Bacteria 17331
508 nmdc:mga0n895_169620_c1 3300050512 Bacteria 2214
509 nmdc:mga0n895_3919_c1 3300050512 Bacteria 12090
510 nmdc:mga0n895_9771_c1 3300050512 Bacteria 8421
511 nmdc:mga0rr50_26358_c1 3300050513 Bacteria 4054
512 nmdc:mga0rr50_681_c1 3300050513 Bacteria 18200
513 nmdc:mga08x19_225242_c1 3300050514 Bacteria 1289
514 nmdc:mga08x19_23420_c1 3300050514 Bacteria 3831
515 nmdc:mga08x19_453_c1 3300050514 Bacteria 27975
516 nmdc:mga08x19_6130_c1 3300050514 Bacteria 7110
517 nmdc:mga08x19_70977_c1 3300050514 Bacteria 2270
518 nmdc:mga08x19_8906_c1 3300050514 Bacteria 5988
519 nmdc:mga0a205_106_c1 3300050515 Bacteria 48183
520 nmdc:mga0a205_166610_c1 3300050515 Bacteria 2099
521 nmdc:mga0a205_21674_c1 3300050515 Bacteria 4207
522 nmdc:mga0sz30_5279_c1 3300050516 Bacteria 4731
523 nmdc:mga0sz30_56176_c1 3300050516 Unclassified 1676
524 Ga0500583_0021436 3300053092 Bacteria 2687
525 Ga0500650_0037707 3300053098 Bacteria 2222
526 Ga0500568_0102426 3300053139 Bacteria 1073
527 Ga0500604_0002914 3300053151 Bacteria 4628
528 Ga0500616_0052178 3300053153 Bacteria 2152
529 Ga0500634_0055328 3300053161 Bacteria 2122
530 Ga0501084_0002815 3300054114 Bacteria 14041
531 Ga0501084_0087785 3300054114 Bacteria 2611
532 Ga0501082_0000358 3300060353 Bacteria 40322
533 Ga0501082_0012656 3300060353 Bacteria 7252
534 Ga0530510_0002277 3300061734 Bacteria 13168
535 Ga0530510_0091644 3300061734 Bacteria 2218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028577 Ga0265318_10098547 Ga0265318_100985471 262
2 3300050509 nmdc:mga0qj67_337046_c1 nmdc:mga0qj67_337046_c1_81_872 262
3 3300005336 Ga0070680_100075327 Ga0070680_1000753272 280
4 3300005345 Ga0070692_10138357 Ga0070692_101383572 280
5 3300005440 Ga0070705_100102990 Ga0070705_1001029902 280
6 3300005444 Ga0070694_100005795 Ga0070694_1000057953 280
7 3300025917 Ga0207660_10213231 Ga0207660_102132312 281
8 3300005546 Ga0070696_100056110 Ga0070696_1000561103 283
9 3300007076 Ga0075435_100133190 Ga0075435_1001331902 287
10 3300007265 Ga0099794_10099175 Ga0099794_100991752 287
11 3300050512 nmdc:mga0n895_116567_c1 nmdc:mga0n895_116567_c1_1021_1884 287
12 3300050513 nmdc:mga0rr50_26358_c1 nmdc:mga0rr50_26358_c1_553_1416 287
13 3300050515 nmdc:mga0a205_21674_c1 nmdc:mga0a205_21674_c1_956_1819 287
14 3300005518 Ga0070699_100055168 Ga0070699_1000551682 288
15 3300005536 Ga0070697_100423611 Ga0070697_1004236111 288
16 3300006914 Ga0075436_100000262 Ga0075436_10000026228 288
17 3300006914 Ga0075436_100079549 Ga0075436_1000795491 288
18 3300025939 Ga0207665_10064185 Ga0207665_100641851 288
19 3300050514 nmdc:mga08x19_453_c1 nmdc:mga08x19_453_c1_7881_8747 288
20 3300050514 nmdc:mga08x19_70977_c1 nmdc:mga08x19_70977_c1_1223_2089 288
21 3300050515 nmdc:mga0a205_166610_c1 nmdc:mga0a205_166610_c1_339_1205 288
22 3300005338 Ga0068868_100238149 Ga0068868_1002381492 289
23 3300005334 Ga0068869_100098099 Ga0068869_1000980993 291
24 3300005354 Ga0070675_100020836 Ga0070675_1000208362 291
25 3300005441 Ga0070700_100295320 Ga0070700_1002953202 291
26 3300005546 Ga0070696_100325644 Ga0070696_1003256442 291
27 3300006846 Ga0075430_100119121 Ga0075430_1001191212 291
28 3300025926 Ga0207659_10018543 Ga0207659_100185432 291
29 3300025942 Ga0207689_10048356 Ga0207689_100483563 291
30 3300025960 Ga0207651_10273517 Ga0207651_102735172 291
31 3300026075 Ga0207708_10391022 Ga0207708_103910221 291
32 3300026089 Ga0207648_10159375 Ga0207648_101593752 291
33 3300026121 Ga0207683_10115120 Ga0207683_101151203 291
34 3300028380 Ga0268265_10259498 Ga0268265_102594982 291
35 3300031548 Ga0307408_100155943 Ga0307408_1001559432 291
36 3300032002 Ga0307416_100071962 Ga0307416_1000719623 291
37 3300046528 Ga0495642_0022793 Ga0495642_0022793_1406_2281 291
38 3300050509 nmdc:mga0qj67_226236_c1 nmdc:mga0qj67_226236_c1_570_1445 291
39 3300005546 Ga0070696_100003505 Ga0070696_1000035052 293
40 3300005330 Ga0070690_100000569 Ga0070690_1000005695 294
41 3300005330 Ga0070690_100051358 Ga0070690_1000513583 294
42 3300005334 Ga0068869_100000727 Ga0068869_1000007274 294
43 3300005336 Ga0070680_100001166 Ga0070680_10000116610 294
44 3300005337 Ga0070682_100050434 Ga0070682_1000504341 294
45 3300005338 Ga0068868_100000716 Ga0068868_10000071616 294
46 3300005340 Ga0070689_100000798 Ga0070689_1000007985 294
47 3300005340 Ga0070689_100034383 Ga0070689_1000343834 294
48 3300005341 Ga0070691_10000223 Ga0070691_100002235 294
49 3300005343 Ga0070687_100003027 Ga0070687_1000030273 294
50 3300005345 Ga0070692_10003091 Ga0070692_100030913 294
51 3300005438 Ga0070701_10002181 Ga0070701_100021814 294
52 3300005440 Ga0070705_100000565 Ga0070705_10000056519 294
53 3300005441 Ga0070700_100000265 Ga0070700_10000026513 294
54 3300005444 Ga0070694_100000584 Ga0070694_10000058413 294
55 3300005459 Ga0068867_100006495 Ga0068867_1000064955 294
56 3300005530 Ga0070679_100004913 Ga0070679_10000491310 294
57 3300005539 Ga0068853_100121010 Ga0068853_1001210103 294
58 3300005544 Ga0070686_100002546 Ga0070686_1000025466 294
59 3300005545 Ga0070695_100004011 Ga0070695_1000040115 294
60 3300005545 Ga0070695_100064538 Ga0070695_1000645382 294
61 3300005546 Ga0070696_100000689 Ga0070696_10000068910 294
62 3300005547 Ga0070693_100000145 Ga0070693_10000014513 294
63 3300005549 Ga0070704_100003704 Ga0070704_1000037045 294
64 3300005563 Ga0068855_100012503 Ga0068855_1000125035 294
65 3300005578 Ga0068854_100007979 Ga0068854_1000079794 294
66 3300005614 Ga0068856_100072061 Ga0068856_1000720614 294
67 3300005615 Ga0070702_100000200 Ga0070702_10000020014 294
68 3300005616 Ga0068852_100523772 Ga0068852_1005237722 294
69 3300005617 Ga0068859_100008918 Ga0068859_1000089187 294
70 3300005617 Ga0068859_100451914 Ga0068859_1004519142 294
71 3300005718 Ga0068866_10000312 Ga0068866_1000031210 294
72 3300005719 Ga0068861_100003520 Ga0068861_1000035206 294
73 3300005840 Ga0068870_10007393 Ga0068870_100073933 294
74 3300005842 Ga0068858_100040094 Ga0068858_1000400942 294
75 3300005843 Ga0068860_100011647 Ga0068860_1000116474 294
76 3300005844 Ga0068862_100014677 Ga0068862_1000146774 294
77 3300006237 Ga0097621_100001046 Ga0097621_10000104614 294
78 3300006358 Ga0068871_100000265 Ga0068871_10000026514 294
79 3300006844 Ga0075428_100016392 Ga0075428_1000163926 294
80 3300006846 Ga0075430_100006542 Ga0075430_10000654210 294
81 3300006847 Ga0075431_100059936 Ga0075431_1000599363 294
82 3300006847 Ga0075431_100211314 Ga0075431_1002113142 294
83 3300006852 Ga0075433_10000585 Ga0075433_100005854 294
84 3300006871 Ga0075434_100000221 Ga0075434_10000022113 294
85 3300006880 Ga0075429_100025305 Ga0075429_1000253054 294
86 3300006881 Ga0068865_100000608 Ga0068865_1000006085 294
87 3300006914 Ga0075436_100001062 Ga0075436_1000010625 294
88 3300006931 Ga0097620_100008919 Ga0097620_1000089197 294
89 3300006931 Ga0097620_100451935 Ga0097620_1004519352 294
90 3300007076 Ga0075435_100001563 Ga0075435_1000015636 294
91 3300009094 Ga0111539_10035511 Ga0111539_100355114 294
92 3300009094 Ga0111539_10102637 Ga0111539_101026373 294
93 3300009098 Ga0105245_10007488 Ga0105245_100074884 294
94 3300009148 Ga0105243_10004754 Ga0105243_100047546 294
95 3300009176 Ga0105242_10000646 Ga0105242_1000064614 294
96 3300009553 Ga0105249_10011456 Ga0105249_100114565 294
97 3300011119 Ga0105246_10069838 Ga0105246_100698382 294
98 3300013297 Ga0157378_10002299 Ga0157378_1000229914 294
99 3300013306 Ga0163162_10365175 Ga0163162_103651752 294
100 3300014968 Ga0157379_10110606 Ga0157379_101106062 294
101 3300025899 Ga0207642_10000981 Ga0207642_100009816 294
102 3300025908 Ga0207643_10014651 Ga0207643_100146514 294
103 3300025912 Ga0207707_10325691 Ga0207707_103256912 294
104 3300025918 Ga0207662_10002183 Ga0207662_100021835 294
105 3300025921 Ga0207652_10057958 Ga0207652_100579582 294
106 3300025927 Ga0207687_10008829 Ga0207687_100088294 294
107 3300025934 Ga0207686_10001709 Ga0207686_100017095 294
108 3300025935 Ga0207709_10002039 Ga0207709_100020395 294
109 3300025936 Ga0207670_10005788 Ga0207670_100057883 294
110 3300025936 Ga0207670_10080609 Ga0207670_100806093 294
111 3300025938 Ga0207704_10000577 Ga0207704_100005774 294
112 3300025939 Ga0207665_10099998 Ga0207665_100999982 294
113 3300025942 Ga0207689_10001695 Ga0207689_1000169519 294
114 3300025942 Ga0207689_10018441 Ga0207689_100184415 294
115 3300025949 Ga0207667_10016185 Ga0207667_100161855 294
116 3300025981 Ga0207640_10007759 Ga0207640_100077595 294
117 3300026023 Ga0207677_10002281 Ga0207677_100022813 294
118 3300026035 Ga0207703_10006142 Ga0207703_100061428 294
119 3300026035 Ga0207703_10028893 Ga0207703_100288933 294
120 3300026041 Ga0207639_10060460 Ga0207639_100604602 294
121 3300026089 Ga0207648_10001968 Ga0207648_1000196820 294
122 3300026118 Ga0207675_100002725 Ga0207675_10000272514 294
123 3300027907 Ga0207428_10012481 Ga0207428_100124816 294
124 3300027907 Ga0207428_10038351 Ga0207428_100383512 294
125 3300028380 Ga0268265_10003024 Ga0268265_100030246 294
126 3300028380 Ga0268265_10250309 Ga0268265_102503092 294
127 3300028381 Ga0268264_10006262 Ga0268264_100062627 294
128 3300032002 Ga0307416_100335862 Ga0307416_1003358621 294
129 3300035090 Ga0373949_0006365 Ga0373949_0006365_787_1671 294
130 3300035112 Ga0373932_0008856 Ga0373932_0008856_849_1733 294
131 3300035241 Ga0373961_0008126 Ga0373961_0008126_107_991 294
132 3300035691 Ga0373931_0006583 Ga0373931_0006583_1838_2722 294
133 3300042876 Ga0451577_0008898 Ga0451577_0008898_1493_2377 294
134 3300044712 Ga0453684_0273586 Ga0453684_0273586_545_1429 294
135 3300045051 Ga0451576_0026374 Ga0451576_0026374_1823_2707 294
136 3300045051 Ga0451576_0188049 Ga0451576_0188049_167_1051 294
137 3300045051 Ga0451576_0205305 Ga0451576_0205305_342_1226 294
138 3300046537 Ga0495598_0004202 Ga0495598_0004202_1650_2534 294
139 3300046664 Ga0495659_0043079 Ga0495659_0043079_596_1480 294
140 3300046691 Ga0495670_0032545 Ga0495670_0032545_1174_2058 294
141 3300049588 Ga0501072_0320455 Ga0501072_0320455_245_1129 294
142 3300050508 nmdc:mga09592_2982_c1 nmdc:mga09592_2982_c1_11870_12754 294
143 3300050509 nmdc:mga0qj67_91441_c1 nmdc:mga0qj67_91441_c1_44_928 294
144 3300050511 nmdc:mga08y16_127092_c1 nmdc:mga08y16_127092_c1_739_1623 294
145 3300050511 nmdc:mga08y16_57930_c1 nmdc:mga08y16_57930_c1_264_1148 294
146 3300050512 nmdc:mga0n895_1538_c1 nmdc:mga0n895_1538_c1_1231_2115 294
147 3300050513 nmdc:mga0rr50_681_c1 nmdc:mga0rr50_681_c1_4979_5863 294
148 3300050514 nmdc:mga08x19_8906_c1 nmdc:mga08x19_8906_c1_2132_3016 294
149 3300050515 nmdc:mga0a205_106_c1 nmdc:mga0a205_106_c1_13342_14226 294
150 3300009147 Ga0114129_10267819 Ga0114129_102678192 295
151 3300046535 Ga0495586_0010979 Ga0495586_0010979_507_1397 295
152 3300050507 nmdc:mga05p37_274434_c1 nmdc:mga05p37_274434_c1_638_1525 295
153 3300005440 Ga0070705_100008174 Ga0070705_1000081742 296
154 3300005444 Ga0070694_100008158 Ga0070694_1000081584 296
155 3300005536 Ga0070697_100004116 Ga0070697_1000041166 296
156 3300005545 Ga0070695_100056782 Ga0070695_1000567821 296
157 3300005546 Ga0070696_100003145 Ga0070696_1000031456 296
158 3300006914 Ga0075436_100018581 Ga0075436_1000185814 296
159 3300013308 Ga0157375_10573278 Ga0157375_105732782 296
160 3300027395 Ga0209996_1011813 Ga0209996_10118131 296
161 3300049578 Ga0501042_0328063 Ga0501042_0328063_160_1050 296
162 3300050514 nmdc:mga08x19_23420_c1 nmdc:mga08x19_23420_c1_1708_2604 296
163 3300050514 nmdc:mga08x19_6130_c1 nmdc:mga08x19_6130_c1_3293_4183 296
164 3300005444 Ga0070694_100062976 Ga0070694_1000629762 297
165 3300045051 Ga0451576_0063476 Ga0451576_0063476_169_1062 297
166 3300005290 Ga0065712_10112361 Ga0065712_101123612 298
167 3300005364 Ga0070673_100203434 Ga0070673_1002034342 298
168 3300006847 Ga0075431_100005545 Ga0075431_1000055456 298
169 3300006847 Ga0075431_100610129 Ga0075431_1006101291 298
170 3300006880 Ga0075429_100084949 Ga0075429_1000849492 298
171 3300009094 Ga0111539_10114889 Ga0111539_101148892 298
172 3300009094 Ga0111539_10206496 Ga0111539_102064962 298
173 3300009094 Ga0111539_10574232 Ga0111539_105742321 298
174 3300027360 Ga0209969_1000257 Ga0209969_10002572 298
175 3300027471 Ga0209995_1009346 Ga0209995_10093462 298
176 3300027682 Ga0209971_1006911 Ga0209971_10069112 298
177 3300027876 Ga0209974_10006565 Ga0209974_100065655 298
178 3300027907 Ga0207428_10300676 Ga0207428_103006761 298
179 3300028380 Ga0268265_10081790 Ga0268265_100817905 298
180 3300031548 Ga0307408_100210641 Ga0307408_1002106412 298
181 3300031731 Ga0307405_10183956 Ga0307405_101839562 298
182 3300032005 Ga0307411_10102916 Ga0307411_101029162 298
183 3300035113 Ga0373936_0144638 Ga0373936_0144638_81_977 298
184 3300045051 Ga0451576_0469638 Ga0451576_0469638_252_1151 298
185 3300046454 Ga0495592_0218138 Ga0495592_0218138_154_1050 298
186 3300046459 Ga0495629_0055613 Ga0495629_0055613_1809_2705 298
187 3300046476 Ga0495662_0022332 Ga0495662_0022332_1446_2342 298
188 3300046514 Ga0495618_0122579 Ga0495618_0122579_488_1384 298
189 3300046516 Ga0495628_0066781 Ga0495628_0066781_532_1428 298
190 3300046517 Ga0495630_0026993 Ga0495630_0026993_481_1377 298
191 3300048910 Ga0496107_0098053 Ga0496107_0098053_317_1219 298
192 3300048913 Ga0496110_0478313 Ga0496110_0478313_178_1080 298
193 3300049515 Ga0501292_011490 Ga0501292_011490_230_1129 298
194 3300049570 Ga0501033_0084106 Ga0501033_0084106_1321_2217 298
195 3300049571 Ga0501034_0016205 Ga0501034_0016205_1731_2627 298
196 3300049572 Ga0501036_0236955 Ga0501036_0236955_104_1006 298
197 3300049823 Ga0501044_0000255 Ga0501044_0000255_42531_43427 298
198 3300050508 nmdc:mga09592_19475_c1 nmdc:mga09592_19475_c1_3893_4795 298
199 3300050510 nmdc:mga06r32_97914_c1 nmdc:mga06r32_97914_c1_1697_2599 298
200 3300050511 nmdc:mga08y16_48515_c1 nmdc:mga08y16_48515_c1_2712_3608 298
201 3300050511 nmdc:mga08y16_545705_c1 nmdc:mga08y16_545705_c1_229_1125 298
202 3300050511 nmdc:mga08y16_68383_c1 nmdc:mga08y16_68383_c1_28_930 298
203 3300005328 Ga0070676_10054557 Ga0070676_100545573 299
204 3300005333 Ga0070677_10070892 Ga0070677_100708922 299
205 3300005336 Ga0070680_100209513 Ga0070680_1002095132 299
206 3300005340 Ga0070689_100227338 Ga0070689_1002273383 299
207 3300005354 Ga0070675_100020836 Ga0070675_1000208365 299
208 3300005444 Ga0070694_100005795 Ga0070694_1000057956 299
209 3300005456 Ga0070678_100284528 Ga0070678_1002845282 299
210 3300005458 Ga0070681_10050204 Ga0070681_100502042 299
211 3300005546 Ga0070696_100136829 Ga0070696_1001368292 299
212 3300005577 Ga0068857_100249863 Ga0068857_1002498632 299
213 3300005840 Ga0068870_10065883 Ga0068870_100658832 299
214 3300005844 Ga0068862_100044129 Ga0068862_1000441294 299
215 3300009094 Ga0111539_10591072 Ga0111539_105910722 299
216 3300011119 Ga0105246_10538435 Ga0105246_105384351 299
217 3300025893 Ga0207682_10031294 Ga0207682_100312942 299
218 3300025907 Ga0207645_10098736 Ga0207645_100987363 299
219 3300025908 Ga0207643_10010297 Ga0207643_100102975 299
220 3300025926 Ga0207659_10040969 Ga0207659_100409692 299
221 3300025936 Ga0207670_10073521 Ga0207670_100735215 299
222 3300025942 Ga0207689_10047407 Ga0207689_100474076 299
223 3300025960 Ga0207651_10260283 Ga0207651_102602832 299
224 3300026121 Ga0207683_10072035 Ga0207683_100720354 299
225 3300031548 Ga0307408_100210475 Ga0307408_1002104752 299
226 3300032005 Ga0307411_10401099 Ga0307411_104010991 299
227 3300049741 Ga0501079_0236362 Ga0501079_0236362_403_1302 299
228 3300005330 Ga0070690_100015303 Ga0070690_1000153033 300
229 3300005336 Ga0070680_100055213 Ga0070680_1000552133 300
230 3300005343 Ga0070687_100127964 Ga0070687_1001279641 300
231 3300005347 Ga0070668_100071747 Ga0070668_1000717474 300
232 3300005353 Ga0070669_100014122 Ga0070669_1000141224 300
233 3300005353 Ga0070669_100148772 Ga0070669_1001487722 300
234 3300005356 Ga0070674_100034607 Ga0070674_1000346073 300
235 3300005365 Ga0070688_100075935 Ga0070688_1000759352 300
236 3300005441 Ga0070700_100283158 Ga0070700_1002831582 300
237 3300005445 Ga0070708_100085748 Ga0070708_1000857481 300
238 3300005458 Ga0070681_10007341 Ga0070681_1000734111 300
239 3300005459 Ga0068867_100252721 Ga0068867_1002527212 300
240 3300005468 Ga0070707_100030431 Ga0070707_1000304312 300
241 3300005536 Ga0070697_100179151 Ga0070697_1001791512 300
242 3300005545 Ga0070695_100020688 Ga0070695_1000206882 300
243 3300005546 Ga0070696_100256437 Ga0070696_1002564372 300
244 3300005547 Ga0070693_100189004 Ga0070693_1001890042 300
245 3300005548 Ga0070665_100491272 Ga0070665_1004912721 300
246 3300005616 Ga0068852_100244240 Ga0068852_1002442402 300
247 3300005719 Ga0068861_100012712 Ga0068861_1000127124 300
248 3300005840 Ga0068870_10213603 Ga0068870_102136031 300
249 3300005841 Ga0068863_100078710 Ga0068863_1000787101 300
250 3300005842 Ga0068858_100382101 Ga0068858_1003821012 300
251 3300005843 Ga0068860_100059911 Ga0068860_1000599113 300
252 3300006844 Ga0075428_100223785 Ga0075428_1002237852 300
253 3300006844 Ga0075428_100243616 Ga0075428_1002436162 300
254 3300006844 Ga0075428_100272128 Ga0075428_1002721283 300
255 3300006846 Ga0075430_100002769 Ga0075430_10000276914 300
256 3300006847 Ga0075431_100021784 Ga0075431_1000217842 300
257 3300006847 Ga0075431_100133137 Ga0075431_1001331372 300
258 3300006871 Ga0075434_100157400 Ga0075434_1001574002 300
259 3300006881 Ga0068865_100014208 Ga0068865_1000142086 300
260 3300006914 Ga0075436_100092661 Ga0075436_1000926612 300
261 3300009094 Ga0111539_10304019 Ga0111539_103040192 300
262 3300009147 Ga0114129_10117651 Ga0114129_101176512 300
263 3300009148 Ga0105243_10009731 Ga0105243_100097313 300
264 3300009553 Ga0105249_10262794 Ga0105249_102627941 300
265 3300011119 Ga0105246_10076027 Ga0105246_100760272 300
266 3300014326 Ga0157380_10156053 Ga0157380_101560532 300
267 3300014969 Ga0157376_10396030 Ga0157376_103960302 300
268 3300025315 Ga0207697_10004195 Ga0207697_100041957 300
269 3300025893 Ga0207682_10003415 Ga0207682_100034154 300
270 3300025899 Ga0207642_10080219 Ga0207642_100802192 300
271 3300025903 Ga0207680_10140942 Ga0207680_101409421 300
272 3300025907 Ga0207645_10006949 Ga0207645_100069496 300
273 3300025910 Ga0207684_10092168 Ga0207684_100921682 300
274 3300025912 Ga0207707_10167462 Ga0207707_101674621 300
275 3300025917 Ga0207660_10029306 Ga0207660_100293063 300
276 3300025917 Ga0207660_10130001 Ga0207660_101300012 300
277 3300025923 Ga0207681_10002576 Ga0207681_1000257610 300
278 3300025938 Ga0207704_10201817 Ga0207704_102018171 300
279 3300025940 Ga0207691_10144747 Ga0207691_101447472 300
280 3300025942 Ga0207689_10004523 Ga0207689_100045235 300
281 3300026075 Ga0207708_10012792 Ga0207708_100127926 300
282 3300026075 Ga0207708_10355592 Ga0207708_103555922 300
283 3300026089 Ga0207648_10008599 Ga0207648_100085992 300
284 3300026089 Ga0207648_10024176 Ga0207648_100241764 300
285 3300026118 Ga0207675_100018330 Ga0207675_1000183307 300
286 3300026118 Ga0207675_100025078 Ga0207675_1000250785 300
287 3300026121 Ga0207683_10202488 Ga0207683_102024882 300
288 3300027471 Ga0209995_1010382 Ga0209995_10103822 300
289 3300028380 Ga0268265_10001655 Ga0268265_100016553 300
290 3300031711 Ga0265314_10085483 Ga0265314_100854831 300
291 3300042876 Ga0451577_0057302 Ga0451577_0057302_1055_1960 300
292 3300046537 Ga0495598_0067107 Ga0495598_0067107_127_1035 300
293 3300046684 Ga0495669_0032906 Ga0495669_0032906_255_1163 300
294 3300050507 nmdc:mga05p37_117796_c1 nmdc:mga05p37_117796_c1_2000_2902 300
295 3300050508 nmdc:mga09592_251016_c1 nmdc:mga09592_251016_c1_97_1002 300
296 3300050509 nmdc:mga0qj67_36587_c1 nmdc:mga0qj67_36587_c1_511_1416 300
297 3300050511 nmdc:mga08y16_76545_c1 nmdc:mga08y16_76545_c1_2347_3252 300
298 3300050512 nmdc:mga0n895_129562_c1 nmdc:mga0n895_129562_c1_1136_2044 300
299 3300053161 Ga0500634_0055328 Ga0500634_0055328_77_982 300
300 3300005290 Ga0065712_10171761 Ga0065712_101717611 301
301 3300005329 Ga0070683_100259914 Ga0070683_1002599141 301
302 3300005330 Ga0070690_100106878 Ga0070690_1001068782 301
303 3300005333 Ga0070677_10033068 Ga0070677_100330682 301
304 3300005335 Ga0070666_10019897 Ga0070666_100198974 301
305 3300005338 Ga0068868_100103275 Ga0068868_1001032752 301
306 3300005338 Ga0068868_100192749 Ga0068868_1001927492 301
307 3300005344 Ga0070661_100249383 Ga0070661_1002493831 301
308 3300005355 Ga0070671_100012340 Ga0070671_1000123403 301
309 3300005367 Ga0070667_100321398 Ga0070667_1003213982 301
310 3300005445 Ga0070708_100139193 Ga0070708_1001391932 301
311 3300005456 Ga0070678_100204434 Ga0070678_1002044342 301
312 3300005458 Ga0070681_10017899 Ga0070681_100178995 301
313 3300005468 Ga0070707_100032470 Ga0070707_1000324703 301
314 3300005530 Ga0070679_100045732 Ga0070679_1000457324 301
315 3300005535 Ga0070684_100088585 Ga0070684_1000885853 301
316 3300005539 Ga0068853_100301215 Ga0068853_1003012152 301
317 3300005545 Ga0070695_100041853 Ga0070695_1000418532 301
318 3300005546 Ga0070696_100003505 Ga0070696_1000035055 301
319 3300005564 Ga0070664_100081490 Ga0070664_1000814903 301
320 3300005578 Ga0068854_100001523 Ga0068854_1000015233 301
321 3300005615 Ga0070702_100128441 Ga0070702_1001284412 301
322 3300005615 Ga0070702_100245956 Ga0070702_1002459561 301
323 3300005616 Ga0068852_100034260 Ga0068852_1000342602 301
324 3300006237 Ga0097621_100055613 Ga0097621_1000556132 301
325 3300006237 Ga0097621_100171278 Ga0097621_1001712782 301
326 3300006358 Ga0068871_100006079 Ga0068871_1000060799 301
327 3300007076 Ga0075435_100387349 Ga0075435_1003873492 301
328 3300013296 Ga0157374_10205469 Ga0157374_102054692 301
329 3300013297 Ga0157378_10003345 Ga0157378_100033459 301
330 3300013306 Ga0163162_10058122 Ga0163162_100581222 301
331 3300013308 Ga0157375_10029222 Ga0157375_100292225 301
332 3300014325 Ga0163163_10543395 Ga0163163_105433951 301
333 3300014745 Ga0157377_10062209 Ga0157377_100622092 301
334 3300014969 Ga0157376_10023911 Ga0157376_100239112 301
335 3300014969 Ga0157376_10608592 Ga0157376_106085922 301
336 3300025893 Ga0207682_10005427 Ga0207682_100054273 301
337 3300025901 Ga0207688_10008300 Ga0207688_100083002 301
338 3300025903 Ga0207680_10009205 Ga0207680_100092054 301
339 3300025908 Ga0207643_10028804 Ga0207643_100288042 301
340 3300025910 Ga0207684_10031595 Ga0207684_100315952 301
341 3300025912 Ga0207707_10055304 Ga0207707_100553043 301
342 3300025922 Ga0207646_10297725 Ga0207646_102977252 301
343 3300025925 Ga0207650_10017951 Ga0207650_100179512 301
344 3300025931 Ga0207644_10000583 Ga0207644_100005832 301
345 3300025940 Ga0207691_10000948 Ga0207691_100009485 301
346 3300025941 Ga0207711_10105660 Ga0207711_101056602 301
347 3300025944 Ga0207661_10283418 Ga0207661_102834181 301
348 3300025960 Ga0207651_10073229 Ga0207651_100732292 301
349 3300026041 Ga0207639_10172612 Ga0207639_101726122 301
350 3300026075 Ga0207708_10011989 Ga0207708_100119895 301
351 3300026116 Ga0207674_10038517 Ga0207674_100385174 301
352 3300026121 Ga0207683_10000313 Ga0207683_100003132 301
353 3300026121 Ga0207683_10355560 Ga0207683_103555602 301
354 3300026142 Ga0207698_10007556 Ga0207698_100075564 301
355 3300031548 Ga0307408_100024448 Ga0307408_1000244482 301
356 3300032002 Ga0307416_100042677 Ga0307416_1000426772 301
357 3300046528 Ga0495642_0007460 Ga0495642_0007460_1949_2860 301
358 3300048089 Ga0495614_0112752 Ga0495614_0112752_162_1067 301
359 3300048907 Ga0496104_0199888 Ga0496104_0199888_108_1019 301
360 3300048913 Ga0496110_0130873 Ga0496110_0130873_422_1333 301
361 3300048918 Ga0496115_0367035 Ga0496115_0367035_21_932 301
362 3300049568 Ga0501031_0099438 Ga0501031_0099438_373_1278 301
363 3300049569 Ga0501032_0046821 Ga0501032_0046821_420_1325 301
364 3300049570 Ga0501033_0004209 Ga0501033_0004209_9822_10727 301
365 3300049572 Ga0501036_0002503 Ga0501036_0002503_939_1844 301
366 3300049572 Ga0501036_0091684 Ga0501036_0091684_983_1891 301
367 3300049573 Ga0501037_0085020 Ga0501037_0085020_667_1572 301
368 3300049574 Ga0501038_0006655 Ga0501038_0006655_9281_10186 301
369 3300049575 Ga0501039_0005669 Ga0501039_0005669_7844_8749 301
370 3300049575 Ga0501039_0057373 Ga0501039_0057373_661_1569 301
371 3300049576 Ga0501040_0001508 Ga0501040_0001508_535_1440 301
372 3300049577 Ga0501041_0000398 Ga0501041_0000398_12244_13149 301
373 3300049578 Ga0501042_0001320 Ga0501042_0001320_12697_13602 301
374 3300049578 Ga0501042_0070336 Ga0501042_0070336_861_1772 301
375 3300049579 Ga0501043_0006920 Ga0501043_0006920_5419_6324 301
376 3300049579 Ga0501043_0291833 Ga0501043_0291833_113_1024 301
377 3300049580 Ga0501046_0000393 Ga0501046_0000393_38845_39750 301
378 3300049580 Ga0501046_0033459 Ga0501046_0033459_940_1851 301
379 3300049582 Ga0501048_0000181 Ga0501048_0000181_11813_12718 301
380 3300049582 Ga0501048_0094801 Ga0501048_0094801_814_1725 301
381 3300049584 Ga0501068_0003002 Ga0501068_0003002_659_1564 301
382 3300049588 Ga0501072_0001849 Ga0501072_0001849_13374_14279 301
383 3300049588 Ga0501072_0009997 Ga0501072_0009997_4877_5785 301
384 3300049588 Ga0501072_0216442 Ga0501072_0216442_366_1277 301
385 3300049589 Ga0501073_0188266 Ga0501073_0188266_379_1290 301
386 3300049590 Ga0501074_0033418 Ga0501074_0033418_1023_1928 301
387 3300049591 Ga0501075_0000242 Ga0501075_0000242_22257_23162 301
388 3300049591 Ga0501075_0004582 Ga0501075_0004582_5839_6750 301
389 3300049592 Ga0501076_0001073 Ga0501076_0001073_12649_13554 301
390 3300049592 Ga0501076_0165838 Ga0501076_0165838_831_1739 301
391 3300049593 Ga0501077_0002349 Ga0501077_0002349_1650_2555 301
392 3300049593 Ga0501077_0072244 Ga0501077_0072244_453_1364 301
393 3300049593 Ga0501077_0121031 Ga0501077_0121031_613_1521 301
394 3300049741 Ga0501079_0002630 Ga0501079_0002630_11594_12499 301
395 3300049741 Ga0501079_0017772 Ga0501079_0017772_3220_4131 301
396 3300049742 Ga0501080_0002206 Ga0501080_0002206_7315_8220 301
397 3300049742 Ga0501080_0046509 Ga0501080_0046509_577_1488 301
398 3300049743 Ga0501081_0000938 Ga0501081_0000938_12303_13208 301
399 3300049743 Ga0501081_0004554 Ga0501081_0004554_2352_3263 301
400 3300049743 Ga0501081_0081512 Ga0501081_0081512_602_1510 301
401 3300049822 Ga0501035_0003028 Ga0501035_0003028_7440_8345 301
402 3300049822 Ga0501035_0025821 Ga0501035_0025821_3760_4671 301
403 3300049823 Ga0501044_0073394 Ga0501044_0073394_975_1880 301
404 3300049824 Ga0501045_0010531 Ga0501045_0010531_5368_6276 301
405 3300049824 Ga0501045_0030952 Ga0501045_0030952_1372_2283 301
406 3300049824 Ga0501045_0069481 Ga0501045_0069481_1474_2379 301
407 3300050511 nmdc:mga08y16_16853_c1 nmdc:mga08y16_16853_c1_3426_4337 301
408 3300050512 nmdc:mga0n895_169620_c1 nmdc:mga0n895_169620_c1_275_1186 301
409 3300050514 nmdc:mga08x19_225242_c1 nmdc:mga08x19_225242_c1_88_993 301
410 3300054114 Ga0501084_0002815 Ga0501084_0002815_5166_6071 301
411 3300060353 Ga0501082_0000358 Ga0501082_0000358_27969_28874 301
412 3300060353 Ga0501082_0012656 Ga0501082_0012656_3818_4726 301
413 3300061734 Ga0530510_0002277 Ga0530510_0002277_10180_11085 301
414 3300061734 Ga0530510_0091644 Ga0530510_0091644_1096_2007 301
415 3300005329 Ga0070683_100042288 Ga0070683_1000422885 302
416 3300005330 Ga0070690_100024340 Ga0070690_1000243403 302
417 3300005334 Ga0068869_100110789 Ga0068869_1001107892 302
418 3300005435 Ga0070714_100592491 Ga0070714_1005924911 302
419 3300005444 Ga0070694_100015352 Ga0070694_1000153521 302
420 3300005444 Ga0070694_100027884 Ga0070694_1000278842 302
421 3300005467 Ga0070706_100094706 Ga0070706_1000947063 302
422 3300005518 Ga0070699_100065005 Ga0070699_1000650051 302
423 3300005536 Ga0070697_100004116 Ga0070697_1000041169 302
424 3300005545 Ga0070695_100158500 Ga0070695_1001585002 302
425 3300005546 Ga0070696_100003145 Ga0070696_1000031459 302
426 3300006048 Ga0075363_100069621 Ga0075363_1000696212 302
427 3300006051 Ga0075364_10110589 Ga0075364_101105892 302
428 3300006177 Ga0075362_10018242 Ga0075362_100182423 302
429 3300006237 Ga0097621_100006938 Ga0097621_1000069386 302
430 3300006353 Ga0075370_10050366 Ga0075370_100503662 302
431 3300006358 Ga0068871_100003199 Ga0068871_10000319912 302
432 3300006914 Ga0075436_100029416 Ga0075436_1000294162 302
433 3300006914 Ga0075436_100083728 Ga0075436_1000837282 302
434 3300007265 Ga0099794_10013995 Ga0099794_100139952 302
435 3300009094 Ga0111539_10012682 Ga0111539_100126826 302
436 3300025910 Ga0207684_10256637 Ga0207684_102566372 302
437 3300025929 Ga0207664_10481737 Ga0207664_104817372 302
438 3300025933 Ga0207706_10035583 Ga0207706_100355834 302
439 3300026075 Ga0207708_10098180 Ga0207708_100981803 302
440 3300026095 Ga0207676_10332815 Ga0207676_103328152 302
441 3300027543 Ga0209999_1024424 Ga0209999_10244241 302
442 3300027671 Ga0209588_1054579 Ga0209588_10545791 302
443 3300028794 Ga0307515_10197509 Ga0307515_101975091 302
444 3300030521 Ga0307511_10000708 Ga0307511_1000070825 302
445 3300031548 Ga0307408_100005606 Ga0307408_1000056062 302
446 3300031731 Ga0307405_10014840 Ga0307405_100148404 302
447 3300031824 Ga0307413_10168746 Ga0307413_101687462 302
448 3300031852 Ga0307410_10002526 Ga0307410_100025267 302
449 3300031852 Ga0307410_10016677 Ga0307410_100166774 302
450 3300031852 Ga0307410_10084494 Ga0307410_100844942 302
451 3300031901 Ga0307406_10001695 Ga0307406_100016954 302
452 3300031903 Ga0307407_10006223 Ga0307407_100062233 302
453 3300031911 Ga0307412_10093104 Ga0307412_100931042 302
454 3300031995 Ga0307409_100047017 Ga0307409_1000470173 302
455 3300032002 Ga0307416_100003872 Ga0307416_1000038722 302
456 3300032002 Ga0307416_100099492 Ga0307416_1000994922 302
457 3300034816 Ga0373930_0033458 Ga0373930_0033458_75_992 302
458 3300035083 Ga0373926_0001197 Ga0373926_0001197_3902_4813 302
459 3300035084 Ga0373928_0019485 Ga0373928_0019485_28_939 302
460 3300035092 Ga0373952_0025807 Ga0373952_0025807_237_1145 302
461 3300035116 Ga0373945_0002628 Ga0373945_0002628_4657_5568 302
462 3300035171 Ga0373946_0001086 Ga0373946_0001086_7908_8819 302
463 3300035692 Ga0373935_0070343 Ga0373935_0070343_414_1325 302
464 3300035695 Ga0373927_0030989 Ga0373927_0030989_2543_3454 302
465 3300037068 Ga0373925_0021528 Ga0373925_0021528_1336_2247 302
466 3300046455 Ga0495603_0015377 Ga0495603_0015377_696_1607 302
467 3300046472 Ga0495580_0008572 Ga0495580_0008572_6917_7828 302
468 3300046473 Ga0495582_0021379 Ga0495582_0021379_2100_3011 302
469 3300046499 Ga0495594_0066301 Ga0495594_0066301_599_1510 302
470 3300046526 Ga0495666_0011053 Ga0495666_0011053_3572_4483 302
471 3300046531 Ga0495665_0015964 Ga0495665_0015964_3110_4021 302
472 3300046674 Ga0495588_0006001 Ga0495588_0006001_4096_5007 302
473 3300046683 Ga0495658_0005601 Ga0495658_0005601_1351_2262 302
474 3300047315 Ga0495581_0101163 Ga0495581_0101163_336_1247 302
475 3300047321 Ga0495676_0016910 Ga0495676_0016910_1787_2698 302
476 3300049583 Ga0501067_0030352 Ga0501067_0030352_1789_2697 302
477 3300049585 Ga0501069_0029677 Ga0501069_0029677_441_1352 302
478 3300050493 nmdc:mga0k408_88057_c1 nmdc:mga0k408_88057_c1_140_1048 302
479 3300050495 nmdc:mga04h51_6567_c1 nmdc:mga04h51_6567_c1_1733_2641 302
480 3300050496 nmdc:mga07m45_74350_c1 nmdc:mga07m45_74350_c1_78_986 302
481 3300050512 nmdc:mga0n895_3919_c1 nmdc:mga0n895_3919_c1_11161_12069 302
482 3300050514 nmdc:mga08x19_6130_c1 nmdc:mga08x19_6130_c1_6103_7014 302
483 3300050516 nmdc:mga0sz30_5279_c1 nmdc:mga0sz30_5279_c1_3355_4263 302
484 3300050516 nmdc:mga0sz30_56176_c1 nmdc:mga0sz30_56176_c1_208_1116 302
485 3300053092 Ga0500583_0021436 Ga0500583_0021436_586_1494 302
486 3300053098 Ga0500650_0037707 Ga0500650_0037707_665_1573 302
487 3300053139 Ga0500568_0102426 Ga0500568_0102426_135_1043 302
488 3300053151 Ga0500604_0002914 Ga0500604_0002914_2291_3199 302
489 3300005330 Ga0070690_100000569 Ga0070690_1000005692 303
490 3300005334 Ga0068869_100000727 Ga0068869_1000007277 303
491 3300005336 Ga0070680_100001166 Ga0070680_1000011667 303
492 3300005337 Ga0070682_100026721 Ga0070682_1000267212 303
493 3300005338 Ga0068868_100000716 Ga0068868_10000071619 303
494 3300005340 Ga0070689_100000798 Ga0070689_1000007982 303
495 3300005341 Ga0070691_10000223 Ga0070691_100002232 303
496 3300005343 Ga0070687_100003027 Ga0070687_1000030276 303
497 3300005345 Ga0070692_10003091 Ga0070692_100030916 303
498 3300005353 Ga0070669_100178419 Ga0070669_1001784192 303
499 3300005355 Ga0070671_100337533 Ga0070671_1003375332 303
500 3300005365 Ga0070688_100124647 Ga0070688_1001246472 303
501 3300005406 Ga0070703_10008430 Ga0070703_100084302 303
502 3300005438 Ga0070701_10002181 Ga0070701_100021817 303
503 3300005440 Ga0070705_100000565 Ga0070705_10000056516 303
504 3300005441 Ga0070700_100000265 Ga0070700_10000026510 303
505 3300005444 Ga0070694_100000584 Ga0070694_10000058416 303
506 3300005459 Ga0068867_100006495 Ga0068867_1000064952 303
507 3300005530 Ga0070679_100004913 Ga0070679_1000049137 303
508 3300005536 Ga0070697_100138959 Ga0070697_1001389591 303
509 3300005544 Ga0070686_100002546 Ga0070686_1000025463 303
510 3300005545 Ga0070695_100004011 Ga0070695_1000040112 303
511 3300005546 Ga0070696_100000689 Ga0070696_1000006897 303
512 3300005547 Ga0070693_100000145 Ga0070693_10000014516 303
513 3300005549 Ga0070704_100003704 Ga0070704_1000037042 303
514 3300005563 Ga0068855_100012503 Ga0068855_1000125032 303
515 3300005578 Ga0068854_100007979 Ga0068854_1000079797 303
516 3300005614 Ga0068856_100026262 Ga0068856_1000262622 303
517 3300005615 Ga0070702_100000200 Ga0070702_10000020017 303
518 3300005617 Ga0068859_100008918 Ga0068859_1000089184 303
519 3300005718 Ga0068866_10000312 Ga0068866_1000031213 303
520 3300005719 Ga0068861_100003520 Ga0068861_1000035209 303
521 3300005841 Ga0068863_100241642 Ga0068863_1002416422 303
522 3300005842 Ga0068858_100022350 Ga0068858_1000223503 303
523 3300005843 Ga0068860_100011647 Ga0068860_1000116477 303
524 3300005844 Ga0068862_100149671 Ga0068862_1001496712 303
525 3300006237 Ga0097621_100001046 Ga0097621_10000104617 303
526 3300006358 Ga0068871_100000265 Ga0068871_10000026517 303
527 3300006852 Ga0075433_10000585 Ga0075433_100005857 303
528 3300006871 Ga0075434_100000221 Ga0075434_10000022116 303
529 3300006880 Ga0075429_100001446 Ga0075429_1000014462 303
530 3300006880 Ga0075429_100160624 Ga0075429_1001606242 303
531 3300006881 Ga0068865_100000608 Ga0068865_1000006082 303
532 3300006914 Ga0075436_100001062 Ga0075436_1000010622 303
533 3300006931 Ga0097620_100008919 Ga0097620_1000089194 303
534 3300007076 Ga0075435_100001563 Ga0075435_1000015633 303
535 3300009094 Ga0111539_10406765 Ga0111539_104067652 303
536 3300009098 Ga0105245_10007488 Ga0105245_100074887 303
537 3300009147 Ga0114129_10014716 Ga0114129_100147169 303
538 3300009148 Ga0105243_10004754 Ga0105243_100047549 303
539 3300009174 Ga0105241_10015458 Ga0105241_100154582 303
540 3300009176 Ga0105242_10000646 Ga0105242_1000064617 303
541 3300009553 Ga0105249_10011456 Ga0105249_100114562 303
542 3300013297 Ga0157378_10002299 Ga0157378_1000229911 303
543 3300013308 Ga0157375_10075450 Ga0157375_100754502 303
544 3300014326 Ga0157380_10077505 Ga0157380_100775052 303
545 3300014969 Ga0157376_10003492 Ga0157376_100034922 303
546 3300025885 Ga0207653_10016885 Ga0207653_100168852 303
547 3300025899 Ga0207642_10000981 Ga0207642_100009819 303
548 3300025911 Ga0207654_10021198 Ga0207654_100211982 303
549 3300025917 Ga0207660_10001221 Ga0207660_1000122116 303
550 3300025918 Ga0207662_10002183 Ga0207662_100021832 303
551 3300025926 Ga0207659_10038266 Ga0207659_100382662 303
552 3300025927 Ga0207687_10003360 Ga0207687_100033601 303
553 3300025931 Ga0207644_10272606 Ga0207644_102726062 303
554 3300025934 Ga0207686_10001709 Ga0207686_100017092 303
555 3300025935 Ga0207709_10002039 Ga0207709_100020392 303
556 3300025936 Ga0207670_10005788 Ga0207670_100057886 303
557 3300025936 Ga0207670_10026604 Ga0207670_100266042 303
558 3300025938 Ga0207704_10000577 Ga0207704_100005777 303
559 3300025942 Ga0207689_10001695 Ga0207689_1000169516 303
560 3300025942 Ga0207689_10018441 Ga0207689_100184412 303
561 3300025949 Ga0207667_10016185 Ga0207667_100161852 303
562 3300025961 Ga0207712_10026104 Ga0207712_100261042 303
563 3300025981 Ga0207640_10007759 Ga0207640_100077592 303
564 3300026023 Ga0207677_10002281 Ga0207677_100022816 303
565 3300026023 Ga0207677_10328826 Ga0207677_103288262 303
566 3300026035 Ga0207703_10006142 Ga0207703_100061425 303
567 3300026041 Ga0207639_10133954 Ga0207639_101339542 303
568 3300026075 Ga0207708_10000723 Ga0207708_1000072324 303
569 3300026078 Ga0207702_10040706 Ga0207702_100407062 303
570 3300026088 Ga0207641_10210469 Ga0207641_102104692 303
571 3300026089 Ga0207648_10001968 Ga0207648_1000196817 303
572 3300026118 Ga0207675_100002725 Ga0207675_10000272511 303
573 3300026118 Ga0207675_100491091 Ga0207675_1004910912 303
574 3300026142 Ga0207698_10307396 Ga0207698_103073962 303
575 3300027907 Ga0207428_10002376 Ga0207428_1000237617 303
576 3300028380 Ga0268265_10003024 Ga0268265_100030249 303
577 3300028380 Ga0268265_10179199 Ga0268265_101791992 303
578 3300028381 Ga0268264_10006262 Ga0268264_100062624 303
579 3300034818 Ga0373950_0030012 Ga0373950_0030012_46_960 303
580 3300035092 Ga0373952_0028312 Ga0373952_0028312_270_1184 303
581 3300035691 Ga0373931_0039864 Ga0373931_0039864_1323_2237 303
582 3300042876 Ga0451577_0008898 Ga0451577_0008898_4312_5226 303
583 3300045051 Ga0451576_0026374 Ga0451576_0026374_4642_5556 303
584 3300048909 Ga0496106_0170045 Ga0496106_0170045_275_1189 303
585 3300049582 Ga0501048_0094342 Ga0501048_0094342_851_1762 303
586 3300049824 Ga0501045_0263879 Ga0501045_0263879_253_1164 303
587 3300050507 nmdc:mga05p37_24008_c1 nmdc:mga05p37_24008_c1_4386_5300 303
588 3300050508 nmdc:mga09592_2982_c1 nmdc:mga09592_2982_c1_9024_9938 303
589 3300050511 nmdc:mga08y16_82303_c1 nmdc:mga08y16_82303_c1_1122_2036 303
590 3300050512 nmdc:mga0n895_9771_c1 nmdc:mga0n895_9771_c1_6768_7682 303
591 3300050513 nmdc:mga0rr50_681_c1 nmdc:mga0rr50_681_c1_2133_3047 303
592 3300050515 nmdc:mga0a205_106_c1 nmdc:mga0a205_106_c1_16158_17072 303
593 3300054114 Ga0501084_0087785 Ga0501084_0087785_229_1140 303
594 3300042876 Ga0451577_0311875 Ga0451577_0311875_418_1344 304
595 3300045051 Ga0451576_0149596 Ga0451576_0149596_556_1470 304
596 3300053153 Ga0500616_0052178 Ga0500616_0052178_738_1652 304
597 3300003203 JGI25406J46586_10027380 JGI25406J46586_100273802 305
598 3300005985 Ga0081539_10004639 Ga0081539_1000463910 305
599 3300044706 Ga0466964_0080392 Ga0466964_0080392_242_1171 305
600 3300045976 Ga0466967_0008630 Ga0466967_0008630_4863_5792 305
601 3300046684 Ga0495669_0051626 Ga0495669_0051626_691_1611 305

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cl6-assembly1.cif.gz_A crystal structure of puue allantoinase 0.8615 25 296
1z7a-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8535 25 296
3s6o-assembly1.cif.gz_D crystal structure of a polysaccharide deacetylase family protein from burkholderia pseudomallei 0.8319 25 289
3qbu-assembly1.cif.gz_C crystal structure of putative peptidoglycan deactelyase (hp0310) from helicobacter pylori 0.813 29 294
3rxz-assembly1.cif.gz_B crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis 0.8018 23 305
ID Description Score Start End Superfamily
3qbuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.813 29 294 3.20.20.370
af_O13842_2_320_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7995 25 295 3.20.20.370
1z7aC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7982 25 296 3.20.20.370
3rxzD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7962 16 305 3.20.20.370
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7916 33 268 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A2J4Q6J7-F1-model_v4 Polysaccharide deacetylase 0.9595 168 292 GO:0005975
AF-A0A7K0RV96-F1-model_v4 deleted 0.9572 153 290
AF-A0A1F3ZV34-F1-model_v4 NodB homology domain-containing protein 0.9541 69 293 GO:0005975
GO:0016810
AF-A0A2V7FBS8-F1-model_v4 Polysaccharide deacetylase 0.9516 97 294 GO:0005975
AF-A0A536WHK6-F1-model_v4 Polysaccharide deacetylase 0.9457 63 296 GO:0005975
GO:0016810

Feature Viewer

pLDDT pTM Quality
83.69 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map