F468065

General Info

Members Datasets Scaffolds Average Seq Length
601 348 1203 384

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10046067|Ga0207647_100460672
Length 460
Sequence MGAAPQVFWFIPTHGDSRYLGTSEGARQVDHTYLQQVAVAADTLGYEGVLIPTGRSCEDPWIVAASLIPVTKRLRFLVAVRPGLMAPTLAARMAATYDRLSNGRLLVNLVTGGDPAELAGDGLFLDHAQRYEASEEFIRIWRETLAASHEGAALDYTGKHLSVKGAKVLYPPVQRPHPPVYFGGSSEAAHELAAEQVDSYLTWGEPPAAVAEKIADVRKRAAKHGRTVRFGIRLHVIVRETEDEAWQAADKLISKLDDDTVSRAQEAFRKMDSAGQQRMAALHAGGVKRSRADLEISPNLWAGVGLVRGGAGTALVGDPETVAARMKEYADLGIDTFILSGYPHLEEAYRFAEHAPNIETRQIVPSQSRHGHPIPASTILVALCGGDGLTWIDFASSQAKNISHWRALLISFFGRKNQNNKTLGGMHEQSGAEAYAWLLGDSHVHPVKSYRTSAATSREC

Samples

Sample ID Description Type Environment
1 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
79 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
249 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
250 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
256 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
257 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
258 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
259 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
260 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
261 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
262 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
263 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
264 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
265 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
266 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
267 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
268 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
269 2643221570 Acidovorax sp. Root568 Isolate Unclassified
270 2643221585 Pelomonas sp. Root662 Isolate Unclassified
271 2643221596 Acidovorax sp. Root70 Isolate Unclassified
272 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
273 2643221609 Acidovorax sp. Root217 Isolate Unclassified
274 2643221611 Acidovorax sp. Root219 Isolate Unclassified
275 2643221638 Duganella sp. Root336D2 Isolate Unclassified
276 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
277 2643221645 Massilia sp. Root351 Isolate Unclassified
278 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
279 2643221652 Acidovorax sp. Root402 Isolate Unclassified
280 2643221656 Pelomonas sp. Root405 Isolate Unclassified
281 2643221664 Massilia sp. Root418 Isolate Unclassified
282 2721755523 Delftia sp. HK171 Isolate Unclassified
283 2738541280 Massilia sp. GV090 Isolate Unclassified
284 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
285 2738541297 Duganella sp. GV083 Isolate Unclassified
286 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
287 2738541300 Massilia sp. GV016 Isolate Unclassified
288 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
289 2738541337 Pelomonas sp. BT06 Isolate Unclassified
290 2738541357 Duganella sp. GV053 Isolate Unclassified
291 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
292 2738543003 Duganella sp. GV066 Isolate Unclassified
293 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
294 2738543012 Acidovorax sp. CF301 Isolate Unclassified
295 2738543018 Massilia sp. GV045 Isolate Unclassified
296 2738543026 Duganella sp. GV089 Isolate Unclassified
297 2738543029 Duganella sp. GV039 Isolate Unclassified
298 2738543030 Massilia sp. GV097 Isolate Unclassified
299 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
300 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
301 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
302 2816332133 Acidovorax radicis 2721A Isolate Unclassified
303 2818991436 Collimonas arenae 515 Isolate Unclassified
304 2818991450 Burkholderia sp. 604 Isolate Unclassified
305 2821131069 Duganella sp. 1224 Isolate Unclassified
306 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
307 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
308 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
309 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
310 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
311 2842711865 Duganella sp. R-73148 Isolate Unclassified
312 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
313 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
314 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
315 2857553236 Duganella sp. R-74557 Isolate Unclassified
316 2857558681 Duganella sp. R-74565 Isolate Unclassified
317 2857564685 Duganella sp. R-74599 Isolate Unclassified
318 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
319 2885266251 Ralstonia sp. SET104 Isolate Nodule
320 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
321 2904424332 Duganella sp. 1411 Isolate Rhizosphere
322 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
323 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
324 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
325 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
326 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
327 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
328 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
329 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
330 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
331 2919476304 Duganella sp. 3397 Isolate Unclassified
332 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
333 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
334 2928058823 Ralstonia sp. 1138 Isolate Unclassified
335 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
336 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
337 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
338 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
339 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
340 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
341 2941479691
342 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
343 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
344 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
345 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
346 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
347 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
348 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.36
Metatranscriptomes 0.17
Isolates 15.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.97
Nodule 3
Rhizoplane 2.16
Rhizosphere 55.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207647_10046067 3300025904 Bacteria 2718
2 JGI24741J21665_1001141 3300001915 Bacteria 7854
3 JGI24740J21852_10000827 3300001979 Bacteria 13630
4 JGI24739J22299_10003513 3300001989 Bacteria 5983
5 JGI24735J21928_10001072 3300002067 Bacteria 9801
6 JGI25154J39366_1003929 3300002738 Bacteria 2866
7 JGI25158J39367_1000214 3300002739 Bacteria 13670
8 JGI25150J39212_1002915 3300002774 Bacteria 4135
9 JGI25159J45721_1000738 3300002987 Bacteria 14282
10 JGI25151J46595_10002200 3300003187 Bacteria 12063
11 JGI25151J46595_10020027 3300003187 Bacteria 2828
12 JGI25165J46597_1000105 3300003214 Bacteria 152144
13 JGI25153J46596_10027055 3300003215 Bacteria 2017
14 rootH1_10021172 3300003316 Bacteria 5150
15 rootH1_10021172 3300003323 Bacteria 3248
16 rootL2_10028151 3300003322 Bacteria 10187
17 rootL2_10062828 3300003322 Bacteria 18661
18 rootH1_10016206 3300003323 Bacteria 18843
19 JGI25161J50226_1000166 3300003374 Bacteria 45462
20 Ga0006562J51391_1066503 3300003578 Bacteria 2710
21 Ga0055538_1000043 3300003751 Bacteria 152144
22 Ga0055538_1000045 3300003751 Bacteria 139066
23 Ga0055538_1002176 3300003751 Bacteria 3049
24 Ga0055538_1002238 3300003751 Bacteria 2964
25 Ga0055539_1000057 3300003752 Bacteria 152144
26 Ga0055539_1000064 3300003752 Bacteria 139066
27 Ga0055539_1000123 3300003752 Bacteria 83036
28 Ga0055539_1005174 3300003752 Bacteria 1703
29 Ga0055533_1000071 3300003756 Bacteria 152144
30 Ga0055533_1000074 3300003756 Bacteria 139066
31 Ga0055533_1001217 3300003756 Bacteria 7166
32 Ga0055533_1001659 3300003756 Bacteria 5728
33 Ga0055532_1000029 3300003758 Bacteria 232900
34 Ga0055525_1000085 3300003759 Bacteria 152144
35 Ga0055525_1000092 3300003759 Bacteria 139066
36 Ga0055525_1000345 3300003759 Bacteria 33665
37 Ga0055529_1000032 3300003763 Bacteria 255895
38 Ga0055529_1000062 3300003763 Bacteria 183782
39 Ga0055529_1000376 3300003763 Bacteria 48166
40 Ga0055526_1000070 3300003771 Bacteria 96845
41 Ga0055526_1000875 3300003771 Bacteria 22443
42 Ga0055526_1002131 3300003771 Bacteria 13584
43 Ga0055526_1002334 3300003771 Bacteria 12895
44 Ga0055526_1007982 3300003771 Bacteria 5367
45 Ga0055537_1000936 3300003773 Bacteria 13584
46 Ga0055524_1001214 3300003775 Bacteria 15250
47 Ga0055524_1003259 3300003775 Bacteria 7945
48 Ga0055524_1004250 3300003775 Bacteria 6661
49 Ga0055536_1000083 3300003781 Bacteria 81693
50 Ga0055534_1001169 3300003784 Bacteria 11076
51 Ga0055534_1002625 3300003784 Bacteria 6117
52 Ga0055530_10000262 3300003791 Bacteria 47466
53 Ga0055531_10000415 3300003794 Bacteria 40766
54 Ga0055541_1000044 3300003841 Bacteria 152144
55 Ga0055541_1000046 3300003841 Bacteria 139066
56 Ga0055543_1000063 3300004625 Bacteria 98011
57 Ga0065165_1001834 3300005262 Bacteria 20758
58 Ga0070660_100007417 3300005339 Bacteria 7640
59 Ga0070661_100004017 3300005344 Bacteria 10113
60 Ga0070669_100000350 3300005353 Bacteria 35980
61 Ga0070673_100073166 3300005364 Bacteria 2758
62 Ga0070659_100002881 3300005366 Bacteria 12246
63 Ga0070667_100078364 3300005367 Bacteria 2823
64 Ga0070663_100000011 3300005455 Bacteria 146097
65 Ga0070663_100065897 3300005455 Bacteria 2623
66 Ga0068867_100001582 3300005459 Bacteria 15832
67 Ga0068855_100002352 3300005563 Bacteria 23325
68 Ga0068855_100002607 3300005563 Bacteria 22223
69 Ga0070664_100000008 3300005564 Bacteria 173734
70 Ga0068857_100112705 3300005577 Bacteria 2445
71 Ga0068854_100000072 3300005578 Bacteria 72718
72 Ga0068856_100000009 3300005614 Bacteria 181448
73 Ga0068856_100067922 3300005614 Bacteria 3523
74 Ga0068860_100076689 3300005843 Bacteria 3179
75 Ga0075365_10057124 3300006038 Bacteria 2596
76 Ga0075365_10271902 3300006038 Bacteria 1192
77 Ga0075368_10009861 3300006042 Bacteria 3443
78 Ga0070716_100075366 3300006173 Bacteria 1996
79 Ga0075362_10007882 3300006177 Bacteria 4051
80 Ga0075366_10018118 3300006195 Bacteria 4066
81 Ga0075370_10012638 3300006353 Bacteria 4469
82 Ga0079104_1000026 3300006946 Bacteria 216566
83 Ga0099826_10000002 3300006948 Bacteria 1125830
84 Ga0105251_10000134 3300009011 Bacteria 74820
85 Ga0105251_10001448 3300009011 Bacteria 20398
86 Ga0105244_10002391 3300009036 Bacteria 14196
87 Ga0105244_10004250 3300009036 Bacteria 9938
88 Ga0105240_10055439 3300009093 Bacteria 4962
89 Ga0105240_10079339 3300009093 Bacteria 4039
90 Ga0105240_10115119 3300009093 Bacteria 3247
91 Ga0105243_10012895 3300009148 Bacteria 6316
92 Ga0105237_10037899 3300009545 Bacteria 4870
93 Ga0105237_10087424 3300009545 Bacteria 3106
94 Ga0105237_10224283 3300009545 Bacteria 1880
95 Ga0105238_10000318 3300009551 Bacteria 52620
96 Ga0105239_10000493 3300010375 Bacteria 57168
97 Ga0105239_10083795 3300010375 Bacteria 3511
98 Ga0157373_10005361 3300013100 Bacteria 9635
99 Ga0157373_10005801 3300013100 Bacteria 9242
100 Ga0157371_10000068 3300013102 Bacteria 168110
101 Ga0157370_10000200 3300013104 Bacteria 75469
102 Ga0157370_10000300 3300013104 Bacteria 62888
103 Ga0157370_10018183 3300013104 Bacteria 7073
104 Ga0157369_10005953 3300013105 Bacteria 14161
105 Ga0157369_10009262 3300013105 Bacteria 11266
106 Ga0157374_10000230 3300013296 Bacteria 51820
107 Ga0157372_10000304 3300013307 Bacteria 54853
108 Ga0157375_10025421 3300013308 Bacteria 5501
109 Ga0182008_10007115 3300014497 Bacteria 6196
110 Ga0182008_10062672 3300014497 Bacteria 1832
111 Ga0182008_10086137 3300014497 Bacteria 1547
112 Ga0157377_10000014 3300014745 Bacteria 213961
113 Ga0182006_1000035 3300015261 Bacteria 232349
114 Ga0182006_1000040 3300015261 Bacteria 209209
115 Ga0182006_1004807 3300015261 Bacteria 6570
116 Ga0182006_1006450 3300015261 Bacteria 5450
117 Ga0182006_1020266 3300015261 Bacteria 2787
118 Ga0182007_10000189 3300015262 Bacteria 41407
119 Ga0182007_10000453 3300015262 Bacteria 24829
120 Ga0182007_10006298 3300015262 Bacteria 5104
121 Ga0182007_10020700 3300015262 Bacteria 2347
122 Ga0182007_10029125 3300015262 Bacteria 1892
123 Ga0182005_1000025 3300015265 Bacteria 235532
124 Ga0182005_1000066 3300015265 Bacteria 89024
125 Ga0182005_1001576 3300015265 Bacteria 9008
126 Ga0163161_10017321 3300017792 Bacteria 5041
127 Ga0213872_10000072 3300021361 Bacteria 91345
128 Ga0213872_10000313 3300021361 Bacteria 41306
129 Ga0213872_10002057 3300021361 Bacteria 12206
130 Ga0213872_10002394 3300021361 Bacteria 11079
131 Ga0213872_10004921 3300021361 Bacteria 6949
132 Ga0213872_10008680 3300021361 Bacteria 4908
133 Ga0213872_10023628 3300021361 Bacteria 2829
134 Ga0213876_10042094 3300021384 Bacteria 2413
135 Ga0209435_106053 3300025206 Bacteria 1352
136 Ga0209760_100670 3300025207 Bacteria 5503
137 Ga0209436_100056 3300025208 Bacteria 61172
138 Ga0209784_100002 3300025224 Bacteria 1753105
139 Ga0209784_100069 3300025224 Bacteria 152424
140 Ga0209784_101181 3300025224 Bacteria 4074
141 Ga0209566_100003 3300025225 Bacteria 1753105
142 Ga0209566_100083 3300025225 Bacteria 152424
143 Ga0209674_100004 3300025226 Bacteria 1753105
144 Ga0209674_100106 3300025226 Bacteria 152424
145 Ga0209674_100265 3300025226 Bacteria 41160
146 Ga0209674_101455 3300025226 Bacteria 6246
147 Ga0209672_100568 3300025228 Bacteria 19633
148 Ga0209563_100006 3300025230 Bacteria 1753105
149 Ga0209563_100100 3300025230 Bacteria 152424
150 Ga0209563_106003 3300025230 Bacteria 2132
151 Ga0207427_101382 3300025231 Bacteria 8890
152 Ga0209437_100156 3300025233 Bacteria 152424
153 Ga0207425_1000991 3300025245 Bacteria 13328
154 Ga0209646_1000051 3300025246 Bacteria 296525
155 Ga0209677_100003 3300025253 Bacteria 1753105
156 Ga0209677_100061 3300025253 Bacteria 152424
157 Ga0209677_101691 3300025253 Bacteria 9204
158 Ga0209233_1000165 3300025261 Bacteria 152424
159 Ga0209565_1000021 3300025263 Bacteria 406281
160 Ga0209565_1001000 3300025263 Bacteria 14523
161 Ga0209565_1002584 3300025263 Bacteria 6424
162 Ga0209565_1003367 3300025263 Bacteria 5213
163 Ga0209565_1008944 3300025263 Bacteria 2584
164 Ga0209455_1000043 3300025272 Bacteria 413928
165 Ga0209673_1018443 3300025273 Bacteria 2537
166 Ga0209673_1030226 3300025273 Bacteria 1710
167 Ga0209130_1000128 3300025284 Bacteria 123595
168 Ga0209675_1000305 3300025291 Bacteria 44331
169 Ga0209675_1000620 3300025291 Bacteria 25347
170 Ga0209675_1001372 3300025291 Bacteria 14248
171 Ga0209675_1005463 3300025291 Bacteria 5313
172 Ga0209675_1008648 3300025291 Bacteria 3707
173 Ga0209676_1000380 3300025292 Bacteria 81727
174 Ga0209025_1000796 3300025294 Bacteria 51224
175 Ga0209025_1003166 3300025294 Bacteria 16007
176 Ga0209025_1004213 3300025294 Bacteria 12676
177 Ga0209025_1006036 3300025294 Bacteria 9586
178 Ga0209025_1006730 3300025294 Bacteria 8818
179 Ga0209025_1020616 3300025294 Bacteria 3594
180 Ga0209564_1000011 3300025295 Bacteria 822327
181 Ga0209564_1000109 3300025295 Bacteria 212912
182 Ga0209564_1000704 3300025295 Bacteria 48946
183 Ga0209564_1001230 3300025295 Bacteria 28913
184 Ga0209564_1001451 3300025295 Bacteria 24165
185 Ga0209564_1002510 3300025295 Bacteria 14245
186 Ga0209758_1000568 3300025297 Bacteria 57997
187 Ga0209758_1004513 3300025297 Bacteria 11540
188 Ga0209050_1000074 3300025298 Bacteria 289334
189 Ga0209256_1000007 3300025299 Bacteria 1136599
190 Ga0209256_1000280 3300025299 Bacteria 89706
191 Ga0209256_1000653 3300025299 Bacteria 47237
192 Ga0209256_1001600 3300025299 Bacteria 22175
193 Ga0209256_1018312 3300025299 Bacteria 2283
194 Ga0209051_1000412 3300025303 Bacteria 59121
195 Ga0209051_1005477 3300025303 Bacteria 7404
196 Ga0209257_1000022 3300025304 Bacteria 765258
197 Ga0209257_1007187 3300025304 Bacteria 6834
198 Ga0207655_1033511 3300025728 Bacteria 2326
199 Ga0207713_1000287 3300025735 Bacteria 58430
200 Ga0207647_10000161 3300025904 Bacteria 52943
201 Ga0207647_10030948 3300025904 Bacteria 3449
202 Ga0207705_10010449 3300025909 Bacteria 6750
203 Ga0207695_10004999 3300025913 Bacteria 17821
204 Ga0207695_10009157 3300025913 Bacteria 12285
205 Ga0207671_10049173 3300025914 Bacteria 3121
206 Ga0207657_10000748 3300025919 Bacteria 34408
207 Ga0207681_10000484 3300025923 Bacteria 27885
208 Ga0207694_10001723 3300025924 Bacteria 18315
209 Ga0207690_10001324 3300025932 Bacteria 15570
210 Ga0207709_10000207 3300025935 Bacteria 76905
211 Ga0207665_10131193 3300025939 Bacteria 1779
212 Ga0207711_10180548 3300025941 Bacteria 1919
213 Ga0207667_10000055 3300025949 Bacteria 223770
214 Ga0207667_10003185 3300025949 Bacteria 20273
215 Ga0207667_10003495 3300025949 Bacteria 19411
216 Ga0207667_10074759 3300025949 Bacteria 3519
217 Ga0207651_10014252 3300025960 Bacteria 4582
218 Ga0207640_10008622 3300025981 Bacteria 5667
219 Ga0207658_10079036 3300025986 Bacteria 2515
220 Ga0207678_10002121 3300026067 Bacteria 17962
221 Ga0207678_10084482 3300026067 Bacteria 2715
222 Ga0207648_10006437 3300026089 Bacteria 11670
223 Ga0209281_1000067 3300027111 Bacteria 284517
224 Ga0209371_1021458 3300027312 Bacteria 1564
225 Ga0209970_1000306 3300027614 Bacteria 8105
226 Ga0209282_1000001 3300027666 Bacteria 2450367
227 Ga0268265_10189051 3300028380 Bacteria 1776
228 Ga0268264_10049803 3300028381 Bacteria 3487
229 Ga0265338_10001261 3300028800 Bacteria 41728
230 Ga0268256_1024147 3300030500 Bacteria 1564
231 Ga0265328_10015498 3300031239 Bacteria 2984
232 Ga0265331_10003080 3300031250 Bacteria 10941
233 Ga0265327_10000042 3300031251 Bacteria 287487
234 Ga0265327_10000825 3300031251 Bacteria 46672
235 Ga0265327_10072469 3300031251 Bacteria 1720
236 Ga0307513_10000010 3300031456 Bacteria 360812
237 Ga0307408_100000099 3300031548 Bacteria 95526
238 Ga0307408_100000126 3300031548 Bacteria 84345
239 Ga0307408_100000213 3300031548 Bacteria 61855
240 Ga0307408_100002457 3300031548 Bacteria 13003
241 Ga0307516_10003651 3300031730 Bacteria 19550
242 Ga0307516_10008336 3300031730 Bacteria 11746
243 Ga0307406_10001170 3300031901 Bacteria 14699
244 Ga0307414_10048529 3300032004 Bacteria 2929
245 Ga0307510_10109733 3300033180 Bacteria 2507
246 Ga0373939_0000006 3300035114 Bacteria 78721
247 Ga0373960_0011888 3300035121 Bacteria 2153
248 Ga0373931_0000192 3300035691 Bacteria 26110
249 Ga0373931_0010254 3300035691 Bacteria 4501
250 Ga0395899_0007821 3300037312 Bacteria 8242
251 Ga0395900_0002373 3300037418 Bacteria 20814
252 Ga0395900_0028579 3300037418 Bacteria 5714
253 Ga0395900_0035360 3300037418 Bacteria 5145
254 Ga0395900_0393463 3300037418 Bacteria 1351
255 Ga0395898_0002574 3300037466 Bacteria 21233
256 Ga0395898_0054387 3300037466 Bacteria 3906
257 Ga0395905_0001148 3300037471 Bacteria 33147
258 Ga0395905_0006382 3300037471 Bacteria 11884
259 Ga0395905_0007790 3300037471 Bacteria 10622
260 Ga0395905_0046279 3300037471 Bacteria 4079
261 Ga0395905_0125792 3300037471 Bacteria 2410
262 Ga0395901_0000666 3300038443 Bacteria 39480
263 Ga0395901_0113442 3300038443 Bacteria 2846
264 Ga0436365_1213579 3300039437 Bacteria 2681
265 Ga0436361_0019641 3300039447 Bacteria 127735
266 Ga0436361_0028834 3300039447 Bacteria 11246
267 Ga0436361_0060173 3300039447 Bacteria 21826
268 Ga0436361_0262749 3300039447 Bacteria 3352
269 Ga0436361_0262860 3300039447 Bacteria 38390
270 Ga0436361_0427866 3300039447 Bacteria 8734
271 Ga0436361_0831059 3300039447 Bacteria 1888
272 Ga0436361_0867198 3300039447 Bacteria 16499
273 Ga0436361_0914605 3300039447 Bacteria 7609
274 Ga0436361_1185928 3300039447 Bacteria 172199
275 Ga0466969_0011538 3300044656 Bacteria 4677
276 Ga0466965_0006859 3300044683 Bacteria 5205
277 Ga0466965_0042739 3300044683 Bacteria 2236
278 Ga0466966_0004495 3300044684 Bacteria 9200
279 Ga0466966_0041987 3300044684 Bacteria 2938
280 Ga0466966_0080154 3300044684 Bacteria 2034
281 Ga0466964_0001262 3300044706 Bacteria 8611
282 Ga0466970_0005420 3300044765 Bacteria 6329
283 Ga0466970_0021736 3300044765 Bacteria 3345
284 Ga0466970_0048831 3300044765 Bacteria 2257
285 Ga0466957_0000144 3300044842 Bacteria 30661
286 Ga0466959_0003896 3300045049 Bacteria 9906
287 Ga0466959_0060549 3300045049 Bacteria 2754
288 Ga0451576_0146237 3300045051 Bacteria 2464
289 Ga0466967_0012781 3300045976 Bacteria 6448
290 Ga0495617_000003 3300046452 Bacteria 541914
291 Ga0495617_002148 3300046452 Bacteria 8107
292 Ga0495617_002210 3300046452 Bacteria 7924
293 Ga0495617_014823 3300046452 Bacteria 2647
294 Ga0495627_000001 3300046453 Bacteria 1104709
295 Ga0495592_0002083 3300046454 Bacteria 14097
296 Ga0495590_0000001 3300046457 Bacteria 762984
297 Ga0495629_0009210 3300046459 Bacteria 7225
298 Ga0495638_0000017 3300046460 Bacteria 391117
299 Ga0495638_0008065 3300046460 Bacteria 7496
300 Ga0495638_0013252 3300046460 Bacteria 5622
301 Ga0495651_0017286 3300046462 Bacteria 5587
302 Ga0495653_0000024 3300046463 Bacteria 160810
303 Ga0495653_0000887 3300046463 Bacteria 23134
304 Ga0495653_0028431 3300046463 Bacteria 4469
305 Ga0495650_0000072 3300046471 Bacteria 257886
306 Ga0495650_0000082 3300046471 Bacteria 239477
307 Ga0495650_0000456 3300046471 Bacteria 64008
308 Ga0495650_0002278 3300046471 Bacteria 15963
309 Ga0495650_0003058 3300046471 Bacteria 12590
310 Ga0495582_0039281 3300046473 Bacteria 2606
311 Ga0495605_0000028 3300046474 Bacteria 218471
312 Ga0495639_0001013 3300046475 Bacteria 12698
313 Ga0495584_0000298 3300046491 Bacteria 34980
314 Ga0495584_0028997 3300046491 Bacteria 2805
315 Ga0495585_0000506 3300046492 Bacteria 36822
316 Ga0495585_0010198 3300046492 Bacteria 5608
317 Ga0495585_0025150 3300046492 Bacteria 3413
318 Ga0495585_0029388 3300046492 Bacteria 3129
319 Ga0495607_0007244 3300046501 Bacteria 7701
320 Ga0495607_0060457 3300046501 Bacteria 2156
321 Ga0495583_0000050 3300046506 Bacteria 213627
322 Ga0495583_0001616 3300046506 Bacteria 22089
323 Ga0495583_0005688 3300046506 Bacteria 8380
324 Ga0495606_0000001 3300046507 Bacteria 592123
325 Ga0495606_0000095 3300046507 Bacteria 151634
326 Ga0495606_0000123 3300046507 Bacteria 131654
327 Ga0495606_0000877 3300046507 Bacteria 45003
328 Ga0495606_0000943 3300046507 Bacteria 42806
329 Ga0495606_0004178 3300046507 Bacteria 14638
330 Ga0495606_0009453 3300046507 Bacteria 8249
331 Ga0495606_0009729 3300046507 Bacteria 8089
332 Ga0495606_0011424 3300046507 Bacteria 7242
333 Ga0495610_0000003 3300046512 Bacteria 1203910
334 Ga0495610_0010286 3300046512 Bacteria 5827
335 Ga0495610_0023797 3300046512 Bacteria 3321
336 Ga0495618_0006469 3300046514 Bacteria 7112
337 Ga0495628_0000851 3300046516 Bacteria 28201
338 Ga0495628_0002696 3300046516 Bacteria 15889
339 Ga0495628_0003806 3300046516 Bacteria 13437
340 Ga0495643_0000099 3300046522 Bacteria 145425
341 Ga0495643_0000628 3300046522 Bacteria 41878
342 Ga0495644_0001490 3300046523 Bacteria 9545
343 Ga0495644_0022792 3300046523 Bacteria 2385
344 Ga0495648_0000040 3300046524 Bacteria 184782
345 Ga0495648_0000257 3300046524 Bacteria 60516
346 Ga0495648_0033838 3300046524 Bacteria 3333
347 Ga0495648_0068547 3300046524 Bacteria 2069
348 Ga0495642_0003887 3300046528 Bacteria 5858
349 Ga0495642_0008327 3300046528 Bacteria 3967
350 Ga0495652_0000966 3300046529 Bacteria 32910
351 Ga0495652_0014755 3300046529 Bacteria 7005
352 Ga0495652_0022039 3300046529 Bacteria 5658
353 Ga0495652_0172206 3300046529 Bacteria 1670
354 Ga0495654_0000037 3300046530 Bacteria 188218
355 Ga0495665_0000074 3300046531 Bacteria 42760
356 Ga0495609_0001214 3300046538 Bacteria 17758
357 Ga0495609_0005933 3300046538 Bacteria 6312
358 Ga0495609_0023574 3300046538 Bacteria 2828
359 Ga0495609_0025058 3300046538 Bacteria 2735
360 Ga0495597_0000172 3300046542 Bacteria 57536
361 Ga0495597_0000284 3300046542 Bacteria 45727
362 Ga0495597_0006201 3300046542 Bacteria 6207
363 Ga0495597_0024207 3300046542 Bacteria 2803
364 Ga0495645_0019683 3300046543 Bacteria 4862
365 Ga0495645_0073153 3300046543 Bacteria 2469
366 Ga0495622_0000001 3300046557 Bacteria 365248
367 Ga0495622_0000185 3300046557 Bacteria 50470
368 Ga0495622_0070429 3300046557 Bacteria 1614
369 Ga0495633_0000106 3300046558 Bacteria 113381
370 Ga0495633_0000117 3300046558 Bacteria 108053
371 Ga0495633_0000180 3300046558 Bacteria 82176
372 Ga0495633_0001137 3300046558 Bacteria 21361
373 Ga0495633_0007371 3300046558 Bacteria 6337
374 Ga0495633_0012299 3300046558 Bacteria 4562
375 Ga0495668_0000018 3300046616 Bacteria 417480
376 Ga0495668_0000240 3300046616 Bacteria 78290
377 Ga0495668_0000441 3300046616 Bacteria 53224
378 Ga0495668_0001105 3300046616 Bacteria 27912
379 Ga0495668_0007805 3300046616 Bacteria 6782
380 Ga0495634_0161632 3300046642 Bacteria 1412
381 Ga0495611_0038736 3300046648 Bacteria 2121
382 Ga0495625_0000035 3300046660 Bacteria 224323
383 Ga0495625_0001708 3300046660 Bacteria 25534
384 Ga0495625_0003558 3300046660 Bacteria 15362
385 Ga0495625_0089529 3300046660 Bacteria 2130
386 Ga0495625_0105798 3300046660 Bacteria 1927
387 Ga0495635_0065734 3300046663 Bacteria 2488
388 Ga0495659_0000001 3300046664 Bacteria 325846
389 Ga0495659_0000700 3300046664 Bacteria 12110
390 Ga0495661_0011504 3300046665 Bacteria 6003
391 Ga0495599_0008736 3300046678 Bacteria 6169
392 Ga0495623_0002640 3300046679 Bacteria 11829
393 Ga0495623_0003893 3300046679 Bacteria 9846
394 Ga0495646_0001618 3300046680 Bacteria 13412
395 Ga0495646_0126870 3300046680 Bacteria 1439
396 Ga0495624_0010745 3300046690 Bacteria 6309
397 Ga0495624_0013777 3300046690 Bacteria 5506
398 Ga0495624_0033872 3300046690 Bacteria 3308
399 Ga0495670_0000850 3300046691 Bacteria 14756
400 Ga0495670_0030703 3300046691 Bacteria 2669
401 Ga0495671_0000010 3300046692 Bacteria 368641
402 Ga0495671_0000035 3300046692 Bacteria 188543
403 Ga0495671_0044677 3300046692 Bacteria 2220
404 Ga0495671_0071491 3300046692 Bacteria 1704
405 Ga0495671_0083192 3300046692 Bacteria 1568
406 Ga0495649_0004361 3300046694 Bacteria 9265
407 Ga0495600_0002649 3300046809 Bacteria 10336
408 Ga0495660_0000053 3300046810 Bacteria 137479
409 Ga0495660_0000470 3300046810 Bacteria 33476
410 Ga0495660_0002782 3300046810 Bacteria 11033
411 Ga0495604_0003046 3300047317 Bacteria 13394
412 Ga0495604_0005783 3300047317 Bacteria 9811
413 Ga0495636_0004975 3300047318 Bacteria 5212
414 Ga0495636_0008204 3300047318 Bacteria 4120
415 Ga0495674_0018534 3300047319 Bacteria 6479
416 Ga0495674_0080778 3300047319 Bacteria 2789
417 Ga0495672_0000032 3300047320 Bacteria 295356
418 Ga0495672_0000066 3300047320 Bacteria 193318
419 Ga0495672_0002501 3300047320 Bacteria 16819
420 Ga0495672_0005242 3300047320 Bacteria 10328
421 Ga0495672_0016341 3300047320 Bacteria 5005
422 Ga0495680_0000747 3300047322 Bacteria 36401
423 Ga0495687_003394 3300047443 Bacteria 11607
424 Ga0495687_003447 3300047443 Bacteria 11441
425 Ga0495687_004533 3300047443 Bacteria 9326
426 Ga0495687_004837 3300047443 Bacteria 8861
427 Ga0495685_000021 3300047447 Bacteria 72522
428 Ga0495673_0000003 3300047469 Bacteria 1491337
429 Ga0495673_0000016 3300047469 Bacteria 580643
430 Ga0495673_0000035 3300047469 Bacteria 316861
431 Ga0495673_0006609 3300047469 Bacteria 6796
432 Ga0495681_0024424 3300047470 Bacteria 3185
433 Ga0495686_0001386 3300047472 Bacteria 26897
434 Ga0495686_0017804 3300047472 Bacteria 4781
435 Ga0495686_0021956 3300047472 Bacteria 4227
436 Ga0495686_0040925 3300047472 Bacteria 2952
437 Ga0495593_0000348 3300047673 Bacteria 25533
438 Ga0495602_0009940 3300048088 Bacteria 9868
439 Ga0495626_0023857 3300048091 Bacteria 3006
440 Ga0496102_0017861 3300048905 Bacteria 6220
441 Ga0496102_0037728 3300048905 Bacteria 4360
442 Ga0496102_0177613 3300048905 Bacteria 2005
443 Ga0496103_0001632 3300048906 Bacteria 14721
444 Ga0496103_0002995 3300048906 Bacteria 10442
445 Ga0496104_0024895 3300048907 Bacteria 5512
446 Ga0496105_0197834 3300048908 Bacteria 1641
447 Ga0496106_0038571 3300048909 Bacteria 3576
448 Ga0496111_0099094 3300048914 Bacteria 2140
449 Ga0496113_0130739 3300048916 Bacteria 1970
450 Ga0496116_0005613 3300048919 Bacteria 11560
451 Ga0496116_0018784 3300048919 Bacteria 5313
452 Ga0496116_0047524 3300048919 Bacteria 2888
453 Ga0496116_0089072 3300048919 Bacteria 1883
454 Ga0496117_0000045 3300048920 Bacteria 301047
455 Ga0496117_0004060 3300048920 Bacteria 16440
456 Ga0496117_0004789 3300048920 Bacteria 14670
457 Ga0496117_0019912 3300048920 Bacteria 5491
458 Ga0496118_0000041 3300048921 Bacteria 301047
459 Ga0496118_0009775 3300048921 Bacteria 9616
460 Ga0496118_0028442 3300048921 Bacteria 4706
461 Ga0496118_0032955 3300048921 Bacteria 4258
462 Ga0496119_0053134 3300048922 Bacteria 2477
463 Ga0496121_0002653 3300048924 Bacteria 26844
464 Ga0496121_0003488 3300048924 Bacteria 22392
465 Ga0496121_0009982 3300048924 Bacteria 10794
466 Ga0496121_0032075 3300048924 Bacteria 4783
467 Ga0496121_0073604 3300048924 Bacteria 2737
468 Ga0496122_0000818 3300048925 Bacteria 59567
469 Ga0496122_0034662 3300048925 Bacteria 4126
470 Ga0496122_0040260 3300048925 Bacteria 3717
471 Ga0496123_0001701 3300048926 Bacteria 29394
472 Ga0496123_0003612 3300048926 Bacteria 17139
473 Ga0496123_0017283 3300048926 Bacteria 5812
474 Ga0496124_0007340 3300048927 Bacteria 11744
475 Ga0496124_0079182 3300048927 Bacteria 2706
476 Ga0496124_0093381 3300048927 Bacteria 2449
477 Ga0496124_0205581 3300048927 Bacteria 1494
478 Ga0496125_0007217 3300048928 Bacteria 11843
479 Ga0496125_0017268 3300048928 Bacteria 6891
480 Ga0496125_0031101 3300048928 Bacteria 4764
481 Ga0496126_0005426 3300048929 Bacteria 14545
482 Ga0496126_0011681 3300048929 Bacteria 9059
483 Ga0496126_0042404 3300048929 Bacteria 4202
484 Ga0496126_0049065 3300048929 Bacteria 3855
485 Ga0496126_0064349 3300048929 Bacteria 3286
486 Ga0495678_000002 3300049459 Bacteria 999613
487 Ga0495678_000262 3300049459 Bacteria 58570
488 Ga0495678_000674 3300049459 Bacteria 31390
489 Ga0495682_0000332 3300049460 Bacteria 35082
490 Ga0495682_0007852 3300049460 Bacteria 4220
491 Ga0495682_0014753 3300049460 Bacteria 2961
492 Ga0501031_0148966 3300049568 Bacteria 1529
493 Ga0501037_0036053 3300049573 Bacteria 3646
494 Ga0501035_0033813 3300049822 Bacteria 4647
495 Ga0501044_0001149 3300049823 Bacteria 31351
496 nmdc:mga0k408_99523_c1 3300050493 Bacteria 1713
497 nmdc:mga07m45_5582_c1 3300050496 Bacteria 6280
498 nmdc:mga0sz30_27060_c1 3300050516 Bacteria 2353
499 Ga0500583_0016255 3300053092 Bacteria 2967
500 Ga0500651_0025827 3300053093 Bacteria 3688
501 Ga0500593_000235 3300053117 Bacteria 22775
502 Ga0500594_0009167 3300053118 Bacteria 2273
503 Ga0500618_000980 3300053125 Bacteria 14451
504 Ga0500618_014341 3300053125 Bacteria 2026
505 Ga0500559_0000603 3300053136 Bacteria 24440
506 Ga0500568_0030894 3300053139 Bacteria 2215
507 Ga0500619_000083 3300053154 Bacteria 26339
508 Ga0500622_0009604 3300053156 Bacteria 5346
509 Ga0500587_002027 3300053739 Bacteria 2889
510 2511384477 2511231026 Bacteria 5225445
511 2512346352 2512047030 Bacteria 9031815
512 2513955105 2513237150 Bacteria 6553639
513 2513960979 2513237151 Bacteria 6309801
514 2514041320 2513237165 Bacteria 6771773
515 2527075218 2526164713 Bacteria 6780608
516 2550696254 2548876994 Bacteria 4904866
517 2552747689 2551306352 Bacteria 3873115
518 2553006633 2551306416 Bacteria 6152985
519 2597028579 2596583598 Bacteria 5251611
520 2599444601 2599185178 Bacteria 5365746
521 2601669954 2600255292 Bacteria 6300551
522 2643790754 2643221554 Bacteria 6603920
523 2643865468 2643221570 Bacteria 5103772
524 2643933198 2643221585 Bacteria 5812563
525 2643990685 2643221596 Bacteria 5006805
526 2644026641 2643221603 Bacteria 6147767
527 2644063267 2643221609 Bacteria 6756331
528 2644071750 2643221611 Bacteria 6820941
529 2644211676 2643221638 Bacteria 6579467
530 2644217357 2643221639 Bacteria 6649903
531 2644251539 2643221645 Bacteria 7207331
532 2644258867 2643221646 Bacteria 6433402
533 2644296174 2643221652 Bacteria 5140275
534 2644314447 2643221656 Bacteria 5809961
535 2644357408 2643221664 Bacteria 7272945
536 2722882889 2721755523 Bacteria 6430384
537 2738740000 2738541280 Bacteria 6630198
538 2738820708 2738541296 Bacteria 7285013
539 2738829971 2738541297 Bacteria 6549566
540 2738833188 2738541298 Bacteria 7286732
541 2738844245 2738541300 Bacteria 6675882
542 2738874716 2738541306 Bacteria 7284992
543 2739055622 2738541337 Bacteria 6183410
544 2739153767 2738541357 Bacteria 6549408
545 2739186345 2738543002 Bacteria 7284546
546 2739195687 2738543003 Bacteria 6549560
547 2739221314 2738543008 Bacteria 7282815
548 2739246381 2738543012 Bacteria 7115078
549 2739274195 2738543018 Bacteria 6718814
550 2739322163 2738543026 Bacteria 6549408
551 2739340404 2738543029 Bacteria 6549249
552 2739343239 2738543030 Bacteria 6719714
553 2753566716 2751185846 Bacteria 7242164
554 2765570231 2765235838 Bacteria 5445269
555 2774391074 2773857761 Bacteria 3837365
556 2816475403 2816332133 Bacteria 7249298
557 2819544219 2818991436 Bacteria 5376622
558 2819620153 2818991450 Bacteria 6962147
559 2821131913 2821131069 Bacteria 6108407
560 2839096825 2839094727 Bacteria 5534556
561 2839140973 2839138175 Bacteria 6549354
562 2842327405 2842324504 Bacteria 9364110
563 2842351988 2842348783 Bacteria 9002918
564 2842458183 2842454564 Bacteria 8730687
565 2842715617 2842711865 Bacteria 7155354
566 2856291714 2856287931 Bacteria 7223934
567 2857362369 2857357740 Bacteria 9937880
568 2857550980 2857547612 Bacteria 6179999
569 2857555831 2857553236 Bacteria 6166726
570 2857561740 2857558681 Bacteria 6617694
571 2857566857 2857564685 Bacteria 6290584
572 2885082269 2885080285 Bacteria 6355622
573 2885267077 2885266251 Bacteria 4796748
574 2900581617 2900577576 Bacteria 5438534
575 2904425639 2904424332 Bacteria 7633521
576 2904441681 2904439833 Bacteria 5931679
577 2904531397 2904530477 Bacteria 5876334
578 2904586948 2904584206 Bacteria 6028872
579 2904593019 2904589729 Bacteria 6113573
580 2904603171 2904601388 Bacteria 5884906
581 2916700801 2916699645 Bacteria 3568996
582 2919050967 2919046199 Bacteria 5567169
583 2919082019 2919079590 Bacteria 5946433
584 2919186011 2919182534 Bacteria 3907101
585 2919478207 2919476304 Bacteria 5888696
586 2919530591 2919527303 Bacteria 7718827
587 2923510776 2923510766 Bacteria 5926163
588 2928062596 2928058823 Bacteria 5520022
589 2928110288 2928108538 Bacteria 7360024
590 2928135095 2928130867 Bacteria 5467269
591 2928138578 2928135762 Bacteria 7259641
592 2928505359 2928503688 Bacteria 7268108
593 2932413440 2932410948 Bacteria 6312192
594 2932417500 2932416698 Bacteria 6315112
595 2941482795
596 2945937008 2945934425 Bacteria 7444609
597 2990706264 2990703756 Bacteria 7715990
598 642423088 641736151 Bacteria 7477263
599 644748090 644736347 Bacteria 6476522
600 8040169876 8040167225 Bacteria 6542727
601 8055268332 8055266321 Bacteria 7999742
602 8055302350 8055301274 Bacteria 8587385
603 Ga0207647_10046067
604 JGI24741J21665_1001141
605 JGI24740J21852_10000827
606 JGI24739J22299_10003513
607 JGI24735J21928_10001072
608 JGI25154J39366_1003929
609 JGI25158J39367_1000214
610 JGI25150J39212_1002915
611 JGI25159J45721_1000738
612 JGI25151J46595_10002200
613 JGI25151J46595_10020027
614 JGI25165J46597_1000105
615 JGI25153J46596_10027055
616 rootH1_10021172
617 rootL2_10028151
618 rootL2_10062828
619 rootH1_10016206
620 JGI25161J50226_1000166
621 Ga0006562J51391_1066503
622 Ga0055538_1000043
623 Ga0055538_1000045
624 Ga0055538_1002176
625 Ga0055538_1002238
626 Ga0055539_1000057
627 Ga0055539_1000064
628 Ga0055539_1000123
629 Ga0055539_1005174
630 Ga0055533_1000071
631 Ga0055533_1000074
632 Ga0055533_1001217
633 Ga0055533_1001659
634 Ga0055532_1000029
635 Ga0055525_1000085
636 Ga0055525_1000092
637 Ga0055525_1000345
638 Ga0055529_1000032
639 Ga0055529_1000062
640 Ga0055529_1000376
641 Ga0055526_1000070
642 Ga0055526_1000875
643 Ga0055526_1002131
644 Ga0055526_1002334
645 Ga0055526_1007982
646 Ga0055537_1000936
647 Ga0055524_1001214
648 Ga0055524_1003259
649 Ga0055524_1004250
650 Ga0055536_1000083
651 Ga0055534_1001169
652 Ga0055534_1002625
653 Ga0055530_10000262
654 Ga0055531_10000415
655 Ga0055541_1000044
656 Ga0055541_1000046
657 Ga0055543_1000063
658 Ga0065165_1001834
659 Ga0070660_100007417
660 Ga0070661_100004017
661 Ga0070669_100000350
662 Ga0070673_100073166
663 Ga0070659_100002881
664 Ga0070667_100078364
665 Ga0070663_100000011
666 Ga0070663_100065897
667 Ga0068867_100001582
668 Ga0068855_100002352
669 Ga0068855_100002607
670 Ga0070664_100000008
671 Ga0068857_100112705
672 Ga0068854_100000072
673 Ga0068856_100000009
674 Ga0068856_100067922
675 Ga0068860_100076689
676 Ga0075365_10057124
677 Ga0075365_10271902
678 Ga0075368_10009861
679 Ga0070716_100075366
680 Ga0075362_10007882
681 Ga0075366_10018118
682 Ga0075370_10012638
683 Ga0079104_1000026
684 Ga0099826_10000002
685 Ga0105251_10000134
686 Ga0105251_10001448
687 Ga0105244_10002391
688 Ga0105244_10004250
689 Ga0105240_10055439
690 Ga0105240_10079339
691 Ga0105240_10115119
692 Ga0105243_10012895
693 Ga0105237_10037899
694 Ga0105237_10087424
695 Ga0105237_10224283
696 Ga0105238_10000318
697 Ga0105239_10000493
698 Ga0105239_10083795
699 Ga0157373_10005361
700 Ga0157373_10005801
701 Ga0157371_10000068
702 Ga0157370_10000200
703 Ga0157370_10000300
704 Ga0157370_10018183
705 Ga0157369_10005953
706 Ga0157369_10009262
707 Ga0157374_10000230
708 Ga0157372_10000304
709 Ga0157375_10025421
710 Ga0182008_10007115
711 Ga0182008_10062672
712 Ga0182008_10086137
713 Ga0157377_10000014
714 Ga0182006_1000035
715 Ga0182006_1000040
716 Ga0182006_1004807
717 Ga0182006_1006450
718 Ga0182006_1020266
719 Ga0182007_10000189
720 Ga0182007_10000453
721 Ga0182007_10006298
722 Ga0182007_10020700
723 Ga0182007_10029125
724 Ga0182005_1000025
725 Ga0182005_1000066
726 Ga0182005_1001576
727 Ga0163161_10017321
728 Ga0213872_10000072
729 Ga0213872_10000313
730 Ga0213872_10002057
731 Ga0213872_10002394
732 Ga0213872_10004921
733 Ga0213872_10008680
734 Ga0213872_10023628
735 Ga0213876_10042094
736 Ga0209435_106053
737 Ga0209760_100670
738 Ga0209436_100056
739 Ga0209784_100002
740 Ga0209784_100069
741 Ga0209784_101181
742 Ga0209566_100003
743 Ga0209566_100083
744 Ga0209674_100004
745 Ga0209674_100106
746 Ga0209674_100265
747 Ga0209674_101455
748 Ga0209672_100568
749 Ga0209563_100006
750 Ga0209563_100100
751 Ga0209563_106003
752 Ga0207427_101382
753 Ga0209437_100156
754 Ga0207425_1000991
755 Ga0209646_1000051
756 Ga0209677_100003
757 Ga0209677_100061
758 Ga0209677_101691
759 Ga0209233_1000165
760 Ga0209565_1000021
761 Ga0209565_1001000
762 Ga0209565_1002584
763 Ga0209565_1003367
764 Ga0209565_1008944
765 Ga0209455_1000043
766 Ga0209673_1018443
767 Ga0209673_1030226
768 Ga0209130_1000128
769 Ga0209675_1000305
770 Ga0209675_1000620
771 Ga0209675_1001372
772 Ga0209675_1005463
773 Ga0209675_1008648
774 Ga0209676_1000380
775 Ga0209025_1000796
776 Ga0209025_1003166
777 Ga0209025_1004213
778 Ga0209025_1006036
779 Ga0209025_1006730
780 Ga0209025_1020616
781 Ga0209564_1000011
782 Ga0209564_1000109
783 Ga0209564_1000704
784 Ga0209564_1001230
785 Ga0209564_1001451
786 Ga0209564_1002510
787 Ga0209758_1000568
788 Ga0209758_1004513
789 Ga0209050_1000074
790 Ga0209256_1000007
791 Ga0209256_1000280
792 Ga0209256_1000653
793 Ga0209256_1001600
794 Ga0209256_1018312
795 Ga0209051_1000412
796 Ga0209051_1005477
797 Ga0209257_1000022
798 Ga0209257_1007187
799 Ga0207655_1033511
800 Ga0207713_1000287
801 Ga0207647_10000161
802 Ga0207647_10030948
803 Ga0207705_10010449
804 Ga0207695_10004999
805 Ga0207695_10009157
806 Ga0207671_10049173
807 Ga0207657_10000748
808 Ga0207681_10000484
809 Ga0207694_10001723
810 Ga0207690_10001324
811 Ga0207709_10000207
812 Ga0207665_10131193
813 Ga0207711_10180548
814 Ga0207667_10000055
815 Ga0207667_10003185
816 Ga0207667_10003495
817 Ga0207667_10074759
818 Ga0207651_10014252
819 Ga0207640_10008622
820 Ga0207658_10079036
821 Ga0207678_10002121
822 Ga0207678_10084482
823 Ga0207648_10006437
824 Ga0209281_1000067
825 Ga0209371_1021458
826 Ga0209970_1000306
827 Ga0209282_1000001
828 Ga0268265_10189051
829 Ga0268264_10049803
830 Ga0265338_10001261
831 Ga0268256_1024147
832 Ga0265328_10015498
833 Ga0265331_10003080
834 Ga0265327_10000042
835 Ga0265327_10000825
836 Ga0265327_10072469
837 Ga0307513_10000010
838 Ga0307408_100000099
839 Ga0307408_100000126
840 Ga0307408_100000213
841 Ga0307408_100002457
842 Ga0307516_10003651
843 Ga0307516_10008336
844 Ga0307406_10001170
845 Ga0307414_10048529
846 Ga0307510_10109733
847 Ga0373939_0000006
848 Ga0373960_0011888
849 Ga0373931_0000192
850 Ga0373931_0010254
851 Ga0395899_0007821
852 Ga0395900_0002373
853 Ga0395900_0028579
854 Ga0395900_0035360
855 Ga0395900_0393463
856 Ga0395898_0002574
857 Ga0395898_0054387
858 Ga0395905_0001148
859 Ga0395905_0006382
860 Ga0395905_0007790
861 Ga0395905_0046279
862 Ga0395905_0125792
863 Ga0395901_0000666
864 Ga0395901_0113442
865 Ga0436365_1213579
866 Ga0436361_0019641
867 Ga0436361_0028834
868 Ga0436361_0060173
869 Ga0436361_0262749
870 Ga0436361_0262860
871 Ga0436361_0427866
872 Ga0436361_0831059
873 Ga0436361_0867198
874 Ga0436361_0914605
875 Ga0436361_1185928
876 Ga0466969_0011538
877 Ga0466965_0006859
878 Ga0466965_0042739
879 Ga0466966_0004495
880 Ga0466966_0041987
881 Ga0466966_0080154
882 Ga0466964_0001262
883 Ga0466970_0005420
884 Ga0466970_0021736
885 Ga0466970_0048831
886 Ga0466957_0000144
887 Ga0466959_0003896
888 Ga0466959_0060549
889 Ga0451576_0146237
890 Ga0466967_0012781
891 Ga0495617_000003
892 Ga0495617_002148
893 Ga0495617_002210
894 Ga0495617_014823
895 Ga0495627_000001
896 Ga0495592_0002083
897 Ga0495590_0000001
898 Ga0495629_0009210
899 Ga0495638_0000017
900 Ga0495638_0008065
901 Ga0495638_0013252
902 Ga0495651_0017286
903 Ga0495653_0000024
904 Ga0495653_0000887
905 Ga0495653_0028431
906 Ga0495650_0000072
907 Ga0495650_0000082
908 Ga0495650_0000456
909 Ga0495650_0002278
910 Ga0495650_0003058
911 Ga0495582_0039281
912 Ga0495605_0000028
913 Ga0495639_0001013
914 Ga0495584_0000298
915 Ga0495584_0028997
916 Ga0495585_0000506
917 Ga0495585_0010198
918 Ga0495585_0025150
919 Ga0495585_0029388
920 Ga0495607_0007244
921 Ga0495607_0060457
922 Ga0495583_0000050
923 Ga0495583_0001616
924 Ga0495583_0005688
925 Ga0495606_0000001
926 Ga0495606_0000095
927 Ga0495606_0000123
928 Ga0495606_0000877
929 Ga0495606_0000943
930 Ga0495606_0004178
931 Ga0495606_0009453
932 Ga0495606_0009729
933 Ga0495606_0011424
934 Ga0495610_0000003
935 Ga0495610_0010286
936 Ga0495610_0023797
937 Ga0495618_0006469
938 Ga0495628_0000851
939 Ga0495628_0002696
940 Ga0495628_0003806
941 Ga0495643_0000099
942 Ga0495643_0000628
943 Ga0495644_0001490
944 Ga0495644_0022792
945 Ga0495648_0000040
946 Ga0495648_0000257
947 Ga0495648_0033838
948 Ga0495648_0068547
949 Ga0495642_0003887
950 Ga0495642_0008327
951 Ga0495652_0000966
952 Ga0495652_0014755
953 Ga0495652_0022039
954 Ga0495652_0172206
955 Ga0495654_0000037
956 Ga0495665_0000074
957 Ga0495609_0001214
958 Ga0495609_0005933
959 Ga0495609_0023574
960 Ga0495609_0025058
961 Ga0495597_0000172
962 Ga0495597_0000284
963 Ga0495597_0006201
964 Ga0495597_0024207
965 Ga0495645_0019683
966 Ga0495645_0073153
967 Ga0495622_0000001
968 Ga0495622_0000185
969 Ga0495622_0070429
970 Ga0495633_0000106
971 Ga0495633_0000117
972 Ga0495633_0000180
973 Ga0495633_0001137
974 Ga0495633_0007371
975 Ga0495633_0012299
976 Ga0495668_0000018
977 Ga0495668_0000240
978 Ga0495668_0000441
979 Ga0495668_0001105
980 Ga0495668_0007805
981 Ga0495634_0161632
982 Ga0495611_0038736
983 Ga0495625_0000035
984 Ga0495625_0001708
985 Ga0495625_0003558
986 Ga0495625_0089529
987 Ga0495625_0105798
988 Ga0495635_0065734
989 Ga0495659_0000001
990 Ga0495659_0000700
991 Ga0495661_0011504
992 Ga0495599_0008736
993 Ga0495623_0002640
994 Ga0495623_0003893
995 Ga0495646_0001618
996 Ga0495646_0126870
997 Ga0495624_0010745
998 Ga0495624_0013777
999 Ga0495624_0033872
1000 Ga0495670_0000850
1001 Ga0495670_0030703
1002 Ga0495671_0000010
1003 Ga0495671_0000035
1004 Ga0495671_0044677
1005 Ga0495671_0071491
1006 Ga0495671_0083192
1007 Ga0495649_0004361
1008 Ga0495600_0002649
1009 Ga0495660_0000053
1010 Ga0495660_0000470
1011 Ga0495660_0002782
1012 Ga0495604_0003046
1013 Ga0495604_0005783
1014 Ga0495636_0004975
1015 Ga0495636_0008204
1016 Ga0495674_0018534
1017 Ga0495674_0080778
1018 Ga0495672_0000032
1019 Ga0495672_0000066
1020 Ga0495672_0002501
1021 Ga0495672_0005242
1022 Ga0495672_0016341
1023 Ga0495680_0000747
1024 Ga0495687_003394
1025 Ga0495687_003447
1026 Ga0495687_004533
1027 Ga0495687_004837
1028 Ga0495685_000021
1029 Ga0495673_0000003
1030 Ga0495673_0000016
1031 Ga0495673_0000035
1032 Ga0495673_0006609
1033 Ga0495681_0024424
1034 Ga0495686_0001386
1035 Ga0495686_0017804
1036 Ga0495686_0021956
1037 Ga0495686_0040925
1038 Ga0495593_0000348
1039 Ga0495602_0009940
1040 Ga0495626_0023857
1041 Ga0496102_0017861
1042 Ga0496102_0037728
1043 Ga0496102_0177613
1044 Ga0496103_0001632
1045 Ga0496103_0002995
1046 Ga0496104_0024895
1047 Ga0496105_0197834
1048 Ga0496106_0038571
1049 Ga0496111_0099094
1050 Ga0496113_0130739
1051 Ga0496116_0005613
1052 Ga0496116_0018784
1053 Ga0496116_0047524
1054 Ga0496116_0089072
1055 Ga0496117_0000045
1056 Ga0496117_0004060
1057 Ga0496117_0004789
1058 Ga0496117_0019912
1059 Ga0496118_0000041
1060 Ga0496118_0009775
1061 Ga0496118_0028442
1062 Ga0496118_0032955
1063 Ga0496119_0053134
1064 Ga0496121_0002653
1065 Ga0496121_0003488
1066 Ga0496121_0009982
1067 Ga0496121_0032075
1068 Ga0496121_0073604
1069 Ga0496122_0000818
1070 Ga0496122_0034662
1071 Ga0496122_0040260
1072 Ga0496123_0001701
1073 Ga0496123_0003612
1074 Ga0496123_0017283
1075 Ga0496124_0007340
1076 Ga0496124_0079182
1077 Ga0496124_0093381
1078 Ga0496124_0205581
1079 Ga0496125_0007217
1080 Ga0496125_0017268
1081 Ga0496125_0031101
1082 Ga0496126_0005426
1083 Ga0496126_0011681
1084 Ga0496126_0042404
1085 Ga0496126_0049065
1086 Ga0496126_0064349
1087 Ga0495678_000002
1088 Ga0495678_000262
1089 Ga0495678_000674
1090 Ga0495682_0000332
1091 Ga0495682_0007852
1092 Ga0495682_0014753
1093 Ga0501031_0148966
1094 Ga0501037_0036053
1095 Ga0501035_0033813
1096 Ga0501044_0001149
1097 nmdc:mga0k408_99523_c1
1098 nmdc:mga07m45_5582_c1
1099 nmdc:mga0sz30_27060_c1
1100 Ga0500583_0016255
1101 Ga0500651_0025827
1102 Ga0500593_000235
1103 Ga0500594_0009167
1104 Ga0500618_000980
1105 Ga0500618_014341
1106 Ga0500559_0000603
1107 Ga0500568_0030894
1108 Ga0500619_000083
1109 Ga0500622_0009604
1110 Ga0500587_002027
1111 2511384477
1112 2512346352
1113 2513955105
1114 2513960979
1115 2514041320
1116 2527075218
1117 2550696254
1118 2552747689
1119 2553006633
1120 2597028579
1121 2599444601
1122 2601669954
1123 2643790754
1124 2643865468
1125 2643933198
1126 2643990685
1127 2644026641
1128 2644063267
1129 2644071750
1130 2644211676
1131 2644217357
1132 2644251539
1133 2644258867
1134 2644296174
1135 2644314447
1136 2644357408
1137 2722882889
1138 2738740000
1139 2738820708
1140 2738829971
1141 2738833188
1142 2738844245
1143 2738874716
1144 2739055622
1145 2739153767
1146 2739186345
1147 2739195687
1148 2739221314
1149 2739246381
1150 2739274195
1151 2739322163
1152 2739340404
1153 2739343239
1154 2753566716
1155 2765570231
1156 2774391074
1157 2816475403
1158 2819544219
1159 2819620153
1160 2821131913
1161 2839096825
1162 2839140973
1163 2842327405
1164 2842351988
1165 2842458183
1166 2842715617
1167 2856291714
1168 2857362369
1169 2857550980
1170 2857555831
1171 2857561740
1172 2857566857
1173 2885082269
1174 2885267077
1175 2900581617
1176 2904425639
1177 2904441681
1178 2904531397
1179 2904586948
1180 2904593019
1181 2904603171
1182 2916700801
1183 2919050967
1184 2919082019
1185 2919186011
1186 2919478207
1187 2919530591
1188 2923510776
1189 2928062596
1190 2928110288
1191 2928135095
1192 2928138578
1193 2928505359
1194 2932413440
1195 2932417500
1196 2941482795
1197 2945937008
1198 2990706264
1199 642423088
1200 644748090
1201 8040169876
1202 8055268332
1203 8055302350

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

6

336

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jv3-assembly1.cif.gz_A crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.9756 1 341
7jv3-assembly1.cif.gz_B crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.9732 1 341
7jv3-assembly2.cif.gz_E crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.9729 1 341
1m41-assembly1.cif.gz_A crystal structure of escherichia coli alkanesulfonate monooxygenase ssud at 2.3 a resolution 0.9696 1 336
7jv3-assembly2.cif.gz_E crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.9669 1 341
ID Description Score Start End Superfamily
1m41A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9696 1 336 3.20.20.30
1m41A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.929 1 336 3.20.20.30
3raoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8237 1 343 3.20.20.30
3raoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8146 1 343 3.20.20.30
3b9oB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8005 1 338 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A4Q5V6R6-F1-model_v4 deleted 0.9925 1 207
AF-A0A377VAN4-F1-model_v4 Alkanesulfonate monooxygenase (EC 1.14.14.5) 0.9909 1 112 GO:0008726
GO:0046306
AF-A0A0N0C4N8-F1-model_v4 Alkanesulfonate monooxygenase (EC 1.14.14.5) 0.9898 1 139 GO:0008726
GO:0046306
AF-A0A2R7TJ71-F1-model_v4 deleted 0.9894 1 133
AF-A0A528IC91-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9888 1 89 GO:0008726
GO:0046306

Map